BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus
Liberibacter asiaticus str. psy62]
         (373 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039815|gb|ACT56611.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62]
          Length = 373

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY
Sbjct: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
           FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK
Sbjct: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA
Sbjct: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE
Sbjct: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR
Sbjct: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII
Sbjct: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360

Query: 361 DSLFAIFYFAIGI 373
           DSLFAIFYFAIGI
Sbjct: 361 DSLFAIFYFAIGI 373


>gi|315122740|ref|YP_004063229.1| ABC transporter [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496142|gb|ADR52741.1| ABC transporter [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 211

 Score =  378 bits (971), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/211 (87%), Positives = 206/211 (97%)

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           +GV+GVPV+ILISFVTGAVIAQQGAFQLS FGAEIF+IDLMSILQLREIGVLLTAVM+AG
Sbjct: 1   MGVTGVPVIILISFVTGAVIAQQGAFQLSNFGAEIFAIDLMSILQLREIGVLLTAVMVAG 60

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSAIVAEIGSMKINEEID+++T+G+D VR+LISPRIWALIISLPLLTILAN+SAI+GA
Sbjct: 61  RSGSAIVAEIGSMKINEEIDSLKTIGIDLVRVLISPRIWALIISLPLLTILANYSAIVGA 120

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
           SI++WKYYDIPF+VFF+RFHSTATL N+FTGLIKAPFMACAIGIVAMKEGF VG +S+SL
Sbjct: 121 SIIVWKYYDIPFSVFFARFHSTATLGNVFTGLIKAPFMACAIGIVAMKEGFGVGTNSDSL 180

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           GK+VTTCVVQSIS+VIIIDSLFAIFYFAIGI
Sbjct: 181 GKRVTTCVVQSISMVIIIDSLFAIFYFAIGI 211


>gi|222086200|ref|YP_002544732.1| ABC transporter [Agrobacterium radiobacter K84]
 gi|221723648|gb|ACM26804.1| ABC transporter [Agrobacterium radiobacter K84]
          Length = 386

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 161/370 (43%), Positives = 242/370 (65%), Gaps = 18/370 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME--KYH 66
           +R  GNW+S  +  +   +     +S      ++DLS ++++DT GA LI    E  + H
Sbjct: 26  YRLEGNWRSANVHGVLRRIDELTTRS-AGGRVVIDLSDLSDVDTAGALLIRRLKESQEAH 84

Query: 67  G-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           G  + ++G ++HI++L  L +FT     +  +P++   +   + +   IG+ + +   + 
Sbjct: 85  GASVSIEGSNSHIDEL--LTAFTEDPDAEKPEPRQKKSWT--ERIFAPIGETVYEVWGNL 140

Query: 126 CSQAHILGLVISNTGEFCASSYKF-KGFLLS---LIRQMYYVGVSGVPVVILISFVTGAV 181
            +  +ILG  +        +  KF +G  +S   ++ Q+ ++GV  VP+++L+S++ GA+
Sbjct: 141 VAAMYILGSAVRG------AQLKFGRGSGVSPASIVNQIDHMGVRAVPIILLMSYLIGAI 194

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+
Sbjct: 195 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEV 254

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL ++LPLLTILANF+++ GA+ V W Y  I FA F +R 
Sbjct: 255 DALKVMGLNPIGVLIFPRLVALTVALPLLTILANFASLFGAATVTWAYSGITFATFIARL 314

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   +L+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV+SI +VI++D
Sbjct: 315 HEAISLSTVISGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKSIFVVILMD 374

Query: 362 SLFAIFYFAI 371
            LFA+FY AI
Sbjct: 375 GLFAMFYAAI 384


>gi|241204915|ref|YP_002976011.1| hypothetical protein Rleg_2195 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858805|gb|ACS56472.1| protein of unknown function DUF140 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 394

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 167/369 (45%), Positives = 237/369 (64%), Gaps = 19/369 (5%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF--MEKYHG 67
           R  GNW+S  I  +  D    + K  ++    VDLS I+EIDT G  L+      E+  G
Sbjct: 36  RLQGNWRSAYIHLVLRDFEKLLQK--KTGDLTVDLSDISEIDTAGIWLLCRLKKQEEAGG 93

Query: 68  K-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           + ++ +G ++HI+++  ++S    K    Q  + S     F      IGK   +  ++  
Sbjct: 94  RTVRFEGTNSHIDEMLEMVSEEPAKVEPEQTEKVSLAARIFA----PIGKMTYEVWDNFA 149

Query: 127 SQAHILGLVISNTGEFCASSYKF-KGFLLS---LIRQMYYVGVSGVPVVILISFVTGAVI 182
           +  +ILG  +        +  KF +G  +S   ++ Q+ ++GV  VP+++L+SF+ GA+I
Sbjct: 150 AAMYILGSAVRG------AQMKFGRGSGVSPASIVNQIDHMGVRAVPIILLMSFLIGAII 203

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEID
Sbjct: 204 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEID 263

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA+ V W Y  I FA F SR H
Sbjct: 264 ALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLGGAAAVAWGYSGITFANFLSRLH 323

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D 
Sbjct: 324 EAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTAAVVKAIFVVILMDG 383

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 384 LFAMFYAAI 392


>gi|116252407|ref|YP_768245.1| transmembrane component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257055|emb|CAK08149.1| putative transmembrane component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 389

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 168/369 (45%), Positives = 235/369 (63%), Gaps = 19/369 (5%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF--MEKYHG 67
           R  GNW+S  I  +  D    + K     S  VDLS I+EIDT G  L+      E+  G
Sbjct: 31  RLQGNWRSAYIHLVLRDFEKLLQKKTGDLS--VDLSDISEIDTAGIWLLCRLKKQEEAGG 88

Query: 68  K-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           + ++ +G ++HI+++  + S    K    Q  + S     F      IGK   +  ++  
Sbjct: 89  RTVRFEGTNSHIDEMLEMFSEEPAKVEPEQTEKVSLAARIFA----PIGKMTYEVWDNFA 144

Query: 127 SQAHILGLVISNTGEFCASSYKF-KGFLLS---LIRQMYYVGVSGVPVVILISFVTGAVI 182
           +  +ILG  +        +  KF +G  +S   ++ Q+ ++GV  VP+++L+SF+ GA+I
Sbjct: 145 AAMYILGSAVRG------AQMKFGRGSGVSPASIVNQIDHMGVRAVPIILLMSFLIGAII 198

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEID
Sbjct: 199 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEID 258

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA+ V W Y  I FA F SR H
Sbjct: 259 ALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLGGAAAVAWGYSGITFANFLSRLH 318

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D 
Sbjct: 319 EAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTAAVVKAIFVVILMDG 378

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 379 LFAMFYAAI 387


>gi|254710104|ref|ZP_05171915.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis B2/94]
 gi|261317653|ref|ZP_05956850.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261296876|gb|EEY00373.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 391

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNAVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|254693733|ref|ZP_05155561.1| hypothetical protein Babob3T_03544 [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214007|ref|ZP_05928288.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915614|gb|EEX82475.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 391

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLAALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|189024185|ref|YP_001934953.1| Sulfate transporter/antisigma-factor [Brucella abortus S19]
 gi|189019757|gb|ACD72479.1| Sulfate transporter/antisigma-factor [Brucella abortus S19]
          Length = 390

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 22  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 80

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 81  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 137

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 138 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 195

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 196 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 255

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 256 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 315

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 316 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 375

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 376 VVDGLFAMFYAAI 388


>gi|327190640|gb|EGE57728.1| putative ABC transporter, permease protein [Rhizobium etli
           CNPAF512]
          Length = 383

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 236/366 (64%), Gaps = 13/366 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM--EKYHG 67
           R +GNW+S  +  +  D    +++  ++ +  VDLS IT+IDT G  L+      E+  G
Sbjct: 25  RLSGNWRSAYVHLVLRDFEKLLHQ--KAGNLTVDLSEITDIDTAGIWLLCRLKKEEEAAG 82

Query: 68  K-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           + ++ +G + HI+++ ++ S    K     K + S        +   IGK      ++  
Sbjct: 83  RTVRFEGTNPHIDEMLAMFSEEPAKPEPEPKEKVSLA----ARILAPIGKMTYDVWDNLA 138

Query: 127 SQAHILGLVISNTG-EFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
           +  +ILG  +     +F   S        S++ Q+ ++GV  VP+++L+SF+ GA+IAQQ
Sbjct: 139 AAMYILGSAVRGAQMKFGRGSGVSPA---SIVNQIDHMGVRAVPIILLMSFLIGAIIAQQ 195

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEIDA++
Sbjct: 196 GAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEIDALK 255

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA++V W Y  I FA F +R H   
Sbjct: 256 VMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAVVAWGYSGITFANFLARLHEAV 315

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D LFA
Sbjct: 316 TLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKAIFVVILMDGLFA 375

Query: 366 IFYFAI 371
           +FY AI
Sbjct: 376 MFYAAI 381


>gi|190892035|ref|YP_001978577.1| probable ABC transporter, permease protein [Rhizobium etli CIAT
           652]
 gi|190697314|gb|ACE91399.1| probable ABC transporter, permease protein [Rhizobium etli CIAT
           652]
          Length = 389

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 236/366 (64%), Gaps = 13/366 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM--EKYHG 67
           R +GNW+S  +  +  D    +++  ++ +  VDLS IT+IDT G  L+      E+  G
Sbjct: 31  RLSGNWRSAYVHLVLRDFEKLLHQ--KTGNLTVDLSEITDIDTAGIWLLCRLKKEEEAAG 88

Query: 68  K-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           + ++ +G + HI+++ ++ S    K     K + S        +   IGK      ++  
Sbjct: 89  RTVRFEGTNPHIDEMLAMFSEEPAKPEPEPKEKVSLA----ARILAPIGKMTYDVWDNLA 144

Query: 127 SQAHILGLVISNTG-EFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
           +  +ILG  +     +F   S        S++ Q+ ++GV  VP+++L+SF+ GA+IAQQ
Sbjct: 145 AAMYILGSAVRGAQMKFGRGSGVSPA---SIVNQIDHMGVRAVPIILLMSFLIGAIIAQQ 201

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEIDA++
Sbjct: 202 GAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEIDALK 261

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA++V W Y  I FA F +R H   
Sbjct: 262 VMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAVVAWGYSGITFANFLARLHEAV 321

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D LFA
Sbjct: 322 TLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKAIFVVILMDGLFA 381

Query: 366 IFYFAI 371
           +FY AI
Sbjct: 382 MFYAAI 387


>gi|23501899|ref|NP_698026.1| toulene ABC transporter permease [Brucella suis 1330]
 gi|62289942|ref|YP_221735.1| toulene ABC transporter permease [Brucella abortus bv. 1 str.
           9-941]
 gi|82699870|ref|YP_414444.1| sulfate transporter [Brucella melitensis biovar Abortus 2308]
 gi|237815443|ref|ZP_04594441.1| toulene ABC transporter, permease protein [Brucella abortus str.
           2308 A]
 gi|254697384|ref|ZP_05159212.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254706786|ref|ZP_05168614.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis
           M163/99/10]
 gi|254730282|ref|ZP_05188860.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 4 str.
           292]
 gi|256031600|ref|ZP_05445214.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis
           M292/94/1]
 gi|256159738|ref|ZP_05457485.1| Sulfate transporter/antisigma-factor [Brucella ceti M490/95/1]
 gi|256255000|ref|ZP_05460536.1| Sulfate transporter/antisigma-factor [Brucella ceti B1/94]
 gi|256257499|ref|ZP_05463035.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 9 str.
           C68]
 gi|256369443|ref|YP_003106951.1| toluene ABC transporter, permease protein, putative [Brucella
           microti CCM 4915]
 gi|260545309|ref|ZP_05821050.1| sulfate transporter/antisigma-factor [Brucella abortus NCTC 8038]
 gi|260757978|ref|ZP_05870326.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761801|ref|ZP_05874144.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883775|ref|ZP_05895389.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261222188|ref|ZP_05936469.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314254|ref|ZP_05953451.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|265988688|ref|ZP_06101245.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265998152|ref|ZP_06110709.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297248343|ref|ZP_06932061.1| ABC transport system permease [Brucella abortus bv. 5 str. B3196]
 gi|23347840|gb|AAN29941.1| toulene ABC transporter, permease protein, putative [Brucella suis
           1330]
 gi|62196074|gb|AAX74374.1| hypothetical toulene ABC transporter, permease protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615971|emb|CAJ10994.1| Sulfate transporter/antisigma-factor antagonist STAS:Protein of
           unknown function DUF140 [Brucella melitensis biovar
           Abortus 2308]
 gi|237790280|gb|EEP64490.1| toulene ABC transporter, permease protein [Brucella abortus str.
           2308 A]
 gi|255999603|gb|ACU48002.1| toluene ABC transporter, permease protein, putative [Brucella
           microti CCM 4915]
 gi|260096716|gb|EEW80591.1| sulfate transporter/antisigma-factor [Brucella abortus NCTC 8038]
 gi|260668296|gb|EEX55236.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672233|gb|EEX59054.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260873303|gb|EEX80372.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260920772|gb|EEX87425.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261303280|gb|EEY06777.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262552620|gb|EEZ08610.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264660885|gb|EEZ31146.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|297175512|gb|EFH34859.1| ABC transport system permease [Brucella abortus bv. 5 str. B3196]
          Length = 391

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|294852390|ref|ZP_06793063.1| ABC transport system permease [Brucella sp. NVSL 07-0026]
 gi|294820979|gb|EFG37978.1| ABC transport system permease [Brucella sp. NVSL 07-0026]
          Length = 391

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+++L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIIVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|254689249|ref|ZP_05152503.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 6 str.
           870]
 gi|260754755|ref|ZP_05867103.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260674863|gb|EEX61684.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 391

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 229/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++   K   ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKYVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|225627497|ref|ZP_03785534.1| toulene ABC transporter permease protein [Brucella ceti str. Cudo]
 gi|260168729|ref|ZP_05755540.1| Sulfate transporter/antisigma-factor [Brucella sp. F5/99]
 gi|261758207|ref|ZP_06001916.1| sulfate transporter/antisigma-factor [Brucella sp. F5/99]
 gi|225617502|gb|EEH14547.1| toulene ABC transporter permease protein [Brucella ceti str. Cudo]
 gi|261738191|gb|EEY26187.1| sulfate transporter/antisigma-factor [Brucella sp. F5/99]
          Length = 391

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++   K   ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKYVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM   GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRTGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|17987248|ref|NP_539882.1| toluene tolerance protein Ttg2B [Brucella melitensis bv. 1 str.
           16M]
 gi|17982923|gb|AAL52146.1| toluene tolerance protein ttg2b [Brucella melitensis bv. 1 str.
           16M]
          Length = 390

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 22  EQDGMRVIHLSGPWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 80

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 81  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 137

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 138 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 195

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 196 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 255

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 256 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 315

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 316 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 375

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 376 VVDGLFAMFYAAI 388


>gi|225852524|ref|YP_002732757.1| hypothetical protein BMEA_A1060 [Brucella melitensis ATCC 23457]
 gi|256044678|ref|ZP_05447582.1| hypothetical protein Bmelb1R_09298 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113572|ref|ZP_05454392.1| hypothetical protein Bmelb3E_12477 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263986|ref|ZP_05466518.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 2
           str. 63/9]
 gi|260564024|ref|ZP_05834510.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 1
           str. 16M]
 gi|265991102|ref|ZP_06103659.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994939|ref|ZP_06107496.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225640889|gb|ACO00803.1| protein of unknown function DUF140 [Brucella melitensis ATCC 23457]
 gi|260154040|gb|EEW89132.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 1
           str. 16M]
 gi|262766052|gb|EEZ11841.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001886|gb|EEZ14461.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094130|gb|EEZ18052.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 2
           str. 63/9]
 gi|326409040|gb|ADZ66105.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538749|gb|ADZ86964.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 391

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGPWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|86357964|ref|YP_469856.1| ABC transporter permease [Rhizobium etli CFN 42]
 gi|86282066|gb|ABC91129.1| probable ABC transporter, permease protein [Rhizobium etli CFN 42]
          Length = 389

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 161/372 (43%), Positives = 232/372 (62%), Gaps = 25/372 (6%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSA---IVDLSAITEIDTIGAELIMYF--MEK 64
           R +GNW+S  +      +V+   + +Q +      +DLS +++IDT G  L+      E+
Sbjct: 31  RLSGNWRSAYVH-----LVLHEFEKLQREKTGNLTLDLSDVSDIDTAGIWLLCRLKKQEE 85

Query: 65  YHGK-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
             G+ ++  G + HI+++  + S    K    QK + S        L    GK      +
Sbjct: 86  AAGRTVRFVGTNPHIDEMLEMFSEEPAKPEPEQKEKVSLAARILAPL----GKMTYDIWD 141

Query: 124 DSCSQAHILGLVISNT----GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +  +  +ILG  +       G     S        S++ Q+ ++GV  VP+++L+SF+ G
Sbjct: 142 NLAASMYILGSAVRGAQMKLGRGSGVSPA------SIVNQIDHMGVRAVPIILLMSFLIG 195

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           A+IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ E
Sbjct: 196 AIIAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMRE 255

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA++V W Y  I FA F +
Sbjct: 256 EIDALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAVVAWGYSGITFANFLA 315

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI+
Sbjct: 316 RLHEAITLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKAIFVVIL 375

Query: 360 IDSLFAIFYFAI 371
           +D LFA+FY AI
Sbjct: 376 MDGLFAMFYAAI 387


>gi|254714105|ref|ZP_05175916.1| Sulfate transporter/antisigma-factor [Brucella ceti M644/93/1]
 gi|254716838|ref|ZP_05178649.1| Sulfate transporter/antisigma-factor [Brucella ceti M13/05/1]
 gi|261218640|ref|ZP_05932921.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261321862|ref|ZP_05961059.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260923729|gb|EEX90297.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294552|gb|EEX98048.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 391

 Score =  282 bits (722), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 158/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++GI V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGIRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+G LLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGGLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|254719095|ref|ZP_05180906.1| Sulfate transporter/antisigma-factor [Brucella sp. 83/13]
 gi|265984086|ref|ZP_06096821.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306838379|ref|ZP_07471224.1| Sulfate transporter/antisigma-factor [Brucella sp. NF 2653]
 gi|264662678|gb|EEZ32939.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306406519|gb|EFM62753.1| Sulfate transporter/antisigma-factor [Brucella sp. NF 2653]
          Length = 391

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FG EIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGTEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|163843287|ref|YP_001627691.1| hypothetical protein BSUIS_A1062 [Brucella suis ATCC 23445]
 gi|163674010|gb|ABY38121.1| protein of unknown function DUF140 [Brucella suis ATCC 23445]
          Length = 391

 Score =  282 bits (721), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY  I
Sbjct: 377 VVDGLFAMFYATI 389


>gi|306840506|ref|ZP_07473265.1| Sulfate transporter/antisigma-factor [Brucella sp. BO2]
 gi|306843893|ref|ZP_07476488.1| Sulfate transporter/antisigma-factor [Brucella sp. BO1]
 gi|306275648|gb|EFM57372.1| Sulfate transporter/antisigma-factor [Brucella sp. BO1]
 gi|306289521|gb|EFM60739.1| Sulfate transporter/antisigma-factor [Brucella sp. BO2]
          Length = 391

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G  V   +G+W S  + ++ DD +  I ++    +  +D+S I+ +DT GA LI   
Sbjct: 23  EQDGARVIHLSGHWISQSV-QLVDDKMRGIEQAGGDKATTIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D +FA+FY AI
Sbjct: 377 VVDGMFAMFYAAI 389


>gi|256061111|ref|ZP_05451265.1| hypothetical protein Bneo5_12197 [Brucella neotomae 5K33]
 gi|261325112|ref|ZP_05964309.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301092|gb|EEY04589.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 391

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LP LTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPPLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|161618971|ref|YP_001592858.1| hypothetical protein BCAN_A1034 [Brucella canis ATCC 23365]
 gi|254704312|ref|ZP_05166140.1| hypothetical protein Bsuib36_10354 [Brucella suis bv. 3 str. 686]
 gi|260566441|ref|ZP_05836911.1| sulfate transporter/antisigma-factor [Brucella suis bv. 4 str. 40]
 gi|261754981|ref|ZP_05998690.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161335782|gb|ABX62087.1| protein of unknown function DUF140 [Brucella canis ATCC 23365]
 gi|260155959|gb|EEW91039.1| sulfate transporter/antisigma-factor [Brucella suis bv. 4 str. 40]
 gi|261744734|gb|EEY32660.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 391

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           S  H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SHLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|110633893|ref|YP_674101.1| hypothetical protein Meso_1540 [Mesorhizobium sp. BNC1]
 gi|110284877|gb|ABG62936.1| protein of unknown function DUF140 [Chelativorans sp. BNC1]
          Length = 395

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 163/373 (43%), Positives = 227/373 (60%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELI--M 59
            ENG  V R +GNW +  +S + DD +  +         I+DL  +  +DT GA L+  +
Sbjct: 27  EENGALVCRLSGNWTTRTVS-LVDDPMRRLRARKGLTHFIIDLGDVGHLDTAGAWLVSRL 85

Query: 60  YFMEKYHG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
              +K +G ++++ G S     L + I  T ++      P+     N   N+   +G+ I
Sbjct: 86  AAAQKENGAQVEISGQSEAASILLAAIEPTAQEP---DVPKDGRRGNLIVNILAAMGRTI 142

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
               +D     HILG  IS         +      ++   Q+  +GV  +P+++L+S V 
Sbjct: 143 YDIKDDVLYGMHILGATISGAQMKLGRGHAVNPAAIA--NQIDRMGVGSIPIIVLMSAVV 200

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEI+ +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 201 GAIIAQQGAFQLRWFGAEIYVVDLVGILILRELGVLLTAIMIAGRSGSAITAEIGSMKMR 260

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+  +GL+ V +L+ PR+ AL++++P LTI+ANFSA+ GA +V W Y DI  A F 
Sbjct: 261 EEVDALTVIGLNPVGVLVFPRLVALVVAVPCLTIVANFSALGGAILVAWLYSDIMPATFI 320

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R H    L +IF GLIKAPFMA  IGI+A  EG  VG  + SLGK VT  VV++I +VI
Sbjct: 321 QRLHDAIDLTSIFAGLIKAPFMALIIGIIASVEGMKVGGSAESLGKHVTASVVKTIFLVI 380

Query: 359 IIDSLFAIFYFAI 371
           +ID LFA+FY AI
Sbjct: 381 VIDGLFAMFYAAI 393


>gi|254701770|ref|ZP_05163598.1| Sulfate transporter/antisigma-factor [Brucella suis bv. 5 str. 513]
 gi|261752323|ref|ZP_05996032.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261742076|gb|EEY30002.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 391

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 228/373 (61%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI   
Sbjct: 23  EQDGMRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++    H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  +
Sbjct: 82  RQRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P+V+L+S + 
Sbjct: 139 ISMFNDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIVVLMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V   Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSCLYSNISPEAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|222148407|ref|YP_002549364.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4]
 gi|221735395|gb|ACM36358.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4]
          Length = 376

 Score =  277 bits (709), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 231/365 (63%), Gaps = 11/365 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELI--MYFMEKYH 66
            R +G+W++  +  +   + + + +++     I D++ I+ +DT GA +I  +       
Sbjct: 19  LRLSGSWRNTTVDTVIPKL-LELRETLNGHVEI-DITGISSLDTSGAWIIRRIELAASKQ 76

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           G +++ G S  + +L S  +   +  +  +   R  F   F+ +   +GK  V    D  
Sbjct: 77  GDVQIVGGSDAMRELIS--ALPEQPPLPEKVVDRRPF---FQRVLEPVGKMSVSLFEDVL 131

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           + +++LG  +  T          +  + S++ Q+ ++G+  VP+++L+SF+ GA+IAQQG
Sbjct: 132 AMSYVLGSAVRGTQ--SKERRGGRASIASIVNQLDHMGLRAVPIILLMSFLIGAIIAQQG 189

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           AFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+DA++ 
Sbjct: 190 AFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVDALKV 249

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PRI AL+I+LPLLT++ANF+A+ GA++V + Y  I F VF +R H    
Sbjct: 250 IGLNPIGVLVLPRIVALVIALPLLTVIANFAALYGAAVVSFAYSGITFQVFVTRLHDAVD 309

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            A    GLIKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV+SI +VI++D LFA+
Sbjct: 310 YATFAAGLIKAPFMAVVIGIVAAVEGMKVGGSAESLGQHVTASVVKSIFVVILMDGLFAV 369

Query: 367 FYFAI 371
           FY AI
Sbjct: 370 FYAAI 374


>gi|209549578|ref|YP_002281495.1| hypothetical protein Rleg2_1984 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535334|gb|ACI55269.1| protein of unknown function DUF140 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 383

 Score =  276 bits (706), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 162/366 (44%), Positives = 232/366 (63%), Gaps = 13/366 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM--EKYHG 67
           R  GNW+S  +  +  D    +++  ++    VDLS IT+IDT G  L+      E+  G
Sbjct: 25  RLKGNWRSAYVHFVLRDFEKLLHQ--KAGDLTVDLSDITDIDTAGIWLLCRLKKEEEAAG 82

Query: 68  K-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           + ++ +G + HI+++  + S    K     K + S        +   IG+      ++  
Sbjct: 83  RTVRFEGTNPHIDEMLEMFSEEPAKPEPELKEKVSLA----ARILAPIGRMTYDIWDNFA 138

Query: 127 SQAHILGLVISNTG-EFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
           +  +ILG  +     +F   S        S++ Q+ ++GV  VP+++L+SF+ GA+IAQQ
Sbjct: 139 AAMYILGSAVRGAQMKFGRGSGVSPA---SIVNQIDHMGVRAVPIILLMSFLIGAIIAQQ 195

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEIDA++
Sbjct: 196 GAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEIDALK 255

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA+ V W Y  I FA F SR H   
Sbjct: 256 VMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAAVAWGYSGITFANFLSRLHEAV 315

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D LFA
Sbjct: 316 TLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTAAVVKAIFVVILMDGLFA 375

Query: 366 IFYFAI 371
           +FY AI
Sbjct: 376 MFYAAI 381


>gi|148560485|ref|YP_001258960.1| putative toulene ABC transporter permease [Brucella ovis ATCC
           25840]
 gi|148371742|gb|ABQ61721.1| putative toulene ABC transporter, permease protein [Brucella ovis
           ATCC 25840]
          Length = 365

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 225/369 (60%), Gaps = 9/369 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
           + V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    ++ 
Sbjct: 1   MRVIHLSGHWISQSV-HLVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLRQRL 59

Query: 66  ---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
              H  ++L+GV      L   +     + +   + +  FF+ +F N+   +G  ++   
Sbjct: 60  AAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNV---LGGAVISMF 116

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                + +++ QM  +GV  +P+++L+S + GA+I
Sbjct: 117 NDFKMAMHILGATIRGAQLKYGRGNGIP--IAAIVTQMDRMGVGAIPIIVLMSTIVGAII 174

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEI SMK+ EE D
Sbjct: 175 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEISSMKMREETD 234

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 235 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 294

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 295 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 354

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 355 LFAMFYAAI 363


>gi|159184854|ref|NP_354638.2| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
 gi|159140135|gb|AAK87423.2| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
          Length = 386

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 166/374 (44%), Positives = 232/374 (62%), Gaps = 18/374 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF-- 61
            G + +  +G+W++  +S I + +   I KS  +    +DLSA+  IDT GA +I     
Sbjct: 23  GGGSRYVLSGSWRNSNLSGIFESLDR-IEKSKPASPVDIDLSAVEAIDTTGAWIIQRLRK 81

Query: 62  -MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
            +E     + L G +  IE +        + ++  +   R       + +   IG+ +V+
Sbjct: 82  DLEASGATVTLTG-NDRIEDVIG--QLPDKAEMDVEPVAREGL---VERIFAPIGQAVVQ 135

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS---LIRQMYYVGVSGVPVVILISFV 177
              D  +  +ILG  +       A     +G  +S   ++ Q+ ++GV  VP+++L+SF+
Sbjct: 136 NGADFLAGMYILGSAVRG-----AQMKLGRGRGVSPAAIVNQIDHMGVRAVPIIMLMSFL 190

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            GA+IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+
Sbjct: 191 IGAIIAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKM 250

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EEIDA++ +GL+ V +L+ PR+ AL I+LPLLTILANF+A+ GA+IV   Y  I F VF
Sbjct: 251 REEIDALKVIGLNPVGVLVFPRLVALTIALPLLTILANFAALFGAAIVALAYSGITFEVF 310

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            SR H     + I  G+IKAPFMA  IGIVA  EG  VG  + SLGK VT+ VV+SI +V
Sbjct: 311 LSRLHGAVEESTIAAGMIKAPFMALIIGIVAAVEGMKVGGSAESLGKHVTSSVVKSIFVV 370

Query: 358 IIIDSLFAIFYFAI 371
           I++D LFAIFY AI
Sbjct: 371 ILVDGLFAIFYAAI 384


>gi|239831972|ref|ZP_04680301.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824239|gb|EEQ95807.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 391

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 159/377 (42%), Positives = 227/377 (60%), Gaps = 17/377 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
             +G+   R  G W S  ++ + DD V  +  + + ++ I+D+S ++ +DT GA LI   
Sbjct: 23  EHDGVRHIRMNGRWVSQSVN-LVDDKVRRLENADKREATIIDISGVSGLDTAGAWLIERL 81

Query: 62  MEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++      +++L+GV      L   +     + +   + ++ FF  SF      +G  +
Sbjct: 82  RQRLVAQQVEVQLEGVRQSWLPLMEEVGQAVERTLDIPRQKKPFFLISF---LAALGGGV 138

Query: 119 VKFINDSCSQAHILGLVISNT----GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
           V   +D     HILG  I       G    S   F     +++ QM  +GV  +P++IL+
Sbjct: 139 VSLGSDFKMAMHILGATIRGAQLKYGR--GSGIPFA----AIVTQMDRMGVGAIPIIILM 192

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           S + GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGS
Sbjct: 193 STIVGAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGS 252

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MK+ EE DA+  +GL+ V +L+ PR+ AL+I LPLLTI+++ +A+IGA  V W Y +I  
Sbjct: 253 MKMREETDALTVIGLNPVGVLVFPRLVALVIVLPLLTIVSDLAALIGAGGVAWFYSNISP 312

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I
Sbjct: 313 DAFISRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAI 372

Query: 355 SIVIIIDSLFAIFYFAI 371
            +VI++D LFA+FY AI
Sbjct: 373 FVVIVVDGLFAMFYAAI 389


>gi|325293034|ref|YP_004278898.1| ABC transporter transmembrane protein [Agrobacterium sp. H13-3]
 gi|325060887|gb|ADY64578.1| ABC transporter, membrane spanning protein [Agrobacterium sp.
           H13-3]
          Length = 386

 Score =  273 bits (698), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 168/369 (45%), Positives = 228/369 (61%), Gaps = 18/369 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
           +  +G+W++  +S I   +   I KS  +    +DLS++  IDT GA +I    E    K
Sbjct: 28  YALSGSWRNSNLSGIFARL-ENIEKSGPAGPVEIDLSSVEAIDTTGAWVIRRLREDMEAK 86

Query: 69  IKLQGVS---THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
               GV+   T  E++  LI     K     +P         +     IG+ +V+   D 
Sbjct: 87  ----GVTVTLTGNERIEDLIGQLPDKAAMEGEPVAKVGLA--ERFFSPIGQAVVQNGADF 140

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLS---LIRQMYYVGVSGVPVVILISFVTGAVI 182
            +  +ILG  +       A     +G  +S   ++ Q+ ++GV  VP+++L+SF+ GA+I
Sbjct: 141 LAGMYILGSAVRG-----AQMKLGRGRGVSPAAIVNQIDHMGVRAVPIIMLMSFLIGAII 195

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EEID
Sbjct: 196 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEID 255

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ V +L+ PR+ AL I+LPLLTILANF+A+ GA+IV   Y  I F VF SR H
Sbjct: 256 ALKVIGLNPVGVLVFPRLVALTIALPLLTILANFAALFGAAIVTLLYSGITFEVFLSRLH 315

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                + I  G+IKAPFMA  IGIVA  EG  VG  + SLGK VT+ VV+SI +VI++D 
Sbjct: 316 GAVEESTIAAGMIKAPFMALIIGIVAAVEGMKVGGSAESLGKHVTSSVVKSIFVVILVDG 375

Query: 363 LFAIFYFAI 371
           LFAIFY AI
Sbjct: 376 LFAIFYAAI 384


>gi|13470959|ref|NP_102528.1| permease of ABC transporter [Mesorhizobium loti MAFF303099]
 gi|14021702|dbj|BAB48314.1| permease of ABC transporter [Mesorhizobium loti MAFF303099]
          Length = 395

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 225/373 (60%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            E G+    F+G W +  ++ I  D+   I K     +  +DLS I +IDT GA LI   
Sbjct: 27  EEAGVLGCAFSGIWTTRTVALIDADM-RKIEKRSGFKTLALDLSKIEKIDTAGAWLIDRL 85

Query: 62  M---EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           +   EK + +++LQG S     L   +    R++     P R    N        +G+++
Sbjct: 86  VSAFEKKNVEVRLQGQSEIASILLDAVGEAVRRE-PESGPARP--PNIIIRALEAVGRRV 142

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
            +  +D  +  +ILG  I          +       ++  Q+  +GV  +PVV+L+S + 
Sbjct: 143 YEMRDDFLASMNILGATIRGAQMKLGRGHAVNP--AAIFNQIDRMGVGAIPVVVLMSAIV 200

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA++AQQGA+QLS FGA+IF +DL+ +L LRE+GVL+TA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 201 GAIVAQQGAYQLSYFGADIFVVDLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMR 260

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA++ +GL+ + +L+ PR+ AL+I+LP LTI+ANF+A+ G  +  W Y DIP A F 
Sbjct: 261 EEVDALKVIGLNPIGVLVFPRLVALVIALPCLTIIANFAALGGGIVAAWLYSDIPPAAFI 320

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R      L+ IF GLIKAPFMA  IG +A  EG  VG  + SLG+ VT  VV+SI +VI
Sbjct: 321 DRLRVAIDLSTIFAGLIKAPFMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVI 380

Query: 359 IIDSLFAIFYFAI 371
           I+D LFA+FY AI
Sbjct: 381 ILDGLFAMFYAAI 393


>gi|182680563|ref|YP_001834709.1| hypothetical protein Bind_3668 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636446|gb|ACB97220.1| protein of unknown function DUF140 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 377

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 152/370 (41%), Positives = 224/370 (60%), Gaps = 19/370 (5%)

Query: 9   FRFAGNWK---SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
           F  AG+W    S  +   A D++ A+ K+     A+ +L+ +  +DT GA LI    ++ 
Sbjct: 18  FSLAGHWTLEWSKGLESAAADLLKALGKA---RKAVFNLAGVERLDTAGAWLI----DRT 70

Query: 66  HGKIKLQGVSTHIEQLFS----LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              +  +GVST ++ +      L    H +     K Q + F   F       GK +V+ 
Sbjct: 71  RRNLSERGVSTELDHVRPEYGILFQEAHFRTFPEPKRQNASF---FVAPLVETGKTVVEA 127

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             ++      LG  I++  +       F+G  +SL+ Q+  +G+  VP++ LI+F+ G +
Sbjct: 128 GRETLRGMSFLGEAIASLAQSFVQRQHFRG--ISLVYQIETIGLRSVPIITLINFLVGCI 185

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +AQQG FQL +FGA  F++DL+ IL LRE+GVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 186 VAQQGLFQLRRFGASTFAVDLLGILTLRELGVLLTSIMIAGRSGSAITAEIGSMKMREEI 245

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MGL  + +LI PR+ AL+ISLPLLT +A+ +A+ G  +V + Y  I    F +R 
Sbjct: 246 DALTVMGLRPIEVLIVPRLLALVISLPLLTFIADMAALAGGLLVSYSYGGIQPVAFLNRL 305

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   +L   +TGLIKAPFMA  IG++A  EGFAV   + SLG++VTT VV+SI +VI++D
Sbjct: 306 HDAISLHTFYTGLIKAPFMALVIGLIAAVEGFAVEGSAESLGRQVTTSVVKSIFMVIVLD 365

Query: 362 SLFAIFYFAI 371
            LFA+F+  I
Sbjct: 366 GLFAMFFAGI 375


>gi|319783795|ref|YP_004143271.1| hypothetical protein Mesci_4108 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169683|gb|ADV13221.1| protein of unknown function DUF140 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 395

 Score =  263 bits (672), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 153/373 (41%), Positives = 224/373 (60%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            E+G+    F+G W +  ++ + D  +  I K     +  +D+S I ++DT GA LI   
Sbjct: 27  EEDGVLGCAFSGIWTTRTVA-LVDADMRKIEKRSGFKTLALDVSKIEKMDTAGAWLIDRL 85

Query: 62  MEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           +  +  K   I++QG S     L   +    R++     P R    N        +G+++
Sbjct: 86  VSAFEKKGVEIQMQGQSEIASILLEAVGEAVRRE-PESGPVRP--PNIVIRALEAVGRRV 142

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
            +  +D  +  +ILG  I          +       ++  Q+  +GV  +PVV+L+S + 
Sbjct: 143 YEMRDDFLASMNILGATIRGAQMKLGRGHAVN--PAAIFNQIDRMGVGAIPVVVLMSAIV 200

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA++AQQGA+QLS FGA+IF +DL+ +L LRE+GVL+TA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 201 GAIVAQQGAYQLSYFGADIFVVDLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMR 260

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA++ +GL+ + +L+ PR+ AL+I+LP LTI+ANF+A+ G  +  W Y DIP A F 
Sbjct: 261 EEVDALKVIGLNPIGVLVFPRLVALVIALPCLTIIANFAALGGGILAAWLYSDIPPAAFI 320

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R      L+ IF GLIKAPFMA  IG +A  EG  VG  + SLG+ VT  VV+SI +VI
Sbjct: 321 DRLRVAIDLSTIFAGLIKAPFMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVI 380

Query: 359 IIDSLFAIFYFAI 371
           I+D LFA+FY AI
Sbjct: 381 ILDGLFAMFYAAI 393


>gi|260463968|ref|ZP_05812164.1| protein of unknown function DUF140 [Mesorhizobium opportunistum
           WSM2075]
 gi|259030343|gb|EEW31623.1| protein of unknown function DUF140 [Mesorhizobium opportunistum
           WSM2075]
          Length = 395

 Score =  262 bits (670), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 224/373 (60%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            E G+    F+G W +  ++ I  D+   I K     +  +DLS I +IDT GA LI   
Sbjct: 27  EEGGVLGCAFSGVWTTRTVALIDADM-RKIEKRSGFKTLALDLSKIEKIDTAGAWLIDRL 85

Query: 62  M---EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           +   EK + +++LQG S     L   +    R++     P R    N        +G+++
Sbjct: 86  VSVFEKKNVEVQLQGRSEIASILLDAVGEAVRRE-PESGPARP--PNIVLRALEAVGRRV 142

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
            +  +D  +  +ILG  I          +       ++  Q+  +GV  +PVV+L+S + 
Sbjct: 143 YEMRDDFLASMNILGATIRGAQMKLGRGHAVNP--AAIFNQIDRMGVGAIPVVVLMSAIV 200

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA++AQQGA+QLS FGA+IF +DL+ +L LRE+GVL+TA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 201 GAIVAQQGAYQLSYFGADIFVVDLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMR 260

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA++ +GL+ + +L+ PR+ AL+I+LP LTI+ANF+A+ G     W Y DIP A F 
Sbjct: 261 EEVDALKVIGLNPIGVLVFPRLVALVIALPCLTIIANFAALGGGIAAAWLYSDIPPAAFL 320

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R      L+ IF GLIKAPFMA  IG +A  EG  VG  + SLG+ VT  VV+SI +VI
Sbjct: 321 DRLRVAIDLSTIFAGLIKAPFMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVI 380

Query: 359 IIDSLFAIFYFAI 371
           I+D LFA+FY AI
Sbjct: 381 ILDGLFAMFYAAI 393


>gi|114707109|ref|ZP_01440007.1| permease of ABC transporter [Fulvimarina pelagi HTCC2506]
 gi|114537305|gb|EAU40431.1| permease of ABC transporter [Fulvimarina pelagi HTCC2506]
          Length = 394

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 143/375 (38%), Positives = 229/375 (61%), Gaps = 11/375 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G  V   AG+W +  I  I  D+       + +D A+ DLS + +IDT GA ++    
Sbjct: 27  RGGTLVLEAAGDWLARTIGSIESDLERTARADLGADVAM-DLSRVGQIDTAGAFVLERLK 85

Query: 63  EKYHGK---IKLQGVSTHIEQLFSLI-SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                K   ++++G++     LF+ + S   R++   Q+ +     N+       +G  +
Sbjct: 86  RDLRAKREHVEVEGLAERNTALFAAVGSAMDRERPVRQRERSKILTNAV----IAVGSFV 141

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ++  +  +++G  +   G   +   + +    ++  Q+  +GV  +P+++LI+F+ 
Sbjct: 142 IGIKDELVNGLNLIGGAMYGAGSRISGRTQSR--PAAIFNQIDQMGVKAIPIIVLITFLV 199

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G +IAQQGAFQL ++G E+++++L+SIL LREIGVLL A+MIAGRSGSAI AEIGSMK+ 
Sbjct: 200 GGIIAQQGAFQLRRYGGEVYAVNLISILVLREIGVLLAAIMIAGRSGSAICAEIGSMKMR 259

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+  +GL+ + +L+ PR+ AL I+LPLLT++AN +A++G +I +  Y DI F  F 
Sbjct: 260 EEVDALHVIGLNPIGVLVFPRLVALSIALPLLTVIANLAALVGGAITLRIYSDISFLNFL 319

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
                +  L  +F+GL+KAPFMA  IG+VA  EG  VG  + SLG +VT  VV+SI +VI
Sbjct: 320 QGLQQSIDLFTVFSGLLKAPFMAILIGLVAANEGMKVGGSAESLGLRVTAAVVKSIFLVI 379

Query: 359 IIDSLFAIFYFAIGI 373
           ++D LFAIFY +IG+
Sbjct: 380 VMDGLFAIFYASIGL 394


>gi|153009437|ref|YP_001370652.1| hypothetical protein Oant_2107 [Ochrobactrum anthropi ATCC 49188]
 gi|151561325|gb|ABS14823.1| protein of unknown function DUF140 [Ochrobactrum anthropi ATCC
           49188]
          Length = 391

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 156/373 (41%), Positives = 227/373 (60%), Gaps = 9/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G    R +G W S  ++ + DD + ++ K+ +  + I+D+S ++ +DT GA LI   
Sbjct: 23  EQDGARHIRLSGRWVSQSVN-LVDDKMRSLEKTDEHKATIIDVSGVSGLDTAGAWLIERL 81

Query: 62  MEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            ++   K    +L+GV      L   +     + +   + ++ FF+ SF      +G  +
Sbjct: 82  RQRLVAKSADAQLEGVRQSWLPLMEEVGQAVERTLDIPRQKKPFFFISF---LAALGGGV 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +   ND     HILG  I                + +++ QM  +GV  +P++IL+S + 
Sbjct: 139 ISMGNDFKMAMHILGATIRGAQLKYGRGSGIP--IAAIVTQMDRMGVGAIPIIILMSTIV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ 
Sbjct: 197 GAIIAQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMR 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  +GL+ V +L+ PR+ AL++ LPLLTI+++ +A+IGA  V W Y +I    F 
Sbjct: 257 EETDALTVIGLNPVGVLVFPRLVALVVVLPLLTIISDLAALIGAGGVAWFYSNISPDAFI 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           SR H    L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI
Sbjct: 317 SRLHDAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVI 376

Query: 359 IIDSLFAIFYFAI 371
           ++D LFA+FY AI
Sbjct: 377 VVDGLFAMFYAAI 389


>gi|15965586|ref|NP_385939.1| hypothetical protein SMc00174 [Sinorhizobium meliloti 1021]
 gi|307302706|ref|ZP_07582462.1| protein of unknown function DUF140 [Sinorhizobium meliloti BL225C]
 gi|307318554|ref|ZP_07597988.1| protein of unknown function DUF140 [Sinorhizobium meliloti AK83]
 gi|15074767|emb|CAC46412.1| Probable ABC transporter [Sinorhizobium meliloti 1021]
 gi|306895894|gb|EFN26646.1| protein of unknown function DUF140 [Sinorhizobium meliloti AK83]
 gi|306903070|gb|EFN33661.1| protein of unknown function DUF140 [Sinorhizobium meliloti BL225C]
          Length = 379

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 159/366 (43%), Positives = 223/366 (60%), Gaps = 20/366 (5%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
           F+G+W+  E +E     +  + K     S   D S IT +DT GA +I  FM     +++
Sbjct: 27  FSGDWRH-ETAEAMAAKLKRLEKPAGGQSEF-DFSGITRMDTAGAWIIRRFMNGTADEVR 84

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNS-FKNLHYHIGKKIVKFINDSCSQA 129
             G   + E + +L      K+++  +P+ S      F+ L   +G+  V    D+ +  
Sbjct: 85  FTGGERYAELVRAL-----PKQLR--RPEESATRMPLFQRLFTPVGELTVSIWTDTVAAM 137

Query: 130 HILGLVISNT----GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            ILG  +       G     S        +++ Q+  +GV   P++ L+SF+ GA+IAQQ
Sbjct: 138 FILGSAVRGAQMKLGRHAGVSPA------AIVHQIDRMGVMATPIITLMSFLIGAIIAQQ 191

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GAFQL  FGAEIF +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+DA++
Sbjct: 192 GAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVDALK 251

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL  V +L+ PR+ AL I LPLLTI+ANF+A+ GA++V W Y DI    F +R     
Sbjct: 252 VMGLSPVGVLVFPRLVALTIVLPLLTIIANFAALAGAAMVAWTYSDITIPTFLARLQEAV 311

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
             +++  G+IKAPFMA  IG+VA  EG  VG  + SLG++VT+ VV+SI +VI+ID LFA
Sbjct: 312 DFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTSSVVKSIFVVILIDGLFA 371

Query: 366 IFYFAI 371
           +FY AI
Sbjct: 372 MFYAAI 377


>gi|163759630|ref|ZP_02166715.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica
           DFL-43]
 gi|162283227|gb|EDQ33513.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica
           DFL-43]
          Length = 428

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 152/362 (41%), Positives = 229/362 (63%), Gaps = 10/362 (2%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK---I 69
           G+W+   I+ +  ++ +++ K I     ++DLS ++  DT GA L+   M    G+   +
Sbjct: 72  GDWRHAAIAGVYGEL-LSVQKKISGADLVIDLSDLSNFDTAGAWLVRKTMVVAKGQGASV 130

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
           +++G S  +  L S I      + +    +R+     F+ +   +G+ + +  +D  +  
Sbjct: 131 EIEGASKPVSGLLSAIP-DPADRAEVAATERAPL---FQRIFAPVGRALYELFDDLIASM 186

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
           +ILG  +         S        +++ Q+ ++GV  VP+++L+SF+ GA+IAQQGAFQ
Sbjct: 187 YILGSAVRGAQLKLDRSAGISP--AAIVTQIDHMGVRAVPIIMLMSFLIGAIIAQQGAFQ 244

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+DA++ +GL
Sbjct: 245 LRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVDALKVIGL 304

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           + V +L+ PR+ AL ++LPLLT++ANF+A+ GA+ V W Y  I   VF SR      +  
Sbjct: 305 NPVGVLVFPRLVALTVALPLLTVVANFAALAGAAAVAWSYSGITPDVFTSRLREAIDMTT 364

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           + +G+IKAPFMA  IGIVA  EG  VG  + SLG++VT  VV+SI +VI++D LFAIFY 
Sbjct: 365 VASGMIKAPFMALIIGIVASVEGMKVGGSAESLGRRVTASVVKSIFVVILVDGLFAIFYA 424

Query: 370 AI 371
           AI
Sbjct: 425 AI 426


>gi|150396764|ref|YP_001327231.1| hypothetical protein Smed_1554 [Sinorhizobium medicae WSM419]
 gi|150028279|gb|ABR60396.1| protein of unknown function DUF140 [Sinorhizobium medicae WSM419]
          Length = 379

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 156/365 (42%), Positives = 223/365 (61%), Gaps = 18/365 (4%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
           F+G+W+  E +E     +  + K     S   D S IT +DT GA +I  FM     +++
Sbjct: 27  FSGDWRH-ETAEAMSAKLKRLGKPAGGQSEF-DFSGITAMDTAGAWIIRRFMNGTADEVR 84

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
             G   + E + +L      K++++ + + +     F+ L   +G+  V    D+ +  +
Sbjct: 85  FAGSDRYAELILAL-----PKQLRSPEGETAR-APLFQRLFAPVGELTVSIWTDTVAAMY 138

Query: 131 ILGLVISNT----GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           ILG  +       G     S        +++ Q+  +GV   P++ L+SF+ GA+IAQQG
Sbjct: 139 ILGSAVRGAQMKLGRHAGVSPA------AIVHQIDRMGVMATPIITLMSFLIGAIIAQQG 192

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           AFQL  FGAEIF +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+DA++ 
Sbjct: 193 AFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVDALKV 252

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MGL  + +L+ PR+ AL I LPLLTI+ANF+A+ GA++V W Y  I    F +R      
Sbjct: 253 MGLSPIGVLVFPRLVALTIVLPLLTIIANFAALAGAAMVAWAYSGITIPTFLARLQEAVD 312

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            +++  G+IKAPFMA  IG+VA  EG  VG  + SLG++VT+ VV+SI +VI+ID LFAI
Sbjct: 313 FSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTSSVVKSIFVVILIDGLFAI 372

Query: 367 FYFAI 371
           FY AI
Sbjct: 373 FYAAI 377


>gi|209885947|ref|YP_002289804.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
 gi|209874143|gb|ACI93939.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
          Length = 377

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 219/365 (60%), Gaps = 11/365 (3%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFMEKYHGK 68
           AG+W + ++S +   V  A   +  + +  +D+SA+ EIDTIGA   E ++    +   +
Sbjct: 21  AGSWTASQVSALEPAVEAATRTASGARALQLDMSAVNEIDTIGAWLLERMIRHARQAGSE 80

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           IK  G+S   E+   LI      +  N  P      N      Y IG+  V  + +    
Sbjct: 81  IKTVGIS---ERFAGLI---EELRSANLNPPVYEKQNPLLLKLYQIGQSTVSSLQELLIF 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG + +          + +  L S I Q++ VG   VP+++LI+F+ GA+IAQQG F
Sbjct: 135 IDMLGRLGTVLARVILHPRRLR--LTSTIYQLHKVGWQAVPIIVLITFLIGAIIAQQGIF 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
              +FGA+ + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA+ TMG
Sbjct: 193 HFRKFGADAYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEIDALTTMG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +LI PR+ ALII+LP+LT + + +A+ G  ++ W Y D+  A F +R H   ++ 
Sbjct: 253 LDPLEVLILPRVIALIIALPILTFIGSIAALYGGGLISWLYGDMMPATFIARLHEAVSVT 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GLIKAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D LFA+F+
Sbjct: 313 HFEVGLIKAPFMALVIGIVASSEGLRVKGSAESLGRQTTTSVVKSIFLVIVLDGLFAVFF 372

Query: 369 FAIGI 373
            +IG+
Sbjct: 373 ASIGM 377


>gi|90417915|ref|ZP_01225827.1| possible permease protein, ABC-type transporter [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337587|gb|EAS51238.1| possible permease protein, ABC-type transporter [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 377

 Score =  253 bits (647), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 225/376 (59%), Gaps = 13/376 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +G  V R +G+W +  +  + D V  A    +     +VD   +  IDT GA L+   +
Sbjct: 10  RDGGLVLRASGDWLARTVGSVEDTVAEAGAADL-GRQVVVDCGDVARIDTAGALLLEKLV 68

Query: 63  EKY--HGK-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ-RSFFYNSFKNLHYHIGKKI 118
                +G+ ++L+ VS   + LF ++    RK +  ++PQ      N   +L    G+  
Sbjct: 69  RGLGANGRDVRLEAVSERDQPLFDVV----RKALDRERPQPEKRKTNRILDLVAATGRGS 124

Query: 119 VKFINDSCSQAHILG-LVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           V   ++     +I+G  ++         +      + + + QM   G+  VP++ L+SF+
Sbjct: 125 VAVKDEIVVALNIIGGAMVGGVQRLTGKTQIRPAAIFAQVEQM---GLRAVPIIFLMSFL 181

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            GA+IAQQGAFQL +FG E+++++L +IL LREIGVLLTA+MIAGRSGSAI AEIGSMK+
Sbjct: 182 IGAIIAQQGAFQLRRFGGELYAVNLAAILILREIGVLLTAIMIAGRSGSAITAEIGSMKM 241

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EEIDA+  +GL+ + +L+ PR+ AL+I LPLL  +AN + ++GA + +  Y DI FA F
Sbjct: 242 REEIDALHVIGLNPIGVLVFPRLVALVIVLPLLAFIANLAGLLGAMLTLNIYSDISFASF 301

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                 +  +  +F+G+IKAPFMA  IG++A  EG  VG  + SLG +VT  VV+SI +V
Sbjct: 302 GQGVQYSVDMFTVFSGVIKAPFMAVMIGLIASAEGMKVGGSAESLGLRVTASVVKSIFLV 361

Query: 358 IIIDSLFAIFYFAIGI 373
           I++D LFAIFY +IG+
Sbjct: 362 ILMDGLFAIFYASIGL 377


>gi|218679258|ref|ZP_03527155.1| putative transmembrane component of ABC transporter [Rhizobium etli
           CIAT 894]
          Length = 281

 Score =  252 bits (643), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 170/217 (78%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           S++ Q+ ++GV  VP+++L+SF+ GA+IAQQGAFQL  FGAE+F +DL+ ILQLREIGVL
Sbjct: 63  SIVNQIDHMGVRAVPIILLMSFLIGAIIAQQGAFQLRYFGAEVFVVDLVGILQLREIGVL 122

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LT++MIAGRSGSAI AEIGSMK+ EEIDA++ MGL+ + +LI PR+ AL I+LPLLT+LA
Sbjct: 123 LTSIMIAGRSGSAITAEIGSMKMREEIDALKVMGLNPIGVLIFPRLVALTIALPLLTVLA 182

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           NF+++ GA+ V W Y  I FA F SR H   TL+ + +G+IKAPFMA  IGIVA  EG  
Sbjct: 183 NFASLAGAAAVAWGYSGITFANFLSRLHEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLK 242

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
           VG  + SLG+ VT  VV++I +VI++D LFA+FY AI
Sbjct: 243 VGGSAESLGQHVTASVVKAIFVVILMDGLFAMFYAAI 279


>gi|227822231|ref|YP_002826202.1| toulene ABC transporter, permease protein, putative [Sinorhizobium
           fredii NGR234]
 gi|227341231|gb|ACP25449.1| toulene ABC transporter, permease protein, putative [Sinorhizobium
           fredii NGR234]
          Length = 321

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 211/332 (63%), Gaps = 23/332 (6%)

Query: 50  IDTIGAELIMYFME----KYHGKIKL-QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFY 104
           +DT GA +I  FM     +  G+I    G   ++E + +L         + ++P+RS   
Sbjct: 1   MDTAGAWIIRRFMNGIGSEAGGEIHFAHGGDRYVELVRALPG-------ELRQPERSKRK 53

Query: 105 NS-FKNLHYHIGKKIVKFINDSCSQAHILGLVISNT----GEFCASSYKFKGFLLSLIRQ 159
           +  F+ L   IG+  V    D+ +  +ILG  +       G     S        +++ Q
Sbjct: 54  DPLFQRLFAPIGEVTVSIWTDTVAAMYILGSAVRGAQMKLGRHAGVSPA------AIVHQ 107

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           +  +GV   P++ L+SF+ GA+IAQQGAFQL  FGAEIF +DL+ ILQLREIGVLLTA+M
Sbjct: 108 IDRMGVMATPIITLMSFLIGAIIAQQGAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIM 167

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           IAGRSGSAI AEIGSMK+ EE+DA++ MGL  V +L+ PR+ AL I+LPLLTI+ANF+A+
Sbjct: 168 IAGRSGSAITAEIGSMKMREEVDALKVMGLSPVGVLVFPRLVALTIALPLLTIIANFAAL 227

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           +GA++V W Y  I  A F +R       +++  G+IKAPFMA  IG+VA  EG  VG  +
Sbjct: 228 VGAALVAWTYSGITVATFVARLQEAVDFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSA 287

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            SLG++VT+ VV+SI +VI+ID LFA+FY AI
Sbjct: 288 ESLGRRVTSSVVKSIFVVILIDGLFAMFYAAI 319


>gi|299132338|ref|ZP_07025533.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
 gi|298592475|gb|EFI52675.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
          Length = 377

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 141/363 (38%), Positives = 219/363 (60%), Gaps = 7/363 (1%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH-GKIK 70
           AG+W + ++S +   V  AI+    +    +D+SA+ +IDTIGA L+   + + H    +
Sbjct: 21  AGSWTASQVSSLEPVVNAAIHNVSGARVLQLDMSAVDQIDTIGAWLLERMIRRVHQAGSE 80

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
           ++ V  H E+   LI      +  N  P      N+     Y IG+  V  + +      
Sbjct: 81  IRTVGIH-ERFAGLID---ELRSVNLHPPVHERQNAVLLKLYQIGQSTVASLQELLVFLE 136

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
           +LG + S          + +  L S I Q++ VG   VP++++I+F+ GA+IAQQG F  
Sbjct: 137 MLGRLGSVLARLAFKPSRLR--LTSTIYQLHKVGWQAVPIMVMITFLIGAIIAQQGIFHF 194

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
            +FGA+ + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA+ TMGLD
Sbjct: 195 RKFGADAYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEIDALTTMGLD 254

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
            + +L+ PR+ AL+I+LP+L  + + +A+ G  ++ W Y  +  A+F +R H   ++ + 
Sbjct: 255 PLEVLVLPRVLALVIALPILAFIGSIAALYGGGLISWLYGGMSPAIFIARLHEAVSVTHF 314

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             GLIKAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D LFA+F+ +
Sbjct: 315 EVGLIKAPFMALVIGIVASSEGLRVKGSAESLGRQTTTSVVKSIFLVIVLDGLFAVFFAS 374

Query: 371 IGI 373
           IG+
Sbjct: 375 IGM 377


>gi|307945713|ref|ZP_07661049.1| ABC transporter permease protein [Roseibium sp. TrichSKD4]
 gi|307771586|gb|EFO30811.1| ABC transporter permease protein [Roseibium sp. TrichSKD4]
          Length = 382

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/373 (37%), Positives = 219/373 (58%), Gaps = 20/373 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDS---AIVDLSAITEIDTIGAELIMYFMEK 64
           V   +G+W    ++E A+ +V    +SI  D      +D SAI  +DT GA    + + +
Sbjct: 23  VLCLSGDWTISSLAE-AERLV----ESIMLDKYRVTCLDTSAIDNLDTSGA----WLVHR 73

Query: 65  YHGKIKLQGVSTHI----EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
             G ++ QG    +    E  F+L     R      KP++S    S        GK++V 
Sbjct: 74  LRGSLEYQGRRVELIGLTENRFNLFCQIERHHPPEYKPEKSKV--SLVGFLEATGKQVVN 131

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D+ +  HILG +            + +G  +++  Q     +  VP+V L+SF+ GA
Sbjct: 132 VGRDAIAMLHILGSLGVVLSTVLLQPKRLRGIAVAV--QFDRTCIGAVPIVALMSFLIGA 189

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +I+QQG F L QFGA+I+ +DL  IL LREIGV+LTA+M+AGRSGSA  AE+G+M++ EE
Sbjct: 190 IISQQGGFYLRQFGADIYVVDLAGILVLREIGVILTAIMVAGRSGSAFTAELGAMRMQEE 249

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+  +GL    +L+ PRI AL+I+LP+LT +A+ +A++GA +  W Y DIP A + ++
Sbjct: 250 VDALHVIGLSVTEVLVLPRILALMIALPVLTFIADMAALVGAGLTTWVYLDIPPAAYLTQ 309

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +  T+  ++ G++KAPFMA  IG++A  EG  VG  + SLG+  T  VV++I +VI++
Sbjct: 310 LQAAITMKTLWVGIVKAPFMALIIGLIACVEGLKVGGSAESLGRHTTMSVVKAIFLVIVV 369

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+ +I +
Sbjct: 370 DGVFAIFFASINV 382


>gi|254502466|ref|ZP_05114617.1| conserved domain protein [Labrenzia alexandrii DFL-11]
 gi|222438537|gb|EEE45216.1| conserved domain protein [Labrenzia alexandrii DFL-11]
          Length = 382

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 218/366 (59%), Gaps = 12/366 (3%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEKYHG 67
            +G+W    +++ AD  +  +N + +     +D+S +  +DT GA LI      +E    
Sbjct: 26  LSGDWTVSTLAD-ADQQISKLNVA-KDKLTCIDVSEVDHLDTSGAWLIHRTRGQLEFSGR 83

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           K++L GV+   E LF  I   H  +    +P RS F  +        G+++V+   D+ +
Sbjct: 84  KVQLTGVTPVRESLFHEIEKHHPPR---WQPDRSGF--TIVGFLEATGRQMVEVYKDTLA 138

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
             HILG +            + +   +++  Q     +  VP+V L+SF+ GA+I+QQG 
Sbjct: 139 MLHILGSLGIVLSTVLLQPKRLRSIAIAV--QFDRSCIGAVPIVALMSFLIGAIISQQGG 196

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           F L QFGA+IF +DL  IL LREIGV+LTA+M+AGRSGSA  AE+G+M++ EE+DA+  +
Sbjct: 197 FYLRQFGADIFVVDLAGILVLREIGVILTAIMVAGRSGSAFTAELGAMRMQEEVDALHVI 256

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL    +L+ PRI AL+I+LP+LT +A+ SA+ GA ++ W Y DIP A F ++  S  T+
Sbjct: 257 GLSVTEVLVLPRILALMIALPILTFVADISALFGAGLITWAYLDIPPAAFLTQLQSAITV 316

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
                G+IKAPFMA  +G++A  EG  V   S SLG+  T  VV++I +VI++D +FA+F
Sbjct: 317 NTFVVGIIKAPFMALIVGLIACVEGLKVEGSSESLGRHTTMAVVKAIFLVIVVDGMFAMF 376

Query: 368 YFAIGI 373
           + AIG+
Sbjct: 377 FAAIGV 382


>gi|188580085|ref|YP_001923530.1| hypothetical protein Mpop_0817 [Methylobacterium populi BJ001]
 gi|179343583|gb|ACB78995.1| protein of unknown function DUF140 [Methylobacterium populi BJ001]
          Length = 382

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 206/362 (56%), Gaps = 12/362 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFMEKYHGKI 69
           G W + +   + +     I    +    +VDLS +  +DT+GA   E     +E   G++
Sbjct: 28  GRWTADQGPAV-ESASARIAAQGRRQPVLVDLSGLARLDTLGAWVLERTRAEIEAAGGRL 86

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              G       L   +       ++  +P      N    L    G+++ +  N+  S  
Sbjct: 87  AYAGARPEHRILLGEMG------LREPEPAPRDARNPVVRLLDGTGRRVARGGNEILSGI 140

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             LG V++  G        F+  + +L+ Q+  V + GVP+++LISF+ G ++AQQG FQ
Sbjct: 141 AFLGEVVAAGGRVARRPQTFR--MAALVNQLEQVALRGVPIIVLISFLVGGIVAQQGIFQ 198

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ EE+DA+R MGL
Sbjct: 199 LQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMREEVDALRVMGL 258

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           D + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +R  +  +  +
Sbjct: 259 DPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTVDAFLARLQAAVSFHH 318

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI++D LFA+F+ 
Sbjct: 319 FAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIVLDGLFAVFFA 378

Query: 370 AI 371
           AI
Sbjct: 379 AI 380


>gi|170748370|ref|YP_001754630.1| hypothetical protein Mrad2831_1952 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654892|gb|ACB23947.1| protein of unknown function DUF140 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 384

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 134/335 (40%), Positives = 204/335 (60%), Gaps = 15/335 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQG-----VSTHIEQLFSLISFTHRKKIKNQ 96
           VDLS I  +DT+GA    + +E+   +I+  G     +    E    L+     ++    
Sbjct: 58  VDLSGIERLDTLGA----WVLERTRAEIEQAGSALTYLGARPEHRI-LLGEVRLREPDAP 112

Query: 97  KPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
            P+R   +     L    G++ V+  ++  +    LG +I+  G        F+G   +L
Sbjct: 113 PPRR---HGPVVGLLDATGRRTVQGGHEFVTALAFLGELIAACGRVALRPGTFRGN--AL 167

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I Q+  V ++G P+++LISF+ G ++AQQG FQL +FGA+ F ++L+ +L LRE+GVLLT
Sbjct: 168 INQIQQVALNGTPIIVLISFLVGGIVAQQGIFQLQRFGAQTFVVNLIGLLILREMGVLLT 227

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           ++M+AGRSGSAI AEIGSM++ EE+DA+R MGLD V ILI PR+ AL+I LP+LT++ + 
Sbjct: 228 SIMVAGRSGSAITAEIGSMRMREEVDALRVMGLDPVEILIVPRVLALMIGLPMLTLIGDL 287

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           +A+ G  +    Y  +    F  R  +   + ++  GLIKAPFMA  IG++A  EGFAV 
Sbjct: 288 AALAGGGLTAMLYGGLTLDQFLVRLQAAVGVHHVMVGLIKAPFMALTIGVIATIEGFAVE 347

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
             + SLG+ VT  VV+SI +VI++D LFA+F+ AI
Sbjct: 348 GSAESLGRHVTASVVKSIFMVIVLDGLFAVFFAAI 382


>gi|218528881|ref|YP_002419697.1| hypothetical protein Mchl_0851 [Methylobacterium chloromethanicum
           CM4]
 gi|218521184|gb|ACK81769.1| protein of unknown function DUF140 [Methylobacterium
           chloromethanicum CM4]
          Length = 381

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 207/362 (57%), Gaps = 12/362 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFMEKYHGKI 69
           G W + +   + +     I    ++   +VDLS +  +DT+GA   E     +E   G++
Sbjct: 27  GRWTADQGPAV-ESASARIAAQGRTQPVLVDLSGLARLDTLGAWVLERTRAEIEAAGGRL 85

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              G       L   +     + +    PQ +   N         G+++ +  N+  S  
Sbjct: 86  AYAGARPEHRILLGEMGLREPEPV----PQDT--RNPVLRFLDTTGQRVARGGNEILSGI 139

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             LG V++  G        F+  + +L+ Q+  V + GVP+++LISF+ G ++AQQG FQ
Sbjct: 140 AFLGEVVAAGGRVARRPQTFR--MAALVNQLEQVALRGVPIIVLISFLVGGIVAQQGIFQ 197

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ EE+DA+R MGL
Sbjct: 198 LQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMREEVDALRVMGL 257

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           D + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +R  +  +  +
Sbjct: 258 DPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTTDAFLARLQAAVSFHH 317

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI++D LFA+F+ 
Sbjct: 318 FAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIVLDGLFAVFFA 377

Query: 370 AI 371
           AI
Sbjct: 378 AI 379


>gi|240137395|ref|YP_002961866.1| putative ABC transporter, permease [Methylobacterium extorquens
           AM1]
 gi|240007363|gb|ACS38589.1| Putative ABC transporter, permease [Methylobacterium extorquens
           AM1]
          Length = 382

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 207/364 (56%), Gaps = 16/364 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFMEKYHGKI 69
           G W + +   + +     I    ++   +VDLS +  +DT+GA   E     +E   G++
Sbjct: 28  GRWTADQGPAV-ESASARIAAQGRTQPVLVDLSGLARLDTLGAWVLERTRAEIEAAGGRL 86

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKN--QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
              G       L   +     + +    + P   F   +        G+++ +  N+  S
Sbjct: 87  AYAGARPEHRILLGEMGLREPEPVPQDTRNPALRFLDTT--------GQRVARGGNEILS 138

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG V++  G        F+  + +L+ Q+  V + GVP+++LISF+ G ++AQQG 
Sbjct: 139 GIAFLGEVVAAGGRVARRPQTFR--MAALVNQLEQVALRGVPIIVLISFLVGGIVAQQGI 196

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ EE+DA+R M
Sbjct: 197 FQLQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMREEVDALRVM 256

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +R  +  + 
Sbjct: 257 GLDPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTTDAFLARLQAAVSF 316

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI++D LFA+F
Sbjct: 317 HHFAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIVLDGLFAVF 376

Query: 368 YFAI 371
           + AI
Sbjct: 377 FAAI 380


>gi|163850324|ref|YP_001638367.1| hypothetical protein Mext_0891 [Methylobacterium extorquens PA1]
 gi|254559575|ref|YP_003066670.1| ABC transporter permease [Methylobacterium extorquens DM4]
 gi|163661929|gb|ABY29296.1| protein of unknown function DUF140 [Methylobacterium extorquens
           PA1]
 gi|254266853|emb|CAX22652.1| Putative ABC transporter, permease [Methylobacterium extorquens
           DM4]
          Length = 382

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 207/364 (56%), Gaps = 16/364 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFMEKYHGKI 69
           G W + +   + +     I    ++   +VDLS +  +DT+GA   E     +E   G++
Sbjct: 28  GRWTADQGPAV-ESASARIAAQGRTQPVLVDLSGLARLDTLGAWVLERTRAEIEAAGGRL 86

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKN--QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
              G       L   +     + +    + P   F   +        G+++ +  N+  S
Sbjct: 87  AYAGARPEHRILLGEMGLREPEPVPQDTRNPALRFLDTT--------GQRVARGGNEILS 138

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG V++  G        F+  + +L+ Q+  V + GVP+++LISF+ G ++AQQG 
Sbjct: 139 GIAFLGEVVAAGGRVARRPQTFR--MAALVNQLEQVALRGVPIIVLISFLVGGIVAQQGI 196

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ EE+DA+R M
Sbjct: 197 FQLQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMREEVDALRVM 256

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +R  +  + 
Sbjct: 257 GLDPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTTDAFLARLQAAVSF 316

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI++D LFA+F
Sbjct: 317 HHFAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIVLDGLFAVF 376

Query: 368 YFAI 371
           + AI
Sbjct: 377 FAAI 380


>gi|118588764|ref|ZP_01546172.1| hypothetical protein SIAM614_18699 [Stappia aggregata IAM 12614]
 gi|118438750|gb|EAV45383.1| hypothetical protein SIAM614_18699 [Stappia aggregata IAM 12614]
          Length = 382

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 139/338 (41%), Positives = 205/338 (60%), Gaps = 16/338 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEK--YHG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           +D+S I  +DT GA LI     +  + G K+ L GVS   + LF  I   H     + KP
Sbjct: 55  IDVSRIEHLDTSGAWLIHRTRGRLEFEGRKVGLSGVSPVRKTLFEEIENHHPP---SWKP 111

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILG---LVISNTGEFCASSYKFKGFLLS 155
               F  S        G+++V   +D+ +  HILG   LV+S          + +   +S
Sbjct: 112 DPGGF--SIAGFLEATGRQMVDVYHDALAMLHILGSLGLVLSTV---LLQPKRLRS--IS 164

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +  Q     +  VP+V L+SF+ GA+I+QQG F L QFGA+IF +DL  IL LREIGV+L
Sbjct: 165 IAVQFDRSCIGAVPIVALMSFLIGAIISQQGGFYLRQFGADIFVVDLAGILVLREIGVIL 224

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+AGRSGSA  AE+G+M++ EE+DA+  +GL    +L+ PRI AL+I+LP+LT +++
Sbjct: 225 TAIMVAGRSGSAFTAELGAMRMQEEVDALHVIGLSVTEVLVLPRILALMIALPILTFISD 284

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
            +A+ G+ +V W Y DIP A F ++  +  T+  +  GL+KAPFMA  +G++A  EG  V
Sbjct: 285 LAALFGSGMVTWAYLDIPPAAFLTQLQAAITINTLVVGLVKAPFMALIVGLIACVEGLKV 344

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              S SLG+  T  VV++I +VI++D  FAIF+ AIG+
Sbjct: 345 EGSSESLGRHTTMSVVKAIFLVIVVDGFFAIFFAAIGV 382


>gi|148257023|ref|YP_001241608.1| putative ABC transporter permease [Bradyrhizobium sp. BTAi1]
 gi|146409196|gb|ABQ37702.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           BTAi1]
          Length = 378

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 139/372 (37%), Positives = 220/372 (59%), Gaps = 18/372 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH-- 66
            R +G+W S  ++E+ +    A  K   + +  +DL A++EIDT+G    ++ +EK    
Sbjct: 18  LRPSGSWVSLNVTELENLTRSASGKVGNAKAVKLDLGAVSEIDTVG----VWLLEKLSRS 73

Query: 67  ----GK-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
               G+ +++ GV+ +   L   +   +R+ I    P+++       +L    G+  +  
Sbjct: 74  AAAGGRLVEMTGVAENYVGLVEEVRQVNRRDIA-PPPRQNPIVAKLTDL----GRSTLGA 128

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D      +L  +        A     +  + SL+ QMY +G   +P+V+LI+F+ GA+
Sbjct: 129 ARDVTVFLDMLAALSLALVRTLARPRSLR--VTSLVYQMYRIGWQAIPIVVLITFLIGAI 186

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGAE + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EEI
Sbjct: 187 IAQQGIFHFRRFGAESYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEI 246

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD V +LI PRI ALI++LP+L  + + +A+ G  +V   Y  +  A+F +R 
Sbjct: 247 DALVTMGLDPVEVLILPRIVALILTLPILAFIGSMAALYGGGLVAQLYGGMGPAIFIARL 306

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   ++ +   G+ KAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D
Sbjct: 307 HDAVSVTHFEVGMWKAPFMALVIGIVACSEGLRVKGSAESLGQQTTTSVVKSIFLVIVLD 366

Query: 362 SLFAIFYFAIGI 373
            LFA+F+ +IG+
Sbjct: 367 GLFAVFFASIGL 378


>gi|158423837|ref|YP_001525129.1| hypothetical protein AZC_2213 [Azorhizobium caulinodans ORS 571]
 gi|158330726|dbj|BAF88211.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 408

 Score =  239 bits (609), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 208/360 (57%), Gaps = 9/360 (2%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
           G W S E ++  +  VM +        A+ +DLS +  +DT GA L    +E+     + 
Sbjct: 55  GAWTS-EYADSLEQAVMQVASHYGEAKAVEIDLSRLDRMDTFGALL----LERLRRVWQE 109

Query: 72  QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHI 131
           +GV   I  L    S    +++     +          +   IG+++V    D+ S  + 
Sbjct: 110 KGVEPQIVGLNPAYSVLI-EEMTRTGREPPPPERKPPGVFERIGREMVVITEDAVSLLNF 168

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           +G V++  G        F+    S++ QM  VG   +P++ILI+F+ G +IAQQG F   
Sbjct: 169 VGAVVAAFGRVLTRPRSFR--FTSMVNQMDRVGFRAMPIIILITFLIGCIIAQQGIFNFR 226

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           +FGA+I+ +D++ +L LRE+GVL+ ++MIAGRSGSA  AE+GSM++ EE+DA+R MG D 
Sbjct: 227 RFGADIYVVDMVGVLVLRELGVLIVSIMIAGRSGSAYTAELGSMRMREEVDALRVMGFDP 286

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           V +L+ PR+ ALII LPLLT + + +A+IG  +V W Y  I   VF +R     TLA   
Sbjct: 287 VEVLVVPRLLALIICLPLLTFVGSMAAMIGGGLVAWFYGGIAPDVFINRLKDAITLAQFE 346

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            G+IKAPFMA  IG+V   EG  VG  + SLG+  T  VV++I +VI++D LFAIF+ +I
Sbjct: 347 VGMIKAPFMAAIIGVVGCMEGLRVGGSAESLGQHTTASVVKAIFLVIVVDGLFAIFFASI 406


>gi|328543112|ref|YP_004303221.1| ABC transporter permease protein [Polymorphum gilvum SL003B-26A1]
 gi|326412858|gb|ADZ69921.1| ABC transporter permease protein [Polymorphum gilvum SL003B-26A1]
          Length = 381

 Score =  238 bits (606), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 201/339 (59%), Gaps = 18/339 (5%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIK-------LQGVSTHIEQLFSLISFTHRKKIK 94
           +DLS I+ +DT GA    + + +  G+I+       L GV+   E L S +   H     
Sbjct: 54  IDLSGISVLDTSGA----WLLHRMRGRIEFAGVRVILTGVAPKYELLLSEVDAHHPPP-- 107

Query: 95  NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLL 154
              P+R  +  S  ++    G+ +V    D  +  HILG +            + +G  +
Sbjct: 108 -WSPER--YRYSIVSVLETTGRHVVDAGKDLVAMMHILGSLSVVVAGVLFRPGRLRG--I 162

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           S+  Q     +  VP++ L+SF+ GA+IAQQG F L QFGA++F +DL  +L LREIGVL
Sbjct: 163 SIAVQFDKSCIGAVPIIALMSFLIGAIIAQQGGFYLRQFGADLFVVDLAGVLVLREIGVL 222

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+M+AGRSGSA  AE+GSMK+ EEIDA+  +GL    +LI PR+ AL++++P+LT ++
Sbjct: 223 LTAIMVAGRSGSAFTAELGSMKMQEEIDALHVIGLSVTEVLILPRLLALMVAMPVLTFVS 282

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           + +A+ G+ +V W Y  IP A + +R     +      G++KAPFMA  IG++A  EG  
Sbjct: 283 DIAALFGSGLVTWSYLGIPPAAYMARLEEAISFQTFLVGMVKAPFMALIIGLIACVEGLK 342

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           VG  ++SLG+  T  VV++I +VI++D LFAIF+ AI +
Sbjct: 343 VGGSADSLGRHTTMSVVKAIFLVIVVDGLFAIFFAAIDV 381


>gi|115523755|ref|YP_780666.1| hypothetical protein RPE_1737 [Rhodopseudomonas palustris BisA53]
 gi|115517702|gb|ABJ05686.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisA53]
          Length = 382

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/382 (37%), Positives = 223/382 (58%), Gaps = 24/382 (6%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMY 60
            + G+   R  G+W +   + + + +   ++  +Q    + +DL+ + EIDT+GA    +
Sbjct: 15  DDAGVLQLRPGGSWTAGN-AVVLERLFEEVSPQLQGVRGLRIDLAGVQEIDTLGA----W 69

Query: 61  FMEKYHGKIKLQGVSTHI----EQLFSLISFTHR--KKIKNQKPQRSF---FYNSFKNLH 111
            +EK   +   QGVS+ +    E+   LI    +  +      P+ +F   + +    L 
Sbjct: 70  LLEKMSRRAAQQGVSSELVGVDERHAGLIDEVRQVNRNAPAPHPRGNFVLGWLDQLGRLT 129

Query: 112 YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVV 171
           +    +++ F+    + A  L  V+         S +    L SL  Q+Y VG   +P++
Sbjct: 130 WASRVEVLVFLQMLGALAVALLGVLRRP-----RSLR----LTSLFYQVYRVGWQAIPIM 180

Query: 172 ILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAE 231
           +LI+F+ GA+IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE
Sbjct: 181 LLITFLIGAIIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAE 240

Query: 232 IGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYD 291
           +GSMK+ EEIDA+ TM LD V +LI PR+ ALII+LP+L+ L + +A+ G  +V W Y  
Sbjct: 241 LGSMKMREEIDALSTMDLDPVEVLILPRVLALIIALPILSFLGSMAALYGGGLVAWFYGG 300

Query: 292 IPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVV 351
           +   +F +R H   ++ +   G+IKAPFMA  IGIVA  EG  V   + SLG++ TT VV
Sbjct: 301 MSPTIFIARLHEAVSVTHFEVGIIKAPFMALVIGIVACSEGLRVKGSAESLGRQTTTSVV 360

Query: 352 QSISIVIIIDSLFAIFYFAIGI 373
           +SI  VI++D LFA+F+ +IG+
Sbjct: 361 KSIFCVIVLDGLFAVFFASIGM 382


>gi|217978940|ref|YP_002363087.1| protein of unknown function DUF140 [Methylocella silvestris BL2]
 gi|217504316|gb|ACK51725.1| protein of unknown function DUF140 [Methylocella silvestris BL2]
          Length = 379

 Score =  236 bits (603), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 148/374 (39%), Positives = 220/374 (58%), Gaps = 14/374 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           SE G+   + AG+W     ++I +     +     +  AI DL+ +  +DT GA    + 
Sbjct: 14  SEEGVR-LKLAGHWTLDACADIEEGAQALVGAGAGAKHAIFDLAGVQRMDTAGA----WL 68

Query: 62  MEKYHGKIKLQGVSTHI----EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
           ++    ++  +GVS        ++  L+   H +  + Q P R  FY     L   +G+ 
Sbjct: 69  IDGARQQLDAKGVSADFAGGRPEIDILLKEAHFRSFE-QPPGRKGFY--IVTLLADVGES 125

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +V    D       LG V+++ G+       F+G   +L+ Q+  + + GVP+++LI+F+
Sbjct: 126 VVASGRDIYRGVEFLGEVVASIGKSVIQPAHFRG--TALVAQIETIALRGVPIIVLINFL 183

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            GA++AQQG FQL +FGA I  +DL+ IL LRE+GVLLTA+MI+GRSGSAI AE+GSMK+
Sbjct: 184 VGAIVAQQGIFQLRRFGATILVVDLIGILILRELGVLLTAIMISGRSGSAITAELGSMKM 243

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EEIDA+  MGL  + +LI+PRI ALI+SLPLLT LA+ +A+ G  +V W Y  I    F
Sbjct: 244 REEIDALVVMGLRPIDVLIAPRILALILSLPLLTFLADMAALAGGILVSWLYGGITPKSF 303

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +       L    +GLIKAPFM   IG++A  EG AV   + SLG++VT  VV+SI +V
Sbjct: 304 IALLPEAIALRTFLSGLIKAPFMGLIIGLIACMEGLAVAGSAESLGRQVTASVVKSIFMV 363

Query: 358 IIIDSLFAIFYFAI 371
           I++D LFA+F+  I
Sbjct: 364 IVVDGLFAVFFATI 377


>gi|85716130|ref|ZP_01047106.1| ABC transporter permease protein [Nitrobacter sp. Nb-311A]
 gi|85697129|gb|EAQ35011.1| ABC transporter permease protein [Nitrobacter sp. Nb-311A]
          Length = 370

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 213/366 (58%), Gaps = 8/366 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG- 67
            R  G W +  ++ +      A  +  ++ S  +D+S ++E+DT+GA L+     +  G 
Sbjct: 12  LRPDGFWIAANVTVLEALADAAAPQVERAKSLKMDMSGLSELDTLGAWLLEKLSRQIAGH 71

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             ++ GVS +   L   +   +R  +   K +     N        +G+       D   
Sbjct: 72  PAEIVGVSENYAGLIEEVRHVNRHNLPPPKAR-----NPVIAKVEEVGRAAWNSREDVAV 126

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG +              +  L SL+ Q+Y VG   +P+++LI+F+ GA+IAQQG 
Sbjct: 127 FLQMLGSLCVALLGIIRKPRSLR--LTSLVYQLYRVGWQAIPIILLITFLIGAIIAQQGF 184

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           F   +FGA+ + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA+ TM
Sbjct: 185 FHFRKFGADSYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEIDALSTM 244

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD V +LI PR+ AL+++LP+LT + + +A+ G  +V W Y  +  ++F +R H   ++
Sbjct: 245 GLDPVVVLILPRVLALVLALPILTFIGSMAALYGGGLVAWFYGGMGPSIFIARLHDAVSV 304

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   G+IKAPFMA  IGIVA  EG  V   + SLGK+ TT VV+SI +VI++D LFA+F
Sbjct: 305 THFQVGMIKAPFMALVIGIVACSEGLRVKGSAESLGKQTTTSVVKSIFLVIVLDGLFAVF 364

Query: 368 YFAIGI 373
           + +IG+
Sbjct: 365 FASIGM 370


>gi|146342154|ref|YP_001207202.1| putative ABC transporter permease [Bradyrhizobium sp. ORS278]
 gi|146194960|emb|CAL78985.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           ORS278]
          Length = 378

 Score =  236 bits (601), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 137/371 (36%), Positives = 215/371 (57%), Gaps = 16/371 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH-- 66
            R +G+W S  ++++      A  K   +    +DL +++EIDT+GA LI     +    
Sbjct: 18  LRASGSWVSRNVTQLESLTGSACAKLGHAGIVRLDLGSVSEIDTVGAWLIEKLSRRAGVG 77

Query: 67  -GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHI---GKKIVKFI 122
             ++++ GV+     L   +   +R++I    P+ +       +L        K +  F+
Sbjct: 78  GRRVEMTGVAASYSGLVDEVRQVNRREIA-PAPRPNPIVARLTDLGRSTMGAAKDVTIFL 136

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +   + +  L   +        +S         L+ QMY +G   +P+V+LI+F+ GA+I
Sbjct: 137 DMLAALSFALVRTLRRPRSLRVTS---------LVYQMYRIGWQAIPIVVLITFLIGAII 187

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGAE + +D++ IL LRE+GVL+ A+M+AGRSGSA  AEIGSMK+ EEID
Sbjct: 188 AQQGIFHFRRFGAESYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAEIGSMKMREEID 247

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ TMGLD V +LI PRI ALI++LP+L  + + +A+ G  +V   Y  +   +F +R H
Sbjct: 248 ALVTMGLDPVEVLILPRIVALILTLPILAFIGSMAALYGGGLVAQLYGGMGPPIFIARLH 307

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   G++KAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D 
Sbjct: 308 EAISVTHFEVGMLKAPFMALVIGIVACSEGLRVKGSAESLGQQTTTSVVKSIFLVIVLDG 367

Query: 363 LFAIFYFAIGI 373
           LFAIF+ +IG+
Sbjct: 368 LFAIFFASIGM 378


>gi|146341950|ref|YP_001206998.1| putative ABC transporter permease [Bradyrhizobium sp. ORS278]
 gi|146194756|emb|CAL78781.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           ORS278]
          Length = 377

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 137/375 (36%), Positives = 208/375 (55%), Gaps = 11/375 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            E      R  G W +P    +   V  A   + +S +  +D+S ++++DT GA LI   
Sbjct: 11  GEGNALALRATGAWTAPFAPALERLVADAEKLAGKSGNVSIDVSQVSKLDTFGAWLIERL 70

Query: 62  MEKYHG---KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
              +     + ++ G+S +     SL+    R  +    P       +   +   IG+ +
Sbjct: 71  RRSFTTGTVEARIDGLSANYA---SLVDEVRRVSLA---PGDDATNVTITGMLGQIGRSV 124

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
              +    +   +LG VI  +G        F+  L S I  +  V    VP+++LI+F+ 
Sbjct: 125 AGIVGTVAALIDMLGAVIVASGRVLVHPRSFR--LTSTIHHLEQVCWRAVPIIVLITFLI 182

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G +IAQQG F   +FGA+IF +D++ +L LREIGVLL A+MIAGRSGSA  AE+GSMK+ 
Sbjct: 183 GCIIAQQGIFHFRRFGADIFVVDMLGVLVLREIGVLLVAIMIAGRSGSAYTAELGSMKMR 242

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+RTMG D + +LI PR+ AL+I+LP+L+ L + +A+ G  +V W Y  +    F 
Sbjct: 243 EEIDALRTMGFDPIEVLILPRMLALVIALPILSFLGDIAALYGGGLVAWFYGGVDPEAFL 302

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R     ++ +   GL+KAP MA  IGIVA  EG AV   + SLG+  T+ VV+ I  VI
Sbjct: 303 LRLRDAISIDHFTVGLLKAPVMAAVIGIVACVEGLAVEGSAESLGRHTTSSVVKGIFFVI 362

Query: 359 IIDSLFAIFYFAIGI 373
           ++D +FAIF+ A+G+
Sbjct: 363 VMDGVFAIFFAAVGM 377


>gi|92116871|ref|YP_576600.1| hypothetical protein Nham_1315 [Nitrobacter hamburgensis X14]
 gi|91799765|gb|ABE62140.1| protein of unknown function DUF140 [Nitrobacter hamburgensis X14]
          Length = 377

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/369 (37%), Positives = 205/369 (55%), Gaps = 19/369 (5%)

Query: 12  AGNWKS---PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
           AG W +   P +  I  D   A   +    +  +D+S I+ +DT GA LI    E+    
Sbjct: 21  AGPWTARFAPALERIVAD---AEKLAGSRPNIFIDVSQISRLDTFGAWLI----ERLRRS 73

Query: 69  IKLQGVSTHIEQLF----SLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           +   GV   I  L     SL+    R    +  P R     +   L   +G+ +V F   
Sbjct: 74  LTQGGVEAKIAGLSLNYSSLVDEVRRVPAADPAPARQ---RALTGLIEDVGRNVVGFGTT 130

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 +LG V++ +G        F+  L S +  +  V    VP+V+LI+F+ G +I+Q
Sbjct: 131 LTGLIGMLGAVLAASGRVMRHPRSFR--LTSTVHHLEQVCWRAVPIVVLITFLIGCIISQ 188

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QG F   +FGA+IF +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EEIDA+
Sbjct: 189 QGIFHFRKFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDAL 248

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RTMG D + +L+ PR+ AL+I+LP+L  L   +A+ G  +V W Y  +    F  R    
Sbjct: 249 RTMGFDPIEVLVLPRMLALVIALPILAFLGAIAALYGGGLVAWLYGGVQPEAFLIRLRDA 308

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            ++ +   G+IKAP MA  IGIVA  EG AV   + SLG++ T+ VV+ I  VI++D +F
Sbjct: 309 ISIDHFVVGMIKAPVMAAVIGIVACVEGLAVEGSAESLGQRTTSSVVKGIFFVIVMDGVF 368

Query: 365 AIFYFAIGI 373
           AIF+ +IG+
Sbjct: 369 AIFFASIGM 377


>gi|92117460|ref|YP_577189.1| hypothetical protein Nham_1921 [Nitrobacter hamburgensis X14]
 gi|91800354|gb|ABE62729.1| protein of unknown function DUF140 [Nitrobacter hamburgensis X14]
          Length = 388

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/371 (37%), Positives = 215/371 (57%), Gaps = 16/371 (4%)

Query: 9   FRFAGNWKSPEI---SEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
            R  G+W +  +     +AD V   + ++    S  +D+S ++E+DT+GA L+     + 
Sbjct: 28  LRPDGSWIAANVIALETLADAVAPQVERA---KSLKMDMSGLSELDTLGAWLLEKLSRRV 84

Query: 66  HG---KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                 +++ GVS +   L   +   +R    N  P ++   N        IG+      
Sbjct: 85  ASADHPVEVVGVSENYAGLIEEVRHVNR---HNPPPPKA--RNPVIAKVEEIGRSAWGSR 139

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D      +LG +              +  L SL+ Q+Y VG   +P+++LI+F+ GA+I
Sbjct: 140 EDVAVFLQMLGSLCVALLGIIRKPRSLR--LTSLVYQLYRVGWQAIPIILLITFLIGAII 197

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGA+ + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EEID
Sbjct: 198 AQQGFFHFRKFGADSYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEID 257

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ TMGLD V +LI PR+ AL+ +LP+LT + + +A+ G  +V W Y  +  ++F +R H
Sbjct: 258 ALSTMGLDPVVVLILPRVLALVSALPILTFIGSMAALYGGGLVAWFYGGMGPSIFIARLH 317

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   G+IKAPFMA  IGIVA  EG  V   + SLGK+ TT VV+SI +VI++D 
Sbjct: 318 DAVSVTHFEVGMIKAPFMALVIGIVACSEGLRVKGSAESLGKQTTTSVVKSIFLVIVLDG 377

Query: 363 LFAIFYFAIGI 373
           LFA+F+ +IG+
Sbjct: 378 LFAVFFASIGM 388


>gi|154243867|ref|YP_001409440.1| hypothetical protein Xaut_5005 [Xanthobacter autotrophicus Py2]
 gi|154162989|gb|ABS70204.1| protein of unknown function DUF140 [Xanthobacter autotrophicus Py2]
          Length = 344

 Score =  234 bits (598), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 131/332 (39%), Positives = 197/332 (59%), Gaps = 11/332 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR--KKIKNQKPQ 99
           V+LS IT +DT GA L    +E+  G  + +G    + Q+ SL     R  ++++    +
Sbjct: 20  VNLSGITRMDTFGAIL----LERLCGAWEQEG---SVPQVSSLDPRYQRLMQELERSDSR 72

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
                   + +   +G ++V    D     + +G V+S  G        F+    S + Q
Sbjct: 73  PHPQTRRSEGILERLGHEVVNTAKDGLDLLNFIGAVVSAMGRVAVRPRSFR--FTSTVAQ 130

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           +  VG   VP+++LI+F+ G++IAQQ  F   +FGA+IF +D++ +L LRE+GVL+ ++M
Sbjct: 131 LDRVGFRAVPIILLITFLVGSIIAQQSIFHFRRFGADIFVVDMVGVLVLRELGVLIVSIM 190

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           IAGRSGSA  AE+GSM++ EE+DA++ MGLD + +L+ PRI ALII LPLLT L + +A+
Sbjct: 191 IAGRSGSAYTAELGSMRMREEVDALKVMGLDPIEVLVVPRILALIIGLPLLTFLGSMAAL 250

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           IG  +V W Y  I   VF  R      L     G+ KAPFMA AIG+VA  EG  VG  +
Sbjct: 251 IGGGLVAWFYGGITPNVFIDRLKQAIDLTQFEVGMYKAPFMAAAIGLVACLEGLKVGGSA 310

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            SLG+  T  VV++I +VI++D LFA+F+ +I
Sbjct: 311 ESLGQHTTASVVKAIFLVIVMDGLFAVFFASI 342


>gi|296445994|ref|ZP_06887944.1| protein of unknown function DUF140 [Methylosinus trichosporium
           OB3b]
 gi|296256512|gb|EFH03589.1| protein of unknown function DUF140 [Methylosinus trichosporium
           OB3b]
          Length = 382

 Score =  233 bits (595), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 134/366 (36%), Positives = 210/366 (57%), Gaps = 11/366 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG- 67
           F  AG+W      +I       +     +  A+VDL  ++ +DT GA +I   +++    
Sbjct: 23  FALAGDWVLAAAMDIERAAEKMVADGRGATRAVVDLVHVSRLDTAGAWVIGRALDELARA 82

Query: 68  --KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +  ++G     E L     F  R+   + +P+ S   +   +L    G+ +V    D+
Sbjct: 83  GVEASVEGARPEHELLLREAHF--RRFETDSRPRSSLCIDILADL----GRSVVTAGRDA 136

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            + A  LG  ++ TG   A + +F+    S +  +   G+  VP++ LI+ + GA++AQQ
Sbjct: 137 FAGAVFLGEFVAVTGRAVAIARRFR--FTSFVYHLENFGLRSVPIIALINLLVGAIVAQQ 194

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G FQL +FGA  +++DL+ +L LRE+GVLL+++MIAGRSGSAI AE+GSMK+ EEIDA+R
Sbjct: 195 GIFQLRRFGASTYAVDLIGVLVLRELGVLLSSIMIAGRSGSAITAELGSMKMREEIDALR 254

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL  +  L++PRI AL++++PLL  +A+ SA+ G  +V W Y  I    +     +  
Sbjct: 255 VMGLSPMDALVTPRILALVVAMPLLAFIADMSALFGGLLVCWGYEGISPVAYLEWLQAAI 314

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
                  G+IKAPFMA  IGIV+  EG +    + SLG+ VT  VV+SI +VI++D LFA
Sbjct: 315 GRNTFMVGIIKAPFMAFTIGIVSAMEGMSTKGSAESLGRHVTAAVVKSIFMVIVLDGLFA 374

Query: 366 IFYFAI 371
           IF+ +I
Sbjct: 375 IFFASI 380


>gi|323136828|ref|ZP_08071909.1| protein of unknown function DUF140 [Methylocystis sp. ATCC 49242]
 gi|322398145|gb|EFY00666.1| protein of unknown function DUF140 [Methylocystis sp. ATCC 49242]
          Length = 380

 Score =  233 bits (594), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 142/372 (38%), Positives = 210/372 (56%), Gaps = 13/372 (3%)

Query: 4   NGITVFRFAGNW---KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELI-M 59
           NG      +G+W    S  + + A  +V   ++  +     +DLS + ++DT GA LI  
Sbjct: 16  NGGERLALSGDWILIASRRLEQKAQQLV---DEGGRVKFVTIDLSGVEKLDTAGAWLINR 72

Query: 60  YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
              E  H  + +       E    L     R+    +KP R  F N+  +L   +G  +V
Sbjct: 73  ARHELAHADVGVALAHARPEHHTMLEEAAFRE---FEKPPRRRF-NAIVDLLADLGASVV 128

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             + +       LG  I+           F+    SL+  M  +G    P+++LI+ + G
Sbjct: 129 DALREFYRGVAFLGEFIAAMAYVATHPGHFR--FTSLVFHMETIGFRSAPIIVLINLLVG 186

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           A++AQQG FQL +FGA  +++ L+ IL LRE+GVLLT++MIAGRSGSAI AEIGSMK+ E
Sbjct: 187 AIVAQQGIFQLLKFGASSYTVSLIGILVLRELGVLLTSIMIAGRSGSAITAEIGSMKMRE 246

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+R MGL  + +LI+PR+ ALI+SLP+LT +A+ +A+ G  +V W Y  I  A F S
Sbjct: 247 EIDALRVMGLSPIEVLIAPRVLALIVSLPILTFIADMAALFGGLLVSWSYGGISPAAFLS 306

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                  L     G+IKAPFMA  IG++A  +G      + SLG++VT+ VV+SI +VI+
Sbjct: 307 LLKEAIALHTFLVGMIKAPFMALVIGLIAAMDGLETKGSAESLGRQVTSSVVKSIFMVIV 366

Query: 360 IDSLFAIFYFAI 371
           +D LFAIF+ +I
Sbjct: 367 LDGLFAIFFASI 378


>gi|91975833|ref|YP_568492.1| hypothetical protein RPD_1353 [Rhodopseudomonas palustris BisB5]
 gi|91682289|gb|ABE38591.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB5]
          Length = 378

 Score =  232 bits (591), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 195/336 (58%), Gaps = 12/336 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHI----EQLFSLISFTHRKKIKNQK 97
           +D++ + EIDTIGA    + +EK   +    G + H     E+   LI     +++   +
Sbjct: 51  IDMTEVIEIDTIGA----WLLEKASREAAQAGRTAHFVGVGERYAGLIE--EVRQVNRHR 104

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           P      N        +G+       D      + G +              +  L SL 
Sbjct: 105 PTPKPKVNPIIARLDQVGRSAWSATQDIAVFLDMFGALGVALLGVLRRPRSLR--LTSLT 162

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
            Q+Y VG   +P+V+LI+F+ GA+IAQQG F   +FGAE + +D++ IL LREIGVL+ A
Sbjct: 163 YQIYRVGWRAIPIVVLITFLIGAIIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVA 222

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+AGRSGSA  AE+GSMK+ EEIDA+ TMGLD V +LI PRI AL+I+LP+LT + + S
Sbjct: 223 IMVAGRSGSAYTAELGSMKMREEIDALSTMGLDPVEVLILPRIIALVIALPILTFIGSMS 282

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           A+ G  +  W Y  +  AV+ +R H   +L +   G+ KAPFMA  IGIVA  EG  V  
Sbjct: 283 ALYGGLLTAWFYGGMQPAVYIARLHEAVSLNSFEVGIWKAPFMALVIGIVACSEGLRVKG 342

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            + SLG + TT VV+SI +VI++D LFA+F+ +IG+
Sbjct: 343 SAESLGLQTTTSVVKSIFLVIVLDGLFAVFFASIGL 378


>gi|39937024|ref|NP_949300.1| hypothetical protein RPA3963 [Rhodopseudomonas palustris CGA009]
 gi|192292851|ref|YP_001993456.1| hypothetical protein Rpal_4485 [Rhodopseudomonas palustris TIE-1]
 gi|39650881|emb|CAE29404.1| putative permease of ABC transporter [Rhodopseudomonas palustris
           CGA009]
 gi|192286600|gb|ACF02981.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           TIE-1]
          Length = 383

 Score =  231 bits (589), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 131/336 (38%), Positives = 192/336 (57%), Gaps = 13/336 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQL----FSLISFTHRKKIKNQK 97
           +D+S I  +DT GA LI    E+    +   G    I  L     SL+    +      +
Sbjct: 57  IDVSGIARLDTFGAWLI----ERLRRNLGQDGTEARIAGLSTNYASLVDEVRQVSEAGPE 112

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           P+R     S +     +G+ I  FI+D  +   ++G V++           F+  L S +
Sbjct: 113 PRRG---GSLRAPIERLGRTIYAFIDDIVALISMMGAVLAGVLRVVVRPTSFR--LTSTV 167

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
             +  V    VP+++LI+F+ G +IAQQG F   +FGA++F +D++ +L LREIGVLL +
Sbjct: 168 HHLEQVCWRAVPIIVLITFLIGCIIAQQGIFHFRKFGADVFVVDMLGVLVLREIGVLLVS 227

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+AGRSGSA  AE+GSMK+ EEIDA+RTMG D + +LI PR+ AL++++P+LT L   S
Sbjct: 228 IMVAGRSGSAYTAELGSMKMREEIDALRTMGFDPIDVLIVPRLIALVLAVPILTFLGAMS 287

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           A+ G  +V W Y  +    F  R     ++ +   G+IKAP MA  IGIVA  EG AV  
Sbjct: 288 ALYGGGLVAWMYGGVDPEAFLLRLRDAISIDHFTVGMIKAPVMAVVIGIVACVEGLAVQG 347

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            + SLG   T  VV+SI  VI++D +FAIF+  IGI
Sbjct: 348 SAESLGSHTTASVVKSIFFVIVMDGVFAIFFAGIGI 383


>gi|154252954|ref|YP_001413778.1| hypothetical protein Plav_2512 [Parvibaculum lavamentivorans DS-1]
 gi|154156904|gb|ABS64121.1| protein of unknown function DUF140 [Parvibaculum lavamentivorans
           DS-1]
          Length = 387

 Score =  230 bits (587), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 207/366 (56%), Gaps = 13/366 (3%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
           AG+W    +  + D  + AI     +  AI+    IT  DT  A +    + +    +  
Sbjct: 31  AGDWSIVHLDPV-DRQLRAIGARPGTGRAIIGFKDITRFDTAAAAI----LGRTAAHLGE 85

Query: 72  QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA-- 129
           QG+    E +         K      P+ +  +  ++ LH  I  KI   + D  ++   
Sbjct: 86  QGIKVDFEDVSDAQRLLLDKIDSCGMPEPA--HVPWRPLHIQIIDKIGATMRDIGAEGLA 143

Query: 130 --HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +G V++  G   A   + +      +  M   G   +P+V L++F+ GAV+AQQGA
Sbjct: 144 MLGFVGAVMATAGRTIARPSRLR--WTPFVHHMEKAGFDALPLVCLLTFLIGAVVAQQGA 201

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL QFGAE+F+++L++I+ LRE+G+LLTA+++AGRSGSA  AEIGSMK+ EEIDA+RT+
Sbjct: 202 VQLRQFGAEVFTVNLIAIIFLREVGLLLTAIIVAGRSGSAFTAEIGSMKMREEIDAMRTL 261

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD + +L+ PR+ AL+++LPLLT +A+   +IG  +V+    D+P  V+ SR       
Sbjct: 262 GLDPMEMLVLPRVLALMVTLPLLTFVADIMGLIGGGLVVQVMLDMPPGVYISRVQEAVGF 321

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
                GL+KAPFMA  I +V  + G +V   + S+G   T  VV+SI +VII+D+LFA+F
Sbjct: 322 WTFGVGLVKAPFMAVVIALVGCRSGLSVTGSAESVGAMTTRSVVRSIFLVIILDALFAMF 381

Query: 368 YFAIGI 373
           + A+GI
Sbjct: 382 FTAVGI 387


>gi|86748498|ref|YP_484994.1| hypothetical protein RPB_1373 [Rhodopseudomonas palustris HaA2]
 gi|86571526|gb|ABD06083.1| Protein of unknown function DUF140 [Rhodopseudomonas palustris
           HaA2]
          Length = 378

 Score =  229 bits (585), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 136/336 (40%), Positives = 195/336 (58%), Gaps = 12/336 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHI----EQLFSLISFTHRKKIKNQK 97
           +D++ + EIDTIGA    + +EK        G +       ++   LI    +   +  K
Sbjct: 51  IDMTDVVEIDTIGA----WLLEKVSRDAAQAGRTAQFVGVADRYAGLIEEVRQVNRRGPK 106

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           P+ S   N        IG+       D      +LG +              +  L SL 
Sbjct: 107 PRPSV--NPIIARLDQIGRSAWSATQDISVFLAMLGALGVALLGVLRRPRSLR--LTSLT 162

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
            Q+Y VG   +P+V+LI+F+ GA+IAQQG F   +FGAE + +D++ IL LREIGVL+ A
Sbjct: 163 YQVYRVGWQAIPIVVLITFLIGAIIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVA 222

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+AGRSGSA  AE+GSMK+ EEIDA+ TMGLD V +LI PRI AL+I+LP+LT + + +
Sbjct: 223 IMVAGRSGSAYTAELGSMKMREEIDALTTMGLDPVEVLILPRIIALVIALPILTFIGSMA 282

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           A+ G  +  W Y  +  AV+ +R H   +L +   G+ KAPFMA  IGIVA  EG  V  
Sbjct: 283 ALYGGLLTAWFYGGMQPAVYIARLHEAVSLNSFEVGIWKAPFMALVIGIVACSEGLRVKG 342

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            + SLG + TT VV+SI +VI++D LFA+F+ +IG+
Sbjct: 343 SAESLGLQTTTSVVKSIFLVIVLDGLFAVFFASIGM 378


>gi|316935525|ref|YP_004110507.1| hypothetical protein Rpdx1_4222 [Rhodopseudomonas palustris DX-1]
 gi|315603239|gb|ADU45774.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           DX-1]
          Length = 383

 Score =  229 bits (584), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 127/336 (37%), Positives = 193/336 (57%), Gaps = 13/336 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQL----FSLISFTHRKKIKNQK 97
           +D+S I  +DT GA LI    E+    +   G    I  L     SL+    +       
Sbjct: 57  IDVSGIARLDTFGAWLI----ERLRRNLGQAGAEARIAGLSANYASLVDEVRQVSETGPA 112

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           P+R     + +     +G+ +  F +D  +   ++G V++  G        F+  L S +
Sbjct: 113 PKRG---GALRAPIERLGRTMYAFFDDIVALISMMGAVLAGLGRIVIRPTSFR--LTSTV 167

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
             +  V  + VP+++LI+F+ G ++AQQG F   +FGA++F +D++ +L LRE+GVLL A
Sbjct: 168 HHLEQVCWNAVPIILLITFLIGCIVAQQGIFHFRKFGADVFVVDMLGVLVLRELGVLLVA 227

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+AGRSGSA  AE+GSMK+ EEIDA+RTMG D + +LI PR+ AL++++P+LT L   +
Sbjct: 228 IMVAGRSGSAYTAELGSMKMREEIDALRTMGFDPIDVLIVPRLIALVLAVPILTFLGAMA 287

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           A+ G  +V W Y  +    F  R     ++ +   G+IKAP MA  IGIVA  EG AV  
Sbjct: 288 ALYGGGLVAWLYGGVDPEAFLLRLRDAISIDHFTVGMIKAPVMAAVIGIVACVEGLAVQG 347

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            + SLG+  T  VV+SI  VI++D +FAIF+  IGI
Sbjct: 348 SAESLGRHTTASVVKSIFFVIVMDGVFAIFFAGIGI 383


>gi|304391808|ref|ZP_07373750.1| ABC transporter, membrane spanning protein [Ahrensia sp. R2A130]
 gi|303296037|gb|EFL90395.1| ABC transporter, membrane spanning protein [Ahrensia sp. R2A130]
          Length = 385

 Score =  229 bits (583), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 135/366 (36%), Positives = 223/366 (60%), Gaps = 18/366 (4%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIV-DLSAITEIDTIGAELIMYFMEKYHGKIK 70
           +G W    I E+ DD+      SI+  + +V + +A T++DT GA    + +E+   +++
Sbjct: 30  SGPWTIAFIEEVDDDIRAF---SIEGSAKLVLNTTAATQLDTSGA----WLIERLRQRVE 82

Query: 71  LQGVS-THIE---QLFSLISFTHRK-KIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             G++ +H +   +   L+   HR+ + +   P ++    S++     +G+  ++F  D 
Sbjct: 83  EAGIAFSHEDDEPRRQQLVDVIHRRERPETDAPTQT---KSWRGPIVRLGEIGIEFGRDL 139

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +  +ILG  +        S    +  ++S++ Q+  +G   VPVV ++SF+ GA+IAQQ
Sbjct: 140 MTALYILGSSVRGPSSNGGSGRGLR--VMSILNQIDQMGWRAVPVVFVMSFLIGAIIAQQ 197

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA+Q+  +G E+ +I L+ IL  RE+GVLLT++M+AGRSGSAI AEIG+MK+ EEIDA++
Sbjct: 198 GAYQMQAYGEELLAISLVGILHFREVGVLLTSIMVAGRSGSAITAEIGTMKMREEIDALQ 257

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL+ V +L+ PR+ A++I LP+LT+L+N + I+GA +V+  Y  I  + F +      
Sbjct: 258 VMGLNPVGVLLFPRLLAIMICLPILTLLSNIAGIMGAMVVMDIYVGITPSQFITTLTEDI 317

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           +  ++  GL KAP MA  IG+VA  EG  VG  S SLG++ T  VV+SI +VI++D LF 
Sbjct: 318 SPRHLAVGLAKAPVMALIIGLVAAVEGLKVGGSSESLGQRTTAAVVKSIFLVIVVDGLFT 377

Query: 366 IFYFAI 371
           IF+ A+
Sbjct: 378 IFFSAM 383


>gi|209884491|ref|YP_002288348.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
 gi|209872687|gb|ACI92483.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
          Length = 378

 Score =  228 bits (582), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 139/375 (37%), Positives = 213/375 (56%), Gaps = 24/375 (6%)

Query: 9   FRFAGNW---KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME-K 64
            R AG W    +P + ++ +    A  KS ++ + ++D+S ++ +DT GA LI      +
Sbjct: 18  LRAAGEWTVHHAPALEKLVEHTERA-GKS-RNAALVIDVSQVSRLDTFGAWLIERLRRAQ 75

Query: 65  YHGKI--KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF----FYNSFKNLHYHIGKKI 118
             G +   + G+S       SL+    R K    +P+ +F       +       +G+ +
Sbjct: 76  IRGDVAPPIAGLSA---DYASLVEEVKRVKAPPVQPRPAFGPIRAVEAVGRSVVEVGQTL 132

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +  +N   S  H L  VI +      S ++F     S I  +  V    VP+V+LI+F+ 
Sbjct: 133 LSLLNMMGSVLHALWRVILHP-----SHFRFT----STIHHLEQVCWRAVPIVLLITFLI 183

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G +IAQQG FQ  +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSM++ 
Sbjct: 184 GCIIAQQGIFQFRKFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMRMR 243

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+RTMG D   +LI PRI ALII++P+L  L   +A+ G  +  W Y  +    F 
Sbjct: 244 EEVDALRTMGFDPTEVLILPRILALIIAMPILAFLGAMAALYGGGLTAWLYGGVQPDAFL 303

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +R     ++ +   GL+KAPFMA  IGI+A  EG AV   + SLG+  T  VV+SI  VI
Sbjct: 304 ARLREAISINHFTVGLVKAPFMALIIGIIACVEGAAVRGSAESLGQHTTASVVKSIFFVI 363

Query: 359 IIDSLFAIFYFAIGI 373
           ++D +FAIF+ +IG+
Sbjct: 364 VVDGIFAIFFASIGV 378


>gi|39937298|ref|NP_949574.1| hypothetical protein RPA4238 [Rhodopseudomonas palustris CGA009]
 gi|39651156|emb|CAE29679.1| putative permease of ABC transporter [Rhodopseudomonas palustris
           CGA009]
          Length = 378

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 143/372 (38%), Positives = 210/372 (56%), Gaps = 26/372 (6%)

Query: 13  GNWKSPE---ISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH--- 66
           G W +     + +++ DV   I  +    S  +D++ I EIDTIGA    + +EK     
Sbjct: 22  GAWTATNSKFMEQLSQDVAPQIAAA---KSLTIDMAEIGEIDTIGA----WVLEKLSRSA 74

Query: 67  ---GKI-KLQGVSTHIEQLFSLI-SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              G+  + +G+ST   +L   +     R    + KP      N        IG+     
Sbjct: 75  AQAGRTAQFKGISTSYAELIDEVRQLNRRGPTPHPKP------NPIIAKLDEIGRSAWSA 128

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D      +LG + +            +  L SL  Q+Y VG   +P+++LI+F+ GA+
Sbjct: 129 TTDMAVFLEMLGALGAALLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIMVLITFLIGAI 186

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEI
Sbjct: 187 IAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEI 246

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD V +LI PRI AL+I+LP+L  + + +A+ G  +  W Y  +  +VF +R 
Sbjct: 247 DALSTMGLDPVEVLILPRIIALVIALPILAFVGSMAALYGGLLTAWFYGGMQPSVFIARL 306

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI++D
Sbjct: 307 HEAVSLNSFEVGMWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVLD 366

Query: 362 SLFAIFYFAIGI 373
            LFA+F+ +IG+
Sbjct: 367 GLFAVFFASIGM 378


>gi|192293078|ref|YP_001993683.1| hypothetical protein Rpal_4717 [Rhodopseudomonas palustris TIE-1]
 gi|192286827|gb|ACF03208.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           TIE-1]
          Length = 382

 Score =  228 bits (581), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 143/372 (38%), Positives = 210/372 (56%), Gaps = 26/372 (6%)

Query: 13  GNWKSPE---ISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH--- 66
           G W +     + +++ DV   I  +    S  +D++ I EIDTIGA    + +EK     
Sbjct: 26  GAWTATNSKFMEQLSQDVAPQIAAA---KSLTIDMAEIGEIDTIGA----WVLEKLSRSA 78

Query: 67  ---GKI-KLQGVSTHIEQLFSLI-SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              G+  + +G+ST   +L   +     R    + KP      N        IG+     
Sbjct: 79  AQAGRTAQFKGISTSYAELIDEVRQLNRRGPTPHPKP------NPIIAKLDEIGRSAWSA 132

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D      +LG + +            +  L SL  Q+Y VG   +P+++LI+F+ GA+
Sbjct: 133 TTDMAVFLEMLGALGAALLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIMVLITFLIGAI 190

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEI
Sbjct: 191 IAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEI 250

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD V +LI PRI AL+I+LP+L  + + +A+ G  +  W Y  +  +VF +R 
Sbjct: 251 DALSTMGLDPVEVLILPRIIALVIALPILAFVGSMAALYGGLLTAWFYGGMQPSVFIARL 310

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI++D
Sbjct: 311 HEAVSLNSFEVGMWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVLD 370

Query: 362 SLFAIFYFAIGI 373
            LFA+F+ +IG+
Sbjct: 371 GLFAVFFASIGM 382


>gi|182680400|ref|YP_001834546.1| hypothetical protein Bind_3500 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636283|gb|ACB97057.1| protein of unknown function DUF140 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 376

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 211/362 (58%), Gaps = 8/362 (2%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G+W     + + + ++  + +  +  +  VD+  + EIDT GA L+   ++ +  + K  
Sbjct: 22  GSWIGAHAAAL-EPLIEGVRRDGRGRTLSVDMRGVDEIDTFGACLLERLIQSWKAEGKET 80

Query: 73  GVSTHIEQLFSLIS-FTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHI 131
            ++   ++   L++   H  +  +Q   +    +S +      G+  +    D+ +   +
Sbjct: 81  TITGLSDRFGDLVAEVDHVSRSMSQAAAKRTSLDSLRAF----GRAAMDLWLDTRNFLVV 136

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           LG +++          K +    SL+ Q+  VG+  VP+++LI+F+ G +IAQQG F   
Sbjct: 137 LGRLVAVFLVVLRHPKKMR--FTSLVAQLDRVGLQAVPIILLITFLIGGIIAQQGLFNFR 194

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           +FGA+ + +DL++ L LRE+GVL+ A+M+AGRSGS+  AEIGSMK+ EEIDA+RTMGLD 
Sbjct: 195 KFGADTYVVDLLAFLVLRELGVLIVAIMVAGRSGSSYTAEIGSMKMREEIDALRTMGLDP 254

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           V +L+ PR+ AL+++LP+LT L   +A+ G  +V W Y  +   +F  R    A+L    
Sbjct: 255 VEVLLLPRVLALVLALPMLTFLGFMAALYGGGVVSWIYGGMSPPIFIERIRDAASLTQFE 314

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            GLIKAPFMA  IG++A  EG AV   + SLG + T+ VV+SI ++I++D +  +F+ A 
Sbjct: 315 VGLIKAPFMALVIGVIACTEGLAVQGSAESLGLRTTSSVVKSIFLIIVLDGILDLFFAAT 374

Query: 372 GI 373
           G+
Sbjct: 375 GM 376


>gi|148256837|ref|YP_001241422.1| putative ABC transporter permease [Bradyrhizobium sp. BTAi1]
 gi|146409010|gb|ABQ37516.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           BTAi1]
          Length = 377

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 134/368 (36%), Positives = 202/368 (54%), Gaps = 11/368 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH-- 66
            R  G W +P    +   V  A   + +     +D+S ++ +DT GA LI      +   
Sbjct: 18  LRATGAWTAPFAPSLERLVADAEKLAGKKIDVSIDVSEVSRLDTFGAWLIERLRRSFTTG 77

Query: 67  -GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             + ++ G+S +     SL+    R    +  P       +   +   IG+ +       
Sbjct: 78  TAEARIDGLSANYA---SLVDEVRRV---SAAPDGDATAVTITGMLGQIGRSVAGIFGTV 131

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +   +LG VI  +G        F+  L S I  +  V    VP+++LI+F+ G +IAQQ
Sbjct: 132 AALIDMLGAVIVASGRVFIHPRSFR--LTSTIHHLEQVCWRAVPIIVLITFLIGCIIAQQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G F   +FGA+IF +D++ +L LREIGVLL A+MIAGRSGSA  AE+GSMK+ EEIDA+R
Sbjct: 190 GIFHFRRFGADIFVVDMLGVLVLREIGVLLVAIMIAGRSGSAYTAELGSMKMREEIDALR 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG D + +LI PR+ AL+I+LP+L+ L + +A+ G  +V W Y  +    F  R     
Sbjct: 250 TMGFDPIEVLILPRMLALVIALPILSFLGDIAALYGGGLVAWFYGGVDPEAFLLRLREAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           ++ +   GL+KAP MA  IGIVA  EG AV   + SLG+  T+ VV+ I  VI++D +FA
Sbjct: 310 SIDHFTVGLLKAPVMAAVIGIVACVEGLAVQGSAESLGRHTTSSVVKGIFFVIVMDGVFA 369

Query: 366 IFYFAIGI 373
           IF+  +G+
Sbjct: 370 IFFATVGM 377


>gi|27381176|ref|NP_772705.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
 gi|27354343|dbj|BAC51330.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
          Length = 378

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 135/373 (36%), Positives = 216/373 (57%), Gaps = 20/373 (5%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSD-----SAIVDLSAITEIDTIGAELIMYFME 63
            R  G+W +  ++     ++  +++S+ +D     +  +D+S ++ +DT+GA    + +E
Sbjct: 18  LRPQGSWTAANVA-----MLETLSRSVGADVDRSRAVTLDMSGVSALDTLGA----WVLE 68

Query: 64  KYHGKIKLQGVSTH---IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
           K   +    G S     +   FS +    R+  ++     +        L   +GK  V 
Sbjct: 69  KLSRRAATSGRSAEFVGVADHFSGLMDEVREVNRHTPAPAAAPNPLLLRLG-DLGKSTVG 127

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D      +LG +              +  L SL+ Q+Y +G   +P+V LI+F+ GA
Sbjct: 128 AREDITIFLQMLGALFMAIFGVLRRPRSLR--LTSLVYQLYRIGWQAIPIVALITFLIGA 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGAE +++D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 186 IIAQQGFFHFRRFGAESYTVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ TMGLD V +LI PR+ AL+I+LP+L  + + +A+ G  +V   Y D+  A++ +R
Sbjct: 246 IDALSTMGLDPVGVLILPRVAALVIALPILAFIGSIAALYGGGLVAQFYGDMGPAIYIAR 305

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            H   ++ +   G++KAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++
Sbjct: 306 LHEAISVTHFEVGILKAPFMALVIGIVACSEGLRVKGSAESLGRQTTTSVVKSIFLVIVL 365

Query: 361 DSLFAIFYFAIGI 373
           D LFAIF+ +IG+
Sbjct: 366 DGLFAIFFASIGM 378


>gi|316935758|ref|YP_004110740.1| hypothetical protein Rpdx1_4456 [Rhodopseudomonas palustris DX-1]
 gi|315603472|gb|ADU46007.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           DX-1]
          Length = 382

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 207/370 (55%), Gaps = 22/370 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQS-DSAIVDLSAITEIDTIGAELIMYFMEKYH----- 66
           G W +   S+I + +     + I S  S  +D++AI EIDTIGA    + +EK       
Sbjct: 26  GAWTATN-SKIMEQLSAGAAQQIASAKSLTIDMAAIGEIDTIGA----WVLEKLSRSAAE 80

Query: 67  --GKIKLQGVSTHIEQLFSLI-SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                + +G++    +L   +     R    + KP      N        IG+       
Sbjct: 81  AGSPAQFKGIADSYAELIDEVRQLNRRGPTPHPKP------NPIIAKLDEIGRSAWSATA 134

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D      +LG +              +  L SL  Q+Y VG   +P+++LI+F+ GA+IA
Sbjct: 135 DIAVFLQMLGALGVAVLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIMVLITFLIGAIIA 192

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG F   +FGA+ + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA
Sbjct: 193 QQGIFHFRKFGADSYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEIDA 252

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + TMGLD V +LI PRI AL+I+LP+L  + + +A+ G  +  W Y  +  +VF +R H 
Sbjct: 253 LSTMGLDPVEVLILPRIIALVIALPILAFIGSMAALYGGLLTAWFYGGMQPSVFIARLHE 312

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI++D L
Sbjct: 313 AVSLNSFQVGMWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVLDGL 372

Query: 364 FAIFYFAIGI 373
           FA+F+ +IG+
Sbjct: 373 FAVFFASIGM 382


>gi|254470335|ref|ZP_05083739.1| ABC transporter permease protein [Pseudovibrio sp. JE062]
 gi|211960646|gb|EEA95842.1| ABC transporter permease protein [Pseudovibrio sp. JE062]
          Length = 382

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 138/373 (36%), Positives = 214/373 (57%), Gaps = 8/373 (2%)

Query: 2   SENG-ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +E+G + +   +G W   +     ++++  +  S+      VDL A++ +DT GA L+  
Sbjct: 15  AEDGALLLLTASGAWGIRQ-GATCENLINQVAASLTHSVICVDLKAVSFLDTAGAWLLQR 73

Query: 61  F-MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
           F ME+     +++ +    E+   L+    R+++ N  P      NSF N    +G+   
Sbjct: 74  FQMEQAEQGREVKFLYED-ERFDILLKEVDRQEVDN--PTEEHSGNSFLNYLEAVGEATR 130

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +   D+     +LG + +          + +   + +  Q   +G   VP+V L+SF+ G
Sbjct: 131 QLGRDTRDILAMLGSLTATITAAATHPSRLRPISIGVQFQRSCMG--AVPIVCLMSFLIG 188

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            +IAQQG F L QFGAEIF +DL  IL LREIGV+LTA+M+AGRSGSA  AE+GSMK+ E
Sbjct: 189 GIIAQQGGFYLKQFGAEIFVVDLSGILVLREIGVILTAIMVAGRSGSAYTAELGSMKMQE 248

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA++  GL    +LI PR+ AL+I+LP+L  LAN +A+ GA +  W Y  I    F +
Sbjct: 249 EIDALQVTGLRVTEVLILPRLVALMIALPILVFLANIAALFGAGLTCWWYLGIVPHSFIA 308

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           +  +  T+  +  G++KAPFMA  IG++A  EG  V   S SLG+  T  VV+SI +VI+
Sbjct: 309 QLQAAVTVDTLMVGIVKAPFMALIIGLIACMEGMKVEGSSESLGRHTTVSVVKSIFMVIV 368

Query: 360 IDSLFAIFYFAIG 372
           +D +FA+F+ +IG
Sbjct: 369 VDGVFAVFFASIG 381


>gi|299131823|ref|ZP_07025018.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
 gi|298591960|gb|EFI52160.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
          Length = 383

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 133/371 (35%), Positives = 206/371 (55%), Gaps = 16/371 (4%)

Query: 9   FRFAGNWK---SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---M 62
            R  G W    +P + ++ +    + + S    S ++D+S I+ +DT GA LI      +
Sbjct: 23  LRAGGEWTVHHAPALEKLVERTERSRDGS--RASLVIDVSQISRLDTFGAWLIERLRRAL 80

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +      + G+S     L   +     K++K         +   + +   +G+ +V   
Sbjct: 81  TRGDTAPMIAGLSADYASLVEEV-----KRVKAVPEPAKVPFGPVRAVEA-VGRTVVGVA 134

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +      ++ G ++S           F+  L S + Q+  V    VP+V+LI+F+ G +I
Sbjct: 135 DTLLGLLNMTGSILSAFWRVILHPSHFR--LTSTVHQLEQVCWRAVPIVVLITFLIGCII 192

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG FQ  +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSM++ EE+D
Sbjct: 193 AQQGIFQFRKFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMRMREEVD 252

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMG D   +LI PRI AL+I++P+L  L   +A+ G  +  W Y  +    F SR  
Sbjct: 253 ALRTMGFDPTEVLILPRILALVIAMPILAFLGAMAALYGGGLTAWLYGGVQPDAFLSRLR 312

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   GL+KAPFMA  IGI+A  EG AV   + SLGK  T  VV+SI  VI++D 
Sbjct: 313 EAISINHFTVGLVKAPFMALIIGIIACVEGAAVQGSAESLGKHTTASVVKSIFFVIVVDG 372

Query: 363 LFAIFYFAIGI 373
           LFAIF+ +IG+
Sbjct: 373 LFAIFFASIGV 383


>gi|90422963|ref|YP_531333.1| hypothetical protein RPC_1452 [Rhodopseudomonas palustris BisB18]
 gi|90104977|gb|ABD87014.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB18]
          Length = 377

 Score =  226 bits (576), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 129/365 (35%), Positives = 207/365 (56%), Gaps = 11/365 (3%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEKYHGK 68
           AG+W +P    +   V  A   S    +  +D+SA+ ++DT GA LI      + +   +
Sbjct: 21  AGSWTAPFAPVLERIVAEAEALSGTRPNISIDVSAVAKLDTFGAWLIERLRRSLTQGDAE 80

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
             + G+S +   L   +     +++K+ +P +     S +     +G+ +  F++     
Sbjct: 81  ATIAGLSANYSSLVDEV-----RRVKDPEPSKRGGI-SLRAPVERLGRSVAGFLDTIVGL 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             + G V++           F+  L S +  +  V    VP+V+LI+F+ G ++AQQG F
Sbjct: 135 VAMTGAVMAGMLRVVMHPGSFR--LTSTVHHLEQVCWRAVPIVMLITFLIGCIVAQQGIF 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
              +FGA++F +D++ +L LRE+GVLL A+M+AGRSGSA  AE+GSMK+ EEIDA+RTMG
Sbjct: 193 HFRKFGADVFVVDMLGVLVLRELGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRTMG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
            D + +LI PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R     ++ 
Sbjct: 253 FDPIDVLIMPRMMALVLAMPILTFLGVVAALYGGGLVAWLYGGVDPDAFLLRLRDAISID 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+IKAP MA  IGIVA  EG AV   + SLG+  T  VV+ I  VI++D +FAIF+
Sbjct: 313 HFTVGMIKAPVMAIVIGIVACVEGLAVAGSAESLGRHTTASVVKGIFFVIVMDGVFAIFF 372

Query: 369 FAIGI 373
            +IG+
Sbjct: 373 ASIGM 377


>gi|90425518|ref|YP_533888.1| hypothetical protein RPC_4043 [Rhodopseudomonas palustris BisB18]
 gi|90107532|gb|ABD89569.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB18]
          Length = 378

 Score =  225 bits (573), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 133/370 (35%), Positives = 208/370 (56%), Gaps = 12/370 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + R  G+W +   + +     +   +  Q+ +  +DL+ + EIDT+GA    + +EK   
Sbjct: 17  LLRPTGSWTAVHAAALEHLFDVVAPQLRQAKALTIDLAELHEIDTLGA----WLLEKISR 72

Query: 68  KIKLQGVSTHI----EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +    G    +    E+   LI     +++  ++P  +   +        IG+       
Sbjct: 73  RAAQAGHPASVVGAAERYAGLID--QVRQVNRRQPANAVRGSLILTRLEDIGRATWGARE 130

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D  +   + G + +            +  L SL+ Q+Y VG   +P++ LI+F+ GA+IA
Sbjct: 131 DLFAFLQMTGALANALLGVLRRPRSLR--LTSLVYQIYRVGWQAIPIIGLITFLIGAIIA 188

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG F   +FGAE + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA
Sbjct: 189 QQGIFHFRKFGAESYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEIDA 248

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + TM LD V +LI PR+ ALII+LP+L  L   +A+ G  +V W Y  +   +F +R H 
Sbjct: 249 LSTMDLDPVEVLILPRVIALIIALPILAFLGAMAALYGGGLVAWFYGGMSPTIFIARLHE 308

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             ++ +   G+IKAPFMA  IGIVA  EG  V   + SLG++ T  VV+SI  VI++D L
Sbjct: 309 AVSITHFEVGIIKAPFMALVIGIVACSEGLRVMGSAESLGRQTTASVVKSIFCVIVLDGL 368

Query: 364 FAIFYFAIGI 373
           FA+F+ +IG+
Sbjct: 369 FAVFFASIGM 378


>gi|254512708|ref|ZP_05124774.1| ABC transporter, inner membrane subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221532707|gb|EEE35702.1| ABC transporter, inner membrane subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 374

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 133/368 (36%), Positives = 207/368 (56%), Gaps = 15/368 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIV-DLSAITEIDTIGAELIMYFMEKY--- 65
           R  G+ ++ E+    DDV     K   S   +V D+S +  +DT GA LI   + +    
Sbjct: 18  RITGDLRTQEL----DDVEADFGKLRPSGQNVVLDMSQLQSLDTGGAWLIADLVRRLGSD 73

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +++ +G       L   +S    + + +Q P R             IG++      D+
Sbjct: 74  SSQVQFEGAKPAHASLIETVSKNIPQAVGDQAPARGVVV-----WVSRIGERTFGAWEDT 128

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            S    LGL +          ++ +    +L+ QM  VG   +P+V L+ F+ G V+A Q
Sbjct: 129 LSIMGFLGLTLHRLVRTLIMPWRLR--RAALVSQMEQVGFKALPIVALMGFLIGVVLAFQ 186

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA QL QFGAEIF ++L+SI  LRE+G+LLTA+++AGRSGSA  A IGSMK+ EEIDA+R
Sbjct: 187 GATQLKQFGAEIFVVELISISILRELGILLTAIIVAGRSGSAFTASIGSMKVQEEIDAMR 246

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ AL+I LP+L  +A+ + +IG +++ W    +   +F +R     
Sbjct: 247 TLGLDPIEVLVIPRVLALLIMLPILGFIADMAGLIGGALMSWIDLGVSPGMFLTRLKENT 306

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +A +  G+IKAPF A  IG++A  +   V   S S+G++ T  VVQSI +VI ID+LF+
Sbjct: 307 GVAQLAVGMIKAPFFALVIGVIACWQAMQVKGSSESVGQRTTASVVQSIFMVIAIDALFS 366

Query: 366 IFYFAIGI 373
           IF+  +G+
Sbjct: 367 IFFSELGV 374


>gi|115523490|ref|YP_780401.1| hypothetical protein RPE_1471 [Rhodopseudomonas palustris BisA53]
 gi|115517437|gb|ABJ05421.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisA53]
          Length = 377

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 207/367 (56%), Gaps = 15/367 (4%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSA--IVDLSAITEIDTIGAELIMYFMEKY-HGK 68
           AG W +P    +   VV A  +++ SD A  ++D+S ++ +DT GA LI         G 
Sbjct: 21  AGPWTAPYAPALERIVVEA--EALSSDGAKVLIDVSDVSRLDTFGAWLIERLRRSLAQGG 78

Query: 69  IKLQ--GVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           I+ Q  G+S +   L   +     ++++     RS        L   IG+ +V F +   
Sbjct: 79  IEAQIAGLSANYSSLVDEV-----RRVEADDAPRSTKMRLRAPLE-EIGRNVVGFGDTMV 132

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           S   + G V ++          F+  L S +  +  V    VP+V+LI+F+ G ++AQQG
Sbjct: 133 SLVAMSGAVTASVFRLIRHPLSFR--LTSTVHHLEQVCWRAVPIVVLITFLIGCIVAQQG 190

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
            F   +FGA++F +D++ +L LRE+GVLL A+M+AGRSGSA  AE+GSMK+ EEIDA+RT
Sbjct: 191 IFHFRKFGADVFVVDMLGVLVLRELGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRT 250

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG D + +L+ PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R     +
Sbjct: 251 MGFDPIDVLVMPRLIALVLAVPILTFLGVVAALYGGGLVAWVYGGVEPDAFLLRLREAIS 310

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   G+IKAP MA  IG+VA  EG AV   + SLG+  T  VV+ I  VI++D +FAI
Sbjct: 311 IDHFTVGMIKAPVMALVIGVVACVEGLAVQGSAESLGQHTTASVVKGIFFVIVMDGVFAI 370

Query: 367 FYFAIGI 373
            +  IG+
Sbjct: 371 MFATIGM 377


>gi|91976115|ref|YP_568774.1| hypothetical protein RPD_1636 [Rhodopseudomonas palustris BisB5]
 gi|91682571|gb|ABE38873.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB5]
          Length = 383

 Score =  223 bits (568), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 135/367 (36%), Positives = 204/367 (55%), Gaps = 15/367 (4%)

Query: 12  AGNWKS---PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
           AG+W +   P +  I  D   A   +    +  +D+S +  +DT GA LI    E+    
Sbjct: 27  AGSWTARFAPSLERIVAD---AEKLTGTRPNIFIDVSEVARLDTFGAWLI----ERLRRN 79

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYN--SFKNLHYHIGKKIVKFINDSC 126
           +   GV   I  L S    +   +++  +P      +  + +     +G+ +  F +D  
Sbjct: 80  LTQDGVEARIAGL-SANYASLVDEVRQVQPDVPAVASGGALRAPIEKLGRTMYVFADDIV 138

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +   +LG V++           F+  L S +  +  V    VP+V+LI+F+ G +IAQQG
Sbjct: 139 ALISMLGAVLAGVMRAILHPTTFR--LTSTVHHLEQVCWRAVPIVVLITFLIGCIIAQQG 196

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
            F   +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EEIDA+RT
Sbjct: 197 IFHFRRFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRT 256

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG D + +LI PR+ AL++++P+LT L   SA+ G  +V W Y  +    F  R     +
Sbjct: 257 MGFDPIDVLIVPRLIALLLAMPILTFLGAMSALYGGGLVAWLYGGVDPEAFLLRLRDAIS 316

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   G+IKAP MA  IGIVA  EG AV   + SLG   T  VV+ I  VI++D +FAI
Sbjct: 317 INHFTVGMIKAPVMALVIGIVACVEGLAVKGSAESLGSHTTASVVKGIFFVIVMDGVFAI 376

Query: 367 FYFAIGI 373
           F+ +IGI
Sbjct: 377 FFASIGI 383


>gi|86748751|ref|YP_485247.1| hypothetical protein RPB_1627 [Rhodopseudomonas palustris HaA2]
 gi|86571779|gb|ABD06336.1| Protein of unknown function DUF140 [Rhodopseudomonas palustris
           HaA2]
          Length = 383

 Score =  223 bits (567), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 133/366 (36%), Positives = 201/366 (54%), Gaps = 13/366 (3%)

Query: 12  AGNWKS---PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
           AG+W +   P +  I  D   A   +    +  +D+S +  +DT GA LI    E+    
Sbjct: 27  AGSWTAKFAPVLERIVAD---AEQLTGTRPNIFIDVSEVVRLDTFGAWLI----ERLRRN 79

Query: 69  IKLQGVSTHIEQLFS-LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +   G+   I  L +   S     +     P  +      +     +G+ +  F +D  +
Sbjct: 80  LAQDGIEAKIAGLSANYASLVDEVRQVEPVPADTSRGGGLRAPIEKLGRTMFAFGDDIVA 139

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG V++           F+  L S +  +  V    VP+V+LI+F+ G +IAQQG 
Sbjct: 140 LISMLGAVLAGVLRAILHPSTFR--LASTVHHLEQVCWRAVPIVVLITFLIGCIIAQQGI 197

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           F   +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EEIDA+RTM
Sbjct: 198 FHFRRFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRTM 257

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D + +LI PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R     ++
Sbjct: 258 GFDPIDVLIVPRLLALLLAMPILTFLGAMAALYGGGLVAWLYGGVDPEAFLLRLRDAISI 317

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   G+IKAP MA  IGIVA  EG AV   + SLG+  T  VV+ I  VI++D +FAIF
Sbjct: 318 NHFTVGMIKAPVMALVIGIVACVEGLAVRGSAESLGQHTTASVVKGIFFVIVMDGVFAIF 377

Query: 368 YFAIGI 373
           + +IGI
Sbjct: 378 FASIGI 383


>gi|298292077|ref|YP_003694016.1| hypothetical protein Snov_2101 [Starkeya novella DSM 506]
 gi|296928588|gb|ADH89397.1| protein of unknown function DUF140 [Starkeya novella DSM 506]
          Length = 382

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 129/369 (34%), Positives = 201/369 (54%), Gaps = 12/369 (3%)

Query: 8   VFRFAGNWKSPEISEIAD--DVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFM 62
           VF   G W + +   +    D  +A  K    ++A +DLS +   DT+GA   + ++  +
Sbjct: 19  VFVGNGRWVAGQGRALEGGVDTALAELKVGAVETARLDLSGVRGFDTVGAVMVDRLLRAL 78

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           E    + ++ G+      L   I      K  +  P R    N+       +G+ +V   
Sbjct: 79  EVAGVRFQIVGLERRFRPLLDEIV-----KGSHDVPPRRHHVNAVIGGIQLVGQTVVNTG 133

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            DS      +G V++           F+G   S++  +   G+  VP++ LI+F+ G +I
Sbjct: 134 RDSLVFLSFIGAVVAALLRVIVRPQTFRG--TSMVYHLERTGLRAVPIIALITFLIGCII 191

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGA  + +D++ IL LRE+GVL+ ++M+AGRSGSA  AE+GSM++ EE+D
Sbjct: 192 AQQGIFHFRKFGATTYVVDMVGILTLRELGVLIVSIMVAGRSGSAFTAELGSMRMREEVD 251

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG D   +L+ PR+ ALII++PLLT + N  A+ G  +V W Y  I   +F +R  
Sbjct: 252 ALRVMGFDPNEVLVLPRLVALIIAVPLLTFIGNMCALFGGGLVAWLYGGISPEIFLNRLQ 311

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L     G+IKAPFMA  +G++A  EG  VG  + SLG   T  VV++I +VI++D 
Sbjct: 312 EAIALNTFEVGMIKAPFMAAIVGLIACMEGMRVGGSAESLGAHTTAAVVKAIFLVIVVDG 371

Query: 363 LFAIFYFAI 371
           LFA+F+ AI
Sbjct: 372 LFAMFFAAI 380


>gi|154248034|ref|YP_001418992.1| hypothetical protein Xaut_4113 [Xanthobacter autotrophicus Py2]
 gi|154162119|gb|ABS69335.1| protein of unknown function DUF140 [Xanthobacter autotrophicus Py2]
          Length = 474

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 138/367 (37%), Positives = 207/367 (56%), Gaps = 23/367 (6%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQS----DSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
           G W     SE AD++  A++ + +S        +DLSA+  +DT GA L       + G 
Sbjct: 121 GAW----TSEYADELEQAVDDTARSYANPKGIEIDLSAVERMDTFGALLFERLKRSWKGT 176

Query: 69  IKLQGVSTHIEQLFS----LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               GV   ++ L      LI    R   +   P R       + +    G + V    D
Sbjct: 177 ----GVEPQVKGLAPRYKVLIEEMGRMGQEQPPPARRH-----EAILERFGHETVNVAAD 227

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           + +  + +G  ++  G        F+    +++ QM  VG+  VP+++LI+F+ G ++AQ
Sbjct: 228 AAALLNFVGASVAAMGRVLLRPRSFR--FTAMVNQMDRVGLRAVPIIVLITFLIGCILAQ 285

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QG F   +FGA+I+ +D++ +L LRE+GVL+ A+MIAGRSGSA  AE+GSM++ EEIDA+
Sbjct: 286 QGIFNFRRFGADIYVVDMVGVLVLRELGVLIVAIMIAGRSGSAYTAELGSMRMREEIDAL 345

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R MG D V +L+ PR+ ALII+LPLLT + + S+++GA +V W Y  I   VF  R    
Sbjct: 346 RVMGFDPVEVLVVPRLLALIIALPLLTFIGSMSSLLGAGLVSWGYGGITPDVFLDRLKGA 405

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +     G+IKAPFMA  IGIVA  EG  VG  + SLG   T  VV++I +VI++D +F
Sbjct: 406 IDMDQFNVGMIKAPFMAATIGIVACLEGLRVGGSAESLGAHTTASVVKAIFLVIVMDGVF 465

Query: 365 AIFYFAI 371
           A+F+ AI
Sbjct: 466 AMFFAAI 472


>gi|27381005|ref|NP_772534.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
 gi|27354171|dbj|BAC51159.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
          Length = 367

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 132/365 (36%), Positives = 201/365 (55%), Gaps = 13/365 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMYFMEKY-HGKIK 70
           G W +   + + + +V    K   S  +I +D+S + ++DT GA LI         G ++
Sbjct: 12  GTWTA-SFAPVLERMVADAEKLAGSPQSIFIDVSEVAKLDTFGAWLIERLRRSLTQGTVE 70

Query: 71  LQ--GVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            Q  G+S +     SL+    R +     P       +   +   IG+ +          
Sbjct: 71  AQIAGLSANYS---SLVDEVRRVR---ATPVVDAGTITITGMLDQIGRAVAGVAGTVAGL 124

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG V++  G        F+  L S +  M  V    VP+++LI+F+ G +IAQQG F
Sbjct: 125 IDMLGAVLAAGGRVLIHPRSFR--LTSTVHHMEQVCWRAVPIIVLITFLIGCIIAQQGIF 182

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
              +FGA+IF +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EEIDA+RTMG
Sbjct: 183 HFRRFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDALRTMG 242

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
            D + +L+ PR+ AL+++LP+L  L   +A+ G  +V W Y  +    F  R     ++ 
Sbjct: 243 FDPIEVLVLPRMLALVLALPILAFLGAMAALYGGGLVAWLYGGVDPEAFLLRLRDAISID 302

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G++KAP MA  IGIVA  EG AV   + SLG+  T  VV+ I  VI++D +FAIF+
Sbjct: 303 HFIVGIVKAPVMAAVIGIVACVEGLAVQGSAESLGQHTTASVVKGIFFVIVMDGVFAIFF 362

Query: 369 FAIGI 373
            +IG+
Sbjct: 363 ASIGM 367


>gi|254487283|ref|ZP_05100488.1| ABC transporter, inner membrane subunit [Roseobacter sp. GAI101]
 gi|214044152|gb|EEB84790.1| ABC transporter, inner membrane subunit [Roseobacter sp. GAI101]
          Length = 369

 Score =  218 bits (554), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 130/337 (38%), Positives = 203/337 (60%), Gaps = 12/337 (3%)

Query: 41  IVDLSAITEIDTIGAELIMYFMEKYHG---KIKLQGVSTHIEQLFSLISFTHRK-KIKNQ 96
           ++D+S +T IDT GA L++Y  ++      ++++ G S    QL  ++  +     I   
Sbjct: 41  VIDISGLTRIDTAGAWLLVYAQDRLAAPGKRVEITGTSDAQAQLIDVVRASMPPADIAEP 100

Query: 97  KPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
           KP+      +  +    +G+ +      +      LG V++          +F+  L SL
Sbjct: 101 KPK------TLADQVETLGRMVTSGARKTVELTSFLGQVVATMAGTLIHPRRFR--LTSL 152

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +     VG++ VP+V L+SF+ G V+A QGA QL QFGAE+F +DL++I  LRE+G+LLT
Sbjct: 153 VHHCQEVGLNAVPIVALMSFLIGVVLAFQGAVQLRQFGAEVFVVDLIAISVLRELGILLT 212

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+++AGRSGSA  A IGSMK+ EEIDA+RT+GLD V IL+ PR+ AL++ LP L +LA+ 
Sbjct: 213 AIIVAGRSGSAFTAAIGSMKMREEIDAMRTIGLDPVTILVVPRVLALMLMLPALGLLADI 272

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           S ++G +++ W    +  AVF SR      + +   G+IKAPF A  IGI+   EG  VG
Sbjct: 273 SGLVGGAVMSWIELGVSPAVFQSRLVGNTDVWHFGVGMIKAPFFALIIGIIGCYEGMKVG 332

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + SLG+  +T VV SI +VI++D++F+IF+  +G+
Sbjct: 333 GDAESLGRLTSTSVVLSIFMVIVMDAMFSIFFAIVGV 369


>gi|260430754|ref|ZP_05784726.1| ABC transporter, inner membrane subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418195|gb|EEX11453.1| ABC transporter, inner membrane subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 374

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 122/346 (35%), Positives = 197/346 (56%), Gaps = 12/346 (3%)

Query: 33  KSIQSDSA--IVDLSAITEIDTIGAELIMYFMEKYHG---KIKLQGVSTHIEQLFSLISF 87
           +++  D+   + DLS +  +DT GA LI     +       +  + V+     L   ++ 
Sbjct: 36  RALHPDAKRIVFDLSGLGSLDTGGAWLICDLARRASAAGATVTYENVTATQSALLETVAQ 95

Query: 88  THRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSY 147
               +I  + P R F           +G++ V    D+ S    LGL +          +
Sbjct: 96  NIAAEIPAEAPPRGFV-----PWLESLGRRTVGAGRDTASMLSFLGLTLHRLARTLVMPW 150

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           + +    +L+ QM   G+  +P+V L+ F+ G V+A QGA QL QFGAEIF ++L+SI  
Sbjct: 151 RLR--RAALVSQMEETGLKALPIVALMGFLIGVVLAFQGATQLKQFGAEIFVVELISISV 208

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           LRE+GVLLTA+++AGRSGSA  A IGSMK+ EEIDA++T+GLD + +L+ PR+ AL+I L
Sbjct: 209 LRELGVLLTAIIVAGRSGSAFTASIGSMKVQEEIDAMQTLGLDPIEVLVVPRVLALLIML 268

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIV 327
           P+L  +A+ + + G +++ W    +   +F +R      + ++  GLIKAPF A  I ++
Sbjct: 269 PILGFVADMAGLFGGALMSWIDLGVSPGMFVTRLKENTDVWHLAVGLIKAPFFAVVIAVI 328

Query: 328 AMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           A  +   V   S S+G++ T+ VVQ+I +VI ID+LF+IF+  +G+
Sbjct: 329 ACWQAMQVKGSSQSVGQRTTSSVVQAIFMVIAIDALFSIFFSEVGV 374


>gi|85373087|ref|YP_457149.1| ABC-type transport system permease component [Erythrobacter
           litoralis HTCC2594]
 gi|84786170|gb|ABC62352.1| ABC-type transport system permease component [Erythrobacter
           litoralis HTCC2594]
          Length = 370

 Score =  216 bits (549), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 206/371 (55%), Gaps = 14/371 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G TV R AG +    I  I  D+     ++++   + VDL  +++IDT+GA +    
Sbjct: 12  QDDGTTVLRLAGPYLVSTIGPIDQDL-----RALEGGFSAVDLGDVSQIDTVGAWMACTV 66

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              +  +I+    S    +L   +  +  K      P+R      F+ +    G+++V+F
Sbjct: 67  AGAHDAEIR--NASDRASRLIDAVQGSINKA--ETTPERDPL---FRRVAMMTGERVVEF 119

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++        G +++  G       +F     +L RQ+  VG++ +P++ L+SF+ G V
Sbjct: 120 GHNLLDLLSFAGAIVAGFGRLLLHPGRFPH--KALFRQLELVGINALPIIGLMSFLIGIV 177

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGA QL QFGAE  +++L+  + +RE+GVL+TA+M+AGRSGSA  A+IG+MK+ EE+
Sbjct: 178 IAQQGAVQLEQFGAETLTVNLVGRITMRELGVLMTAIMVAGRSGSAFAAQIGTMKLTEEV 237

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+RT+G+  V  L+ PRI A ++ +PLL   +   AI+G ++V      IPF  F  R 
Sbjct: 238 DAMRTIGISPVEALVLPRILAAVLMMPLLGFYSACVAIVGGAVVSEFALGIPFWNFLERI 297

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                  +++ GLIKAP     + +    +G  V  +S  +G + T  VVQ+I +VI++D
Sbjct: 298 QDVVPTYDLWVGLIKAPVFGLIVALAGCYQGMQVRGNSEEVGSRTTKAVVQAIFMVIVLD 357

Query: 362 SLFAIFYFAIG 372
           + FA+F+  IG
Sbjct: 358 AFFAVFFTEIG 368


>gi|220924819|ref|YP_002500121.1| hypothetical protein Mnod_4961 [Methylobacterium nodulans ORS 2060]
 gi|219949426|gb|ACL59818.1| protein of unknown function DUF140 [Methylobacterium nodulans ORS
           2060]
          Length = 386

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 209/368 (56%), Gaps = 16/368 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R +G W + +   +             +    +DLS ++ +DT+GA    + +E+   +I
Sbjct: 27  RLSGRWTADQAPAVEAAAAGIAASPAGAGRIQIDLSGLSRLDTLGA----WVLERTRSEI 82

Query: 70  KLQGVSTHIEQLFSLISFTHR---KKIKNQKPQRSFFYN---SFKNLHYHIGKKIVKFIN 123
              G +      ++     HR   +++  ++P+ +          +L   +G  + +   
Sbjct: 83  AAAGRAVE----YAGARPEHRILLREVAYREPETAPARRRGLGPVDLLAGLGAGMRQLGA 138

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +  S    LG V++      A    F+    + + QM  + + G P+++LI+F+ G ++ 
Sbjct: 139 EGLSWLGFLGEVVAACLRVLARPRSFR--RAAFVNQMEQIALRGTPIIMLIAFLVGCIVT 196

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG  QL +FGA+ F ++++ IL LRE+GVLLTA+M+AGRSGSA  AEIGSM++ EE+DA
Sbjct: 197 QQGIIQLQRFGAQSFVVNMIGILTLRELGVLLTAIMVAGRSGSAFTAEIGSMRMREEVDA 256

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MGLD + ILI PRI AL+++LP+L  LA+ +A+ G ++    Y ++    F +R  +
Sbjct: 257 LRVMGLDPIEILIVPRILALMMALPMLGFLADLAALAGGALTSLAYGNLSLDAFLARLQN 316

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +  +   GLIKAPFMA  IGI+A  EGF V   + SLG+ VT  VV+SI +VI++D +
Sbjct: 317 AVSYRHALVGLIKAPFMALIIGIIATSEGFRVEGSAESLGRHVTASVVKSIFMVIVLDGV 376

Query: 364 FAIFYFAI 371
           FAIF+ AI
Sbjct: 377 FAIFFAAI 384


>gi|170743041|ref|YP_001771696.1| hypothetical protein M446_4933 [Methylobacterium sp. 4-46]
 gi|168197315|gb|ACA19262.1| protein of unknown function DUF140 [Methylobacterium sp. 4-46]
          Length = 394

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/368 (34%), Positives = 205/368 (55%), Gaps = 16/368 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G+W + +   +                  VDLS +  +DT+GA    + +E+   +I
Sbjct: 35  RLTGSWTADQAPAVEAAAAAIAAPGEPGPRVQVDLSGLVRLDTLGA----FVLERTRSEI 90

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKN------QKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +  G +      ++     HR  ++         P          +    +G  + +   
Sbjct: 91  EAAGRAVD----YAGARPEHRILLREVAYRRDTPPPPRRRRLGLLDGLEALGAGLRRLGA 146

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +  S    LG V++      A   +F+    S + QM  +   G P+++LI+F+ G ++ 
Sbjct: 147 EGLSWLGFLGEVVAACLRVLARPRRFRA--ASFVNQMEQIAYRGTPIIMLIAFLVGCIVT 204

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG  QL +FGA+ F ++++ IL LRE+GVLLTA+M+AGRSGSA  AEIGSM++ EE+DA
Sbjct: 205 QQGIIQLQRFGAQSFVVNMIGILTLRELGVLLTAIMVAGRSGSAFTAEIGSMRMREEVDA 264

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MGLD + ILI PRI AL+++LP+L  LA+ +A++G ++    Y ++ F  F +R  +
Sbjct: 265 LRVMGLDPIEILIVPRILALMLALPMLGFLADVAALLGGALTSMAYGNLSFDAFLARLQA 324

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             ++ +   G++KAPFMA  IGI+A  EGF V   + SLG+ VT  VV+SI +VI++D +
Sbjct: 325 VISVRHGLVGMLKAPFMALIIGIIATSEGFRVEGSAESLGRHVTASVVKSIFMVIVLDGV 384

Query: 364 FAIFYFAI 371
           FAIF+ AI
Sbjct: 385 FAIFFAAI 392


>gi|312115045|ref|YP_004012641.1| hypothetical protein Rvan_2318 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220174|gb|ADP71542.1| protein of unknown function DUF140 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 385

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 111/271 (40%), Positives = 172/271 (63%), Gaps = 15/271 (5%)

Query: 105 NSFKNLHYHIGKKIVK---FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
             F +    IG+  ++   F+ ++ +    LG V+ + G F     + K F      Q+ 
Sbjct: 126 RRFLSAATSIGRDAIRLTMFLGETTAA---LGRVVVHPGRF-----RIKAF----THQLQ 173

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
             G+S VP++ L+SF+ G V+ QQ AFQL +FGAE  SID++ IL LRE+GV+L AVM+A
Sbjct: 174 QTGLSAVPIIALVSFLIGGVVMQQSAFQLQKFGAETMSIDMLGILALRELGVILAAVMVA 233

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRS SA  A+IG+MK+ EEIDA+RT+G+D +  L+ PR+ AL+I+LPLL  LA+  A+ G
Sbjct: 234 GRSASAFTAQIGTMKMREEIDAMRTLGIDPIETLVLPRVLALMIALPLLVFLADMMALAG 293

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
            +++   Y  +   ++  R +S+    +++ GLIKAPF A  IG+V   EG +    + S
Sbjct: 294 GAVMAKLYLSLDTDMYLQRLNSSVQAKHLYVGLIKAPFAALVIGLVGCLEGLSAQGSAES 353

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           +G +VTT VV++I +V+++D++FAIF  A G
Sbjct: 354 VGTQVTTAVVKAIFLVLVLDAVFAIFLSAAG 384


>gi|84516868|ref|ZP_01004226.1| ABC transporter, inner membrane subunit [Loktanella vestfoldensis
           SKA53]
 gi|84509336|gb|EAQ05795.1| ABC transporter, inner membrane subunit [Loktanella vestfoldensis
           SKA53]
          Length = 380

 Score =  210 bits (535), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 196/343 (57%), Gaps = 17/343 (4%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK------LQGVSTHIEQLFSLISFTHR 90
           S + +VD++ ++ +DT GA    +F+    G+        + G S     L   +     
Sbjct: 49  SRAEVVDIAQLSHMDTAGA----WFLLDLAGRTSAGAASVITGASDAQTLLIEAVRTNLP 104

Query: 91  KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK 150
            K    KP      + F+ L    G+++    + +      LG VI+            +
Sbjct: 105 PKAAGAKPAVRL-VDHFETL----GRRVALAGSHALEMLSFLGQVIAAMARVIRHPRALR 159

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
             L S++     VG+  VP+V L++F+ G V+A QG+ QL QFGAE+F +DL++I  LRE
Sbjct: 160 --LTSVVHHCQQVGLQAVPIVALMAFLIGVVLAFQGSAQLRQFGAEVFVVDLIAISILRE 217

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G+LLTA+++AGRSGSA  A IGSMK+ EEIDA+RT+GLD V IL+ PR+ AL++ LP L
Sbjct: 218 LGILLTAIIVAGRSGSAFTAAIGSMKMREEIDAMRTLGLDPVAILVVPRVLALVLMLPAL 277

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
            ++AN S + G +++ W   D+  AVF +R  S   + +   G+IKAP  A  IGI+   
Sbjct: 278 GLIANVSGLFGGALMSWIELDVSPAVFQARLVSNTDVWHFNVGMIKAPVFALIIGIIGCY 337

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           +G  VG  + SLG++ +  VV +I +VI+ D+LF+IF+  +G+
Sbjct: 338 QGMKVGGDAESLGRQTSASVVMAIFMVIVADALFSIFFAIVGV 380


>gi|218886600|ref|YP_002435921.1| hypothetical protein DvMF_1505 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757554|gb|ACL08453.1| protein of unknown function DUF140 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 430

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/373 (33%), Positives = 204/373 (54%), Gaps = 11/373 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINK-----SIQSDSAIV--DLSAITEIDTIGAELIMY 60
           V  F+G W    I  +   ++    +     S+Q D+ +V  DL+ +T +DT GA+L+  
Sbjct: 62  VLTFSGVWDVASIGRMTARLLRRCAEVGNACSVQGDAPVVHLDLAEVTRLDTAGAQLLCR 121

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        V  H+      +     + I      R+   +        IG  IV+
Sbjct: 122 AAASM--ATAGARVVWHVSDHGQSMLLDRVRAIDISAVPRARRISPVVGALNAIGGSIVE 179

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
            +  + +    LG+ + +     A  ++ +   +S++  M   G+  VP+V L++F+ G 
Sbjct: 180 ELEQARAIIGFLGMFLVSLAAAVARPWRLR--WVSIVHHMEQTGIQAVPIVALLTFLIGL 237

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V A  G+ Q ++FGA++F ++L+ +  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE
Sbjct: 238 VTAYMGSEQFTRFGAQVFVVNLIEVSTLRELGVLLTALIVAGRSGSSFTAQIGAMVANEE 297

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R+MGLD + +L+ PR+ AL++ LP+LT +A+F  ++G  I  W    I    F  R
Sbjct: 298 VDAMRSMGLDPMEVLVIPRVVALVLMLPVLTFIADFMGVLGGGIASWLSLGISPGAFAVR 357

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           F     LAN  TGL+KAPF A  IGIV   +GF V   + S+G+  T  VV+SI +VI+ 
Sbjct: 358 FQEITRLANFVTGLVKAPFFALIIGIVGCFQGFRVTGSAESVGRLTTQAVVESIFLVIVA 417

Query: 361 DSLFAIFYFAIGI 373
           ++ FAI + ++G+
Sbjct: 418 NAGFAILFMSLGV 430


>gi|149187032|ref|ZP_01865339.1| ABC-type transport system permease component [Erythrobacter sp.
           SD-21]
 gi|148829321|gb|EDL47765.1| ABC-type transport system permease component [Erythrobacter sp.
           SD-21]
          Length = 369

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 206/369 (55%), Gaps = 14/369 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            G +V   +G +    +  + +D+     + +    A +DLS ++EIDT+GA L      
Sbjct: 13  EGGSVLALSGPYLVSTVGAVDEDL-----RGLDEPLARIDLSEVSEIDTVGAWLACQLAS 67

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           ++  +I   G S    +L   ++      + +++   +     +  +   +G+K+    +
Sbjct: 68  RHGAEIT--GASERATRLLGALT-----GMDSEQALSAPRLPVWSRVPEAMGEKMFNARS 120

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
            +      LG  + + G    +  +F+   ++L+ Q+  VGVS +P++ L+SF+ G VIA
Sbjct: 121 GAIGVISFLGAALISAGNLIRNPRRFR--TVALVHQVELVGVSALPIIGLMSFLIGIVIA 178

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQGA QL+ FGAE  +++L+  + LRE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+DA
Sbjct: 179 QQGAVQLAAFGAETLTVNLVGRITLRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVDA 238

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+G+  +  L+ PRI + ++ +PLL   A+  AIIG ++V      IPF  F SR   
Sbjct: 239 MRTIGISPMEALVIPRILSAVLMMPLLGFYASCMAIIGGAVVGDLMLGIPFWTFLSRIQE 298

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                +++ GLIKAP     +G+     G  V  +S  +GK+ T  VV +I  VI++D+ 
Sbjct: 299 VVPTYDVWVGLIKAPVFGLIVGLAGCYNGMQVEGNSEEVGKRTTLSVVAAIFAVIVLDAF 358

Query: 364 FAIFYFAIG 372
           FA+F+  +G
Sbjct: 359 FAVFFTELG 367


>gi|159044594|ref|YP_001533388.1| hypothetical protein Dshi_2050 [Dinoroseobacter shibae DFL 12]
 gi|157912354|gb|ABV93787.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 384

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 125/338 (36%), Positives = 201/338 (59%), Gaps = 11/338 (3%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGK-IKLQGVSTHIEQLFSLISFTHRKKIKN 95
           + S  +DLS I  IDT GA L+    E   G+ ++L G    + +L + ++     K + 
Sbjct: 57  AGSLTLDLSGIGRIDTAGAWLLA---ELARGEGVRLVGAPDKVARLIANVA-----KAEP 108

Query: 96  QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
           + P+R+    +  +    +G+++V+          +LGLV++  G       +F+  + +
Sbjct: 109 EHPERTETPPTLTDRLERLGRQVVEGTKFLGGLTGMLGLVLARFGRALRHPREFR--MTA 166

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+     VG+  VP+V L++F+ G V+A QGA QL QFGAE+F +DL+SI  LRE+G+LL
Sbjct: 167 LVHHCEEVGLRAVPIVALMAFLIGIVLAFQGASQLRQFGAEVFVVDLISISILRELGILL 226

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+++AGR+ S+  A IGSMK+ EEIDA+RT+GLD   +L  PR+ AL+I LP+L ++AN
Sbjct: 227 TAIIVAGRTASSFTAAIGSMKMREEIDAMRTLGLDPAMLLFLPRVLALLIMLPILGLIAN 286

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
            S ++G +++ W    I  A+F +R      + +   GL+KAPF A  IG+V    G  V
Sbjct: 287 LSGLLGGALMSWIELGISPAMFQTRLIEGTDINHAVVGLVKAPFFAILIGVVGCHAGMQV 346

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             ++ SLG+  +  VV +I  VI+ D+ F+IF+  +GI
Sbjct: 347 EGNAESLGRMTSGAVVTAIFAVIVTDAAFSIFFAQMGI 384


>gi|304319773|ref|YP_003853416.1| hypothetical protein PB2503_00972 [Parvularcula bermudensis
           HTCC2503]
 gi|303298676|gb|ADM08275.1| hypothetical protein PB2503_00972 [Parvularcula bermudensis
           HTCC2503]
          Length = 380

 Score =  206 bits (524), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 130/355 (36%), Positives = 201/355 (56%), Gaps = 13/355 (3%)

Query: 25  DDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHI------ 78
           D  + A+N   + D A +DLS I  +DT GA ++     +  G+ + Q ++T        
Sbjct: 33  DSKIRALNFGPREDLAEIDLSQIEALDTAGALMLQRLRHRCMGEGRPQAIATLTGMTDPQ 92

Query: 79  EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISN 138
            +L   ++  H    +   P+R     SF  L   +G+  +   N+  +    +G V++ 
Sbjct: 93  HELMERMA-AHIADCEGDPPRR----KSFILLLNRVGQGTIAVGNEGLAILSFVGSVVAR 147

Query: 139 TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIF 198
                 S  +F+  L + +  M   G++   +V L+SF+ GAV+A  GA  LS+FGAE+F
Sbjct: 148 LAGTIMSPARFR--LTATVAHMEEAGLNSTLIVGLMSFLIGAVVAFMGARVLSEFGAEVF 205

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISP 258
           S++L+ I  LRE GVLLTA++IAGRSGSA  A IGSMK+ EEIDA+R +G+  +  LI P
Sbjct: 206 SVELVGISVLREFGVLLTAILIAGRSGSAFTASIGSMKLREEIDAMRALGISPLDALILP 265

Query: 259 RIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAP 318
           R  AL+++LP+L  LA F  ++G  +V W   DIP  +F  R     T+ N+F GL+KAP
Sbjct: 266 RTIALVLTLPVLAFLAGFLGLLGGGVVGWLALDIPPQLFIGRLQEIVTVENLFVGLVKAP 325

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           F A  I +V    G +V   +  LG++ T  VVQS+ +VI++D+LFA+ +  + I
Sbjct: 326 FFAFVIAVVGCYHGMSVENSAEELGRRTTMAVVQSLFLVILLDALFAMLFLELDI 380


>gi|260752530|ref|YP_003225423.1| hypothetical protein Za10_0287 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856391|ref|YP_162753.2| hypothetical protein ZMO1018 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258551893|gb|ACV74839.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283775390|gb|AAV89642.2| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 366

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 185/339 (54%), Gaps = 15/339 (4%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQ 96
           SD  ++DLS +  +DT GA L+    +  + ++K  G ++ +  +   IS   R      
Sbjct: 38  SDVKVIDLSNLHRMDTAGAWLVHKLAQDNNAEVK--GTNSAVAHILDQISHYDRPLPPEP 95

Query: 97  KPQRSFFYNSF---KNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFL 153
           K      Y      KN   H+   IV  +N          L++S     C  S   +  L
Sbjct: 96  KAVSPLIYTLTGVGKNT-VHVWYTIVGLVN------FFGALLVSIWHTICHPS---RLRL 145

Query: 154 LSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGV 213
            ++I QM  VGV+ + +V L+S + G VIAQQGA QL QFGAEI+SI+L+  L  RE+GV
Sbjct: 146 TAIICQMETVGVNALAIVGLMSILVGVVIAQQGAVQLRQFGAEIYSINLVGRLSFRELGV 205

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           L+TA+M+AGRSGSA  A+IGSM + EEIDA+R +G+  +  L+ PR  A II +PLL   
Sbjct: 206 LMTAIMVAGRSGSAFAAQIGSMNLAEEIDAMRIIGVSPMESLVLPRFLASIIMMPLLGFY 265

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           A  +A+IG  ++ W   DIP   FF+R        ++  GL+KAP     I I    +G 
Sbjct: 266 ATIAAVIGGGLLCWTVLDIPPTTFFTRLREVIPYTDVAVGLVKAPIFGALIAIAGCFQGT 325

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            V  ++  LG   T  VV SI +VI++D+ FA+F+  IG
Sbjct: 326 QVKGNAEQLGYCTTKAVVHSIFLVIVLDAFFAVFFSEIG 364


>gi|241761770|ref|ZP_04759856.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373684|gb|EER63244.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 366

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/339 (37%), Positives = 185/339 (54%), Gaps = 15/339 (4%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQ 96
           SD  ++DLS +  +DT GA L+    +  + ++K  G ++ +  +   IS   R      
Sbjct: 38  SDVKVIDLSNLHRMDTAGAWLVHKLAQDNNAEVK--GTNSAVAHILDQISHYDRPLPPEP 95

Query: 97  KPQRSFFYNSF---KNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFL 153
           K      Y      KN   H+   IV  +N          L++S     C  S   +  L
Sbjct: 96  KAVSPLIYTLTGVGKNT-VHVWYTIVGLVN------FFGALLVSIWHTICHPS---RLRL 145

Query: 154 LSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGV 213
            ++I QM  VGV+ + +V L+S + G VIAQQGA QL QFGAEI+SI+L+  L  RE+GV
Sbjct: 146 TAIICQMETVGVNALAIVGLMSILVGVVIAQQGAVQLRQFGAEIYSINLVGRLSFRELGV 205

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           L+TA+M+AGRSGSA  A+IGSM + EEIDA+R +G+  +  L+ PR  A II +PLL   
Sbjct: 206 LMTAIMVAGRSGSAFAAQIGSMNLAEEIDAMRIIGVSPMESLVLPRFLASIIMMPLLGFY 265

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           A  +A+IG  ++ W   DIP   FF+R        ++  GL+KAP     I I    +G 
Sbjct: 266 ATIAAVIGGGLLCWTVLDIPPTTFFTRLREVIPYTDVAVGLVKAPIFGALIAIAGCFQGT 325

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            V  ++  LG   T  VV SI +VI++D+ FA+F+  IG
Sbjct: 326 QVKGNAEQLGYCTTKAVVHSIFLVIVLDAFFAVFFSEIG 364


>gi|163744195|ref|ZP_02151555.1| ABC transporter, inner membrane subunit [Oceanibulbus indolifex
           HEL-45]
 gi|161381013|gb|EDQ05422.1| ABC transporter, inner membrane subunit [Oceanibulbus indolifex
           HEL-45]
          Length = 376

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 127/337 (37%), Positives = 199/337 (59%), Gaps = 9/337 (2%)

Query: 39  SAIVDLSAITEIDTIGAELIMYFME--KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQ 96
           ++++D++ +  IDT GA +++         G   L+G +    QL   +  +        
Sbjct: 47  ASVIDIAGLARIDTAGAWVLIDLQAHATVPGGAALEGATQAQAQLIETVRRSMLSDAVAA 106

Query: 97  KPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
            P +S       +    +G+ +V   + + +    LG V++  G   A   + +  L SL
Sbjct: 107 PPTKSV-----GDRLEILGRTVVLGAHKTVALISFLGQVVATMGGILAHPSRLR--LTSL 159

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +     VG++ VP+V L+SF+ G V+A QGA QL QFGAE+F +DL++I  LRE+G+LLT
Sbjct: 160 VHHCQEVGLNAVPIVALMSFLIGVVLAFQGAAQLRQFGAEVFVVDLIAISVLRELGILLT 219

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+++AGRSGSA  A IGSMK+ EE+DA+RT+GLD V IL+ PR+ AL++ LP L  +A+ 
Sbjct: 220 AIIVAGRSGSAFTAAIGSMKMREEVDAMRTIGLDPVTILVVPRVLALMLMLPALGFIADI 279

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           S ++G +I+ W    +  AVF  R  S   + +   G+IKAPF A  IGI+   EG  VG
Sbjct: 280 SGLLGGAIMSWIDLGVSPAVFQMRLTSNTDVWHFGVGMIKAPFFALIIGIIGCFEGLKVG 339

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + SLG+  +T VV SI +VI+ D++F+IF+  +G+
Sbjct: 340 GDAESLGRLTSTSVVLSIFMVIVADAMFSIFFAIVGV 376


>gi|87200858|ref|YP_498115.1| hypothetical protein Saro_2845 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136539|gb|ABD27281.1| protein of unknown function DUF140 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 372

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 116/340 (34%), Positives = 192/340 (56%), Gaps = 8/340 (2%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           + I    A +DLSA+T +DT+GA  + + + +  G  ++   S   ++L   IS      
Sbjct: 39  RHITDPVARIDLSAVTAMDTVGAWTV-WRLSRDTGA-EIVACSEEAQKLVDAISKADSNA 96

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF 152
              + P+   F    + +   +G  ++     +      LG VI   G       +F+  
Sbjct: 97  HSIEPPRLPLF----QRVPEKVGDAMIGLGLGAVQVLGFLGQVILAIGTLVRHPSRFR-- 150

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           + +L+ QM  VGV+ + ++ L+SF+ G VIAQQGA QL QFGAEI++++L+  L LRE+G
Sbjct: 151 MKALVHQMELVGVNALAIIGLMSFLVGIVIAQQGAVQLRQFGAEIYTVNLVGRLTLRELG 210

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VL+TA+M+AGRSGSA  A++G+MK+ EE+DA+RT+G+  +  L+ PRI A ++ +PLL  
Sbjct: 211 VLMTAIMVAGRSGSAFAAQLGTMKLTEEVDAMRTIGVSPMEALVVPRILATMVMMPLLGF 270

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
            + F  IIG + +      IPF  F +R      L +++ G+ KAP     + +    +G
Sbjct: 271 YSAFIGIIGGAFLSSLTLGIPFFTFLARIQEVVPLHDVWVGITKAPVFGLIVAVAGCYQG 330

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             V  ++  +G + T  VV +I +VI++D+ FA+F+  IG
Sbjct: 331 MQVKTNAEEVGTRTTAAVVMAIFMVIVLDAFFAVFFTEIG 370


>gi|149374946|ref|ZP_01892719.1| putative permease of ABC transporter [Marinobacter algicola DG893]
 gi|149360835|gb|EDM49286.1| putative permease of ABC transporter [Marinobacter algicola DG893]
          Length = 374

 Score =  203 bits (516), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 205/364 (56%), Gaps = 10/364 (2%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM---EKYHGK 68
           +G+W  P    +  DV  A+ K +  D   V+L+ I  +DT GA L++  +   E +   
Sbjct: 17  SGDWTLPNYGSLKRDVQNAVLKEV-PDGHSVNLATINALDTAGASLLVDLLGAHELHELT 75

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            +   +S+  ++L  L++      + + + +++F  N        IG+ I  F +     
Sbjct: 76  EQTPELSSERQELLRLVA----NAMASPEGEKAFCSNPITEFLAGIGENIEDFWHQQRLL 131

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
               G +++      A+ ++++  + SL+  ++  G++ +P+V L++F+ GAV+A  GA 
Sbjct: 132 IGFTGQILATLASILATPWRWR--ITSLVAHVHQTGLNALPIVALLTFLVGAVVAFLGAT 189

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGA I++++L++   LRE GVLL A+++AGR+ SA  A++GSMK NEEIDA+RT G
Sbjct: 190 ILDDFGATIYTVNLVAFSFLREFGVLLAAILLAGRTASAFTAQLGSMKANEEIDALRTFG 249

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L  V +L+ PR+ A++ISLP+LT +   S IIG S+V     DI      +   +   + 
Sbjct: 250 LSPVELLVIPRVLAMVISLPILTFVGMISGIIGGSVVCVLALDISVPQILNILETKVKVV 309

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL KAP  A  I ++   EGF     + S+G+  T+ VVQSI +VI++DS+ AIF+
Sbjct: 310 HLLVGLGKAPVFAFVIAVIGCLEGFKASGSAQSVGEHTTSAVVQSIFMVILLDSIAAIFF 369

Query: 369 FAIG 372
             +G
Sbjct: 370 MEMG 373


>gi|119385048|ref|YP_916104.1| hypothetical protein Pden_2317 [Paracoccus denitrificans PD1222]
 gi|119374815|gb|ABL70408.1| protein of unknown function DUF140 [Paracoccus denitrificans
           PD1222]
          Length = 364

 Score =  201 bits (511), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/332 (35%), Positives = 189/332 (56%), Gaps = 10/332 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           ++LS +T +DT  A    Y   +      L G++    QL   +     ++   Q    S
Sbjct: 43  LELSGLTRLDTAAA---WYLTGREREGASLDGLTGTQAQLLDTV-----RQALPQPEAES 94

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
                ++ +    G+++V  +      A  LG  ++           F+    SL+    
Sbjct: 95  AGPAGWRLMLEQTGRRMVAALVFLREIAEYLGRFLAALARGIRHPGDFR--FTSLVYHCQ 152

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
             G+  VP+V L+SF+ G V+A QGA QL QFGAE+F IDL++I  LRE+G+LLTA+++A
Sbjct: 153 ETGLRAVPIVALMSFLIGIVLAFQGAVQLRQFGAEVFVIDLIAISILRELGILLTAIIVA 212

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GR+ SA+ A IGSMK+NEEIDA+RT+GLD   +LI PR+ ALII+LP+L ++AN + ++G
Sbjct: 213 GRTASALTASIGSMKMNEEIDAMRTLGLDPDMVLILPRVLALIITLPILGLIANIAGLVG 272

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
            +++ W    I  ++F  R  +  ++ ++  GL KAP  A  IG++    G  VG  + S
Sbjct: 273 GALMSWIELGISPSMFRYRLLADTSVDHVIVGLSKAPVFALIIGVIGCHAGMKVGKDAES 332

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           LG + +  VV +I  VI+ D+LF+IF+  +G+
Sbjct: 333 LGAETSRAVVNAIFAVIVADALFSIFFSEVGL 364


>gi|209964745|ref|YP_002297660.1| ABC transporter, permease protein, putative [Rhodospirillum
           centenum SW]
 gi|209958211|gb|ACI98847.1| ABC transporter, permease protein, putative [Rhodospirillum
           centenum SW]
          Length = 384

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 124/364 (34%), Positives = 197/364 (54%), Gaps = 9/364 (2%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
            G W    +  + D  +        + S  +DLS +  +DT GA LI    E+   +   
Sbjct: 28  GGRWDLSAVPRL-DQRLRTAGPDRPASSVCIDLSGLVALDTAGALLIDRLAERLRAEGHT 86

Query: 72  QGVSTHIEQLFSLISFTHRKKIKNQK--PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
             +      L +L+    R    +    P+    Y    +L   +G+  V+   D+    
Sbjct: 87  VAIVGARPDLCALLREVRRASRADSPALPR----YEPMHDLLERVGRATVEAGQDAAKLL 142

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             LG+V            +F+  +   +  +  VG++ +P+V L+SF+ G V+A QGA Q
Sbjct: 143 GFLGMVTVTALRLVRQPRRFR--MTPFVFHLEQVGLNALPIVGLLSFLIGIVLAYQGADQ 200

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L  FGAEIF ++L+ I  LREIG+L+T++++AGRSGSA  A+IG+MK+N+E+DA+RT+GL
Sbjct: 201 LRLFGAEIFVVNLLGIGVLREIGILMTSIIVAGRSGSAFTAQIGTMKVNQEVDAMRTLGL 260

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           D V +L+ PR+ AL+++LPLL   AN  A+ G +++ + Y DI F  F  +         
Sbjct: 261 DPVELLVLPRLLALMVALPLLGFYANVVALFGGAVMAYSYLDITFGQFLKQLQLAVNETT 320

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           +F GL+KAP  A  I +V   EG  V   + S+G+  T  VV SI +VI++D+LF+I + 
Sbjct: 321 LFVGLVKAPVFAIVIALVGCYEGLRVTGSAQSVGQLTTRSVVVSIFLVIVLDALFSILFS 380

Query: 370 AIGI 373
            +GI
Sbjct: 381 YLGI 384


>gi|312958198|ref|ZP_07772721.1| ABC transport system permease protein [Pseudomonas fluorescens WH6]
 gi|311287629|gb|EFQ66187.1| ABC transport system permease protein [Pseudomonas fluorescens WH6]
          Length = 382

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 126/368 (34%), Positives = 205/368 (55%), Gaps = 17/368 (4%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDS-AIVDLSAITEIDTIGAELIMYFMEKYH 66
           + R  G+W    ++  A+   +A     Q D+ A +DL+ +  +DT GA L++  +    
Sbjct: 20  LLRITGDWT---LAHYANLKKLADKLDGQYDAGARIDLNGLGALDTAGASLLVELL---- 72

Query: 67  GKIKLQGVSTHIEQLFS-----LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           G  +++  +   +   S     L+   +R       P+++    +   L   IG+ +   
Sbjct: 73  GPTRIEQSAEQTDCTLSAADRALLKTVYRSLNDFCVPEKAPEETAGMQLLARIGRAVDTV 132

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLS-LIRQMYYVGVSGVPVVILISFVTGA 180
             DS      +GL++     F    ++ K + ++ ++  +  VG+   P+V L++F+ GA
Sbjct: 133 WQDSKQLLGFIGLILET---FARGIFRPKRWRITPMVAHLEQVGLDAAPIVALLTFLVGA 189

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A  GA  L  FGA IF++DL++   LRE GVLLTA++IAGR+ SA  A+IGSMK NEE
Sbjct: 190 VVAFLGATVLKSFGATIFTVDLVAFSFLREFGVLLTAILIAGRTASAFTAQIGSMKANEE 249

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRT+GLD + +L+ PR+ AL+++LP+LT LA  S I+G  +V     DI  A+F S 
Sbjct: 250 IDAIRTLGLDPMELLVLPRVLALLVALPMLTFLAMLSGIVGGGVVCAVALDISPAMFLSL 309

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             S   + +   G++KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI++
Sbjct: 310 LQSDIGVQHFLVGMVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVL 369

Query: 361 DSLFAIFY 368
           D++ A+F+
Sbjct: 370 DAVAALFF 377


>gi|119897565|ref|YP_932778.1| putative ABC transporter permease [Azoarcus sp. BH72]
 gi|119669978|emb|CAL93891.1| putative ABC transporter permease protein [Azoarcus sp. BH72]
          Length = 380

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/357 (35%), Positives = 197/357 (55%), Gaps = 11/357 (3%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++  G  V R +G+W       IAD  V A+  ++Q  +A VD S +  +DT GA L++ 
Sbjct: 13  LAAAGGGVLRLSGDWTLAHYRSIAD-TVSALRANVQHGTA-VDASGLGALDTAGASLLVQ 70

Query: 61  FMEKYHGKIKLQGVSTH---IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
            +    G   LQ +ST      +  +L+           +P+ +   ++  ++  HIG  
Sbjct: 71  LL----GHDGLQALSTDPALAPERRALLRAVADALATPPEPEPADTGSALGDVLEHIGIA 126

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +  F   +      +GL + +     A   +++  L +L   +    +  VP+V L++F+
Sbjct: 127 MGVFWRHAVGLLGFIGLTLESAFRIIAQPARWR--LTALAANLEKTALDAVPIVALLTFL 184

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            GAV+A  GA  L+ FGA IF++DL++   LRE GVLLTA+++AGR+ SA  A+IGSMK 
Sbjct: 185 VGAVVAFLGATVLADFGASIFTVDLVAFSFLREFGVLLTAILVAGRTASAFTAQIGSMKA 244

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEEIDAIR +GLD V +L+ PR++AL+++LP+LT +A  S I+G  +V     DI   +F
Sbjct: 245 NEEIDAIRVLGLDPVELLVLPRVYALLLALPMLTFVAMLSGIVGGMLVCALTLDISPVMF 304

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
            S F +   L +   G+ KAP  A  I ++   EGF V   + S+G+  T+ VVQSI
Sbjct: 305 LSIFENDVGLRHFIVGIAKAPIFAFLIAVIGCLEGFKVSGSAQSVGEHTTSAVVQSI 361


>gi|70733612|ref|YP_257252.1| ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68347911|gb|AAY95517.1| ABC transporter, permease protein, putative [Pseudomonas
           fluorescens Pf-5]
          Length = 382

 Score =  200 bits (508), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 127/372 (34%), Positives = 200/372 (53%), Gaps = 19/372 (5%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     S++   +  +++    S + I DL+ +  +DT GA L++  +    G 
Sbjct: 21  LRIGGDWTLAHYSDL-KRLSQSLDGRYDSSTHI-DLNGLGALDTAGASLLVELL----GA 74

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFK--------NLHYHIGKKIVK 120
            +L   + H +     +S   R  +       + F    K         L   IG  +  
Sbjct: 75  ERLGQSAEHPD---CTLSAADRALLHTVYTSLNDFCVPVKEPEISVSVQLLSRIGSAVYT 131

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D+      +GL++           +++  +  ++  +   G+   P+V L++F+ GA
Sbjct: 132 VWQDTLKVLGFIGLILETLARGLLRPKRWR--ITPVVAHIEQTGLDAAPIVALLTFLVGA 189

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A  GA  L+ FGA IF++DL++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEE
Sbjct: 190 VVAFLGATVLANFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQIGSMKANEE 249

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRT+GLD V +L+ PR+ AL++SLP+LT LA  S I+G ++V     DI  A+F S 
Sbjct: 250 IDAIRTLGLDPVELLVLPRVLALLVSLPMLTFLAMLSGIVGGAVVCALSLDISPAMFLSL 309

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            HS   + +   GL+KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI+I
Sbjct: 310 LHSDIGVKHFLLGLVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVI 369

Query: 361 DSLFAIFYFAIG 372
           D++ A+F+  +G
Sbjct: 370 DAVAALFFMEMG 381


>gi|288962789|ref|YP_003453083.1| ABC transport system permease protein [Azospirillum sp. B510]
 gi|288915055|dbj|BAI76539.1| ABC transport system permease protein [Azospirillum sp. B510]
          Length = 401

 Score =  199 bits (506), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 120/365 (32%), Positives = 198/365 (54%), Gaps = 10/365 (2%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK--- 68
           AG W + E++  A D +          +  +DLS +  +DT+GA L+    ++       
Sbjct: 44  AGRW-TLEVAAAASDALDHAAPPRDGAALRLDLSGVEALDTVGAYLLSRQADRMAADGRA 102

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           +++ GV      LF  +      K      +R   ++   ++    G+  V    +    
Sbjct: 103 VEVVGVRPEHAALFDAVR--DAGKAPPHPIERE--HHPIHDMVVRTGETTVHAAREVLDL 158

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LGLV            + +  L S++  +   G++ +P++ L+SF+ G V+A QGA 
Sbjct: 159 VGFLGLVTVTFVRLILRPSRLR--LTSVLFHIEQTGLNALPILGLLSFLIGVVLAFQGAD 216

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL +FGAE++ ++L+ I  LREIG+L+TA+++AGRSGSA  A+IG+MK+N+E+DAI TMG
Sbjct: 217 QLKRFGAELYVVNLLGISVLREIGILMTAIIVAGRSGSAFTAQIGTMKVNQEVDAIGTMG 276

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD V +L+ PR  AL+I+LPLL   A+   + G +++ +   DI F  F  + HS   + 
Sbjct: 277 LDPVELLVVPRALALVITLPLLAFYADVMGLFGGAVMAYATLDITFGQFIRQLHSAIGIN 336

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
            +  GLIKAP  A  I +V   EG  V   + S+G   T  VV+ I +VI+ID++F++ +
Sbjct: 337 TVLAGLIKAPVFALVIAMVGCYEGLKVSGSAESVGIMTTKAVVEGIFLVIVIDAVFSVLF 396

Query: 369 FAIGI 373
             +G+
Sbjct: 397 SLLGV 401


>gi|311232876|gb|ADP85730.1| protein of unknown function DUF140 [Desulfovibrio vulgaris RCH1]
          Length = 401

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 198/367 (53%), Gaps = 8/367 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + RF+G W     +  A   +  +    +      DL+ +  +DT GA +I  F      
Sbjct: 42  ILRFSGAWDVATAAR-ARGQLQHLAIPAECGDLTFDLTGVLRLDTAGALVITTF----RT 96

Query: 68  KIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
            ++ QG++  +    +  +   R   I   +       ++       IG  IV+    + 
Sbjct: 97  ALEKQGIAPLLHCAPAHNALIDRVAAIDMSEAPTVRHASALARTLNAIGASIVEETEQAV 156

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                +G+++ +        ++F+   +SL   M   GV  VP+V L+SF+ G V A  G
Sbjct: 157 GILAFMGMLVISLVGLVLRPWRFR--WVSLCSHMEQTGVQAVPIVALLSFLIGLVTAYMG 214

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A Q ++FGA++F I+L+ I  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE+ A+R 
Sbjct: 215 AEQFARFGAQVFVINLLEISTLREMGVLLTALVVAGRSGSSFTAQIGAMVANEEVSAMRA 274

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GLD + +L+ PR+ AL++ LP+L  +A+   I+G  +  W    I  A F +RFH    
Sbjct: 275 LGLDPIEVLVVPRVLALVVMLPILAFIADIMGILGGGVAAWGTLGIDPANFTARFHEIVH 334

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L N   G+IKAPF A  I +V   +GF V   + S+G+  T  VV++I +VI++++LFAI
Sbjct: 335 LRNFVVGMIKAPFFALVIALVGCFQGFRVTGSAESVGRLTTQAVVEAIFMVIVLNALFAI 394

Query: 367 FYFAIGI 373
            + ++G+
Sbjct: 395 LFTSLGV 401


>gi|163793381|ref|ZP_02187356.1| ABC transporter, inner membrane subunit [alpha proteobacterium
           BAL199]
 gi|159181183|gb|EDP65698.1| ABC transporter, inner membrane subunit [alpha proteobacterium
           BAL199]
          Length = 391

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/375 (32%), Positives = 214/375 (57%), Gaps = 12/375 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G  V R  G W + + +   D  + A+     + S  VD ++++ +D+ GA +I   
Sbjct: 26  TRDGTLVVRLRGPW-TLQTALSVDAAIRALADRAAA-SVTVDATSLSRLDSAGAWVIQRT 83

Query: 62  MEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           + ++  +   +++ G+   ++ +    +   +       P  S       N    +G++ 
Sbjct: 84  VAQFDRRGVPVEIVGLDEGLQAILDKAAEHDQSADIAPAPTSSLL-----NFLERLGRRS 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           V+ ++   +   +LG+V+  +G         +G   +++ Q+   GV+ +P+V L+ F+ 
Sbjct: 139 VEGLHTGRNLLGLLGVVVVASGRIVVRPMTLRG--TAVVAQIEATGVTALPIVGLLCFLV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V+A  GA QL++FGA   +++L+ I  LREIG+LLTA+++AGRSGSA  A+IG+MK+N
Sbjct: 197 GVVLAYMGALQLTRFGAANLTVNLVGISVLREIGILLTAIIVAGRSGSAFAAQIGTMKVN 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           +EIDA+ TMGL  + +L+ PR+ ALII LP LT+ A+ + ++G ++V     D+    F 
Sbjct: 257 QEIDALETMGLSVIDVLVLPRVIALIIVLPALTVFADVAGLVGGAMVCMFQLDMTIGQFL 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  +  T+ +  TGLIKAP  A AI +V    G  V   + S+G++ T  VV+SI +VI
Sbjct: 317 TQLSAGVTVWSFATGLIKAPVFALAIALVGCHSGLGVSGSAESVGRQTTRAVVESIFLVI 376

Query: 359 IIDSLFAIFYFAIGI 373
           I++++FAI +  IGI
Sbjct: 377 ILNAIFAIAFAKIGI 391


>gi|148555653|ref|YP_001263235.1| hypothetical protein Swit_2742 [Sphingomonas wittichii RW1]
 gi|148500843|gb|ABQ69097.1| protein of unknown function DUF140 [Sphingomonas wittichii RW1]
          Length = 365

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/340 (35%), Positives = 192/340 (56%), Gaps = 27/340 (7%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           +DL  +  IDT+GA L+     ++   +++ G    + QL   I+    K +K +     
Sbjct: 42  IDLGEVDRIDTVGAWLVHRIAREH--DVEIVGADADVCQLIEQIAEAD-KPLKIRPDSSP 98

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQA-HILGLVISNTGEFCASSYKFKGFLL------ 154
            F+            ++++ I D+ S A H L  +I   G F A+     G +       
Sbjct: 99  PFF------------RVLREIGDATSAAAHSLAGLI---GFFGATLIGLWGLVTHPRRFR 143

Query: 155 --SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             ++ RQ   VGV  + ++ L+SF+ G VIAQQGA QL QFGAE+F+++L+  + LRE+G
Sbjct: 144 YNAMARQFEVVGVKALAIIGLMSFLIGIVIAQQGAVQLRQFGAEVFAVNLIGRITLRELG 203

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VL+TA+M+AGRSGSA  A++GSMK+ EE+DA+RT+G+  +  LI PR+ + ++ +PLL  
Sbjct: 204 VLMTAIMVAGRSGSAFAAQLGSMKLAEEVDAMRTIGVSPMEALILPRVLSTVVLMPLLGF 263

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
            A   AIIG  I  W   DIP   +  R      + +++ GLIKAP     I +    +G
Sbjct: 264 YAAVIAIIGGGIFCWIDLDIPPITYVQRIREVVPMTDLWVGLIKAPVFGMLIALCGCYQG 323

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             V  ++  +G + T  VVQ+I +VI++D++FA+F+ +IG
Sbjct: 324 MQVEGNAEEVGLRTTASVVQAIFLVIVLDAVFAVFFSSIG 363


>gi|46579026|ref|YP_009834.1| STAS domain-containing protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46448439|gb|AAS95093.1| STAS domain protein [Desulfovibrio vulgaris str. Hildenborough]
          Length = 406

 Score =  198 bits (504), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 198/367 (53%), Gaps = 8/367 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + RF+G W     +  A   +  +    +      DL+ +  +DT GA +I  F      
Sbjct: 47  ILRFSGAWDVATAAR-ARGQLQHLAIPAECGDLTFDLTGVLRLDTAGALVITTF----RT 101

Query: 68  KIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
            ++ QG++  +    +  +   R   I   +       ++       IG  IV+    + 
Sbjct: 102 ALEKQGIAPLLHCAPAHNALIDRVAAIDMSEAPTVRHASALARTLNAIGASIVEETEQAV 161

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                +G+++ +        ++F+   +SL   M   GV  VP+V L+SF+ G V A  G
Sbjct: 162 GILAFMGMLVISLVGLVLRPWRFR--WVSLCSHMEQTGVQAVPIVALLSFLIGLVTAYMG 219

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A Q ++FGA++F I+L+ I  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE+ A+R 
Sbjct: 220 AEQFARFGAQVFVINLLEISTLREMGVLLTALVVAGRSGSSFTAQIGAMVANEEVSAMRA 279

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GLD + +L+ PR+ AL++ LP+L  +A+   I+G  +  W    I  A F +RFH    
Sbjct: 280 LGLDPIEVLVVPRVLALVVMLPILAFIADIMGILGGGVAAWGTLGIDPANFTARFHEIVH 339

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L N   G+IKAPF A  I +V   +GF V   + S+G+  T  VV++I +VI++++LFAI
Sbjct: 340 LRNFVVGMIKAPFFALVIALVGCFQGFRVTGSAESVGRLTTQAVVEAIFMVIVLNALFAI 399

Query: 367 FYFAIGI 373
            + ++G+
Sbjct: 400 LFTSLGV 406


>gi|77456265|ref|YP_345770.1| hypothetical protein Pfl01_0037 [Pseudomonas fluorescens Pf0-1]
 gi|77380268|gb|ABA71781.1| putative ABC transport system, permease [Pseudomonas fluorescens
           Pf0-1]
          Length = 382

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 199/369 (53%), Gaps = 13/369 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     +E+   +   +N    +++ I DL+ +  +DT GA L++  +    G 
Sbjct: 21  LRVTGDWTLAHYAEL-KQLSETLNGQYDANTPI-DLNGLGALDTAGASLLVELL----GS 74

Query: 69  IKLQGVSTHIEQLFS-----LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
            +L   + H +   S     L+   +R       P +    +    L   IG+ +     
Sbjct: 75  ERLGKSAEHPDCTISSADRALLQTVYRSLTDFCVPIKEPEISVSVQLLTRIGRAVDTVWQ 134

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D+      +GL++           +++  +  +I  +   G+   P+V L++F+ GAV+A
Sbjct: 135 DTLQLLGFVGLILETIARSLFRPKRWR--ITPMIAHIEQTGLDAAPIVALLTFLVGAVVA 192

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA  L+ FGA +F++DL+    LRE GVLLTA+++AGR+ SA  A+IGSMK NEEIDA
Sbjct: 193 FLGATVLASFGASVFTVDLVGFAFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEIDA 252

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           IRT+GLD + +L+ PR+ AL+++LP+LT LA    I+G ++V     DI  A+F S   S
Sbjct: 253 IRTLGLDPMELLVVPRVLALLVALPMLTFLAMICGIVGGAVVCAVSLDISPAMFLSLLQS 312

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +   GL+KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++
Sbjct: 313 DIGIQHFLVGLVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAV 372

Query: 364 FAIFYFAIG 372
            A+F+  +G
Sbjct: 373 AALFFMEMG 381


>gi|229587675|ref|YP_002869794.1| putative ABC transporter permease [Pseudomonas fluorescens SBW25]
 gi|229359541|emb|CAY46382.1| putative ABC transport system, permease [Pseudomonas fluorescens
           SBW25]
          Length = 382

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/370 (33%), Positives = 202/370 (54%), Gaps = 15/370 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDS-AIVDLSAITEIDTIGAELIMYFMEKYHG 67
            R  G+W    ++  A    ++     Q D+ A +DL+ +  +DT GA L++  +    G
Sbjct: 21  LRITGDWT---LAHYASLKKLSDKLDGQYDAGARIDLNGLGALDTAGASLLVELL----G 73

Query: 68  KIKLQGVSTHIEQLFS-----LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +++  +   +   S     L+   +R       P+++    +   +   IG+ +    
Sbjct: 74  PTRIEQSAEQTDCSLSAADRALLKTVYRSLNDFCVPEKAPEEAAGIQVLARIGRAVDTVW 133

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            DS      +GL++           +++  L  ++  +  VG+   P+V L++F+ GAV+
Sbjct: 134 QDSKQLLGFIGLILETFARGIFRPRRWR--LTPMVAHLEQVGLDAAPIVALLTFLVGAVV 191

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L  FGA IF++DL++   LRE GVLLTA++IAGR+ SA  A+IGSMK NEEID
Sbjct: 192 AFLGATVLKSFGATIFTVDLVAFSFLREFGVLLTAILIAGRTASAFTAQIGSMKANEEID 251

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           AIRT+GLD + +L+ PR+ AL+++LP+LT LA  S I+G  +V     DI  A+F S   
Sbjct: 252 AIRTLGLDPMELLVLPRVLALLVALPMLTFLAMLSGIVGGGVVCAVALDISPAMFLSLLQ 311

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           S   + +   GL+KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI++D+
Sbjct: 312 SDIGVQHFLVGLVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDA 371

Query: 363 LFAIFYFAIG 372
           + A+F+  +G
Sbjct: 372 VAALFFMEMG 381


>gi|120603385|ref|YP_967785.1| hypothetical protein Dvul_2342 [Desulfovibrio vulgaris DP4]
 gi|120563614|gb|ABM29358.1| protein of unknown function DUF140 [Desulfovibrio vulgaris DP4]
          Length = 406

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 197/367 (53%), Gaps = 8/367 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + RF+G W     +  A   +  +    +      DL+ +  +DT GA +I  F      
Sbjct: 47  ILRFSGAWDVATAAR-ARGQLQHLAIPAECGDLTFDLTGVLRLDTAGALVITTF----RT 101

Query: 68  KIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
            ++ QG++  +    +  +   R   I   +       ++       IG  IV+    + 
Sbjct: 102 ALEKQGIAPLLHCAPAHNALIDRVAAIDMSEAPTVRHASALARTLNAIGASIVEETEQAV 161

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                +G+ + +        ++F+   +SL   M   GV  VP+V L+SF+ G V A  G
Sbjct: 162 GILAFMGMFVISLVGLVLRPWRFR--WVSLCSHMEQTGVQAVPIVALLSFLIGLVTAYMG 219

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A Q ++FGA++F I+L+ I  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE+ A+R 
Sbjct: 220 AEQFARFGAQVFVINLLEISTLREMGVLLTALVVAGRSGSSFTAQIGAMVANEEVSAMRA 279

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GLD + +L+ PR+ AL++ LP+L  +A+   I+G  +  W    I  A F +RFH    
Sbjct: 280 LGLDPIEVLVVPRVLALVVMLPILAFIADIMGILGGGVAAWGTLGIDPANFTARFHEIVQ 339

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L N   G+IKAPF A  I +V   +GF V   + S+G+  T  VV++I +VI++++LFAI
Sbjct: 340 LRNFVVGMIKAPFFALVIALVGCFQGFRVTGSAESVGRLTTQAVVEAIFMVIVLNALFAI 399

Query: 367 FYFAIGI 373
            + ++G+
Sbjct: 400 LFTSLGV 406


>gi|217969575|ref|YP_002354809.1| hypothetical protein Tmz1t_1154 [Thauera sp. MZ1T]
 gi|217506902|gb|ACK53913.1| protein of unknown function DUF140 [Thauera sp. MZ1T]
          Length = 385

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 210/378 (55%), Gaps = 15/378 (3%)

Query: 1   MSENGIT-VFRFAGNWK---SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAE 56
           ++ +G+  V R  G+W       +   AD +   I+ + +     V+L+ +  +DT GA 
Sbjct: 16  LAGDGVAAVLRLRGDWTLAHHAALRRQADALRGRIDAATR-----VELAELGTLDTAGAR 70

Query: 57  LIMYFM--EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHI 114
           L+   +  E+    +  +G  +  E+   L +     + + ++P     Y +  ++  HI
Sbjct: 71  LLHGLLGGERVAALLADEGALSR-ERRALLKAVADAIEGREERPAADEGY-ALGDVLAHI 128

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
           G  ++ F     +    +GL++           +++  + +L+  +   G+  VP++ L+
Sbjct: 129 GHTMLVFWRHVSALTGFIGLILETALRVSVQPRRWR--VTALVANLERTGLDAVPIIALL 186

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           +F+ GAV+A  GA  L  FGA IF++DL++   LRE GVLLTA+++AGR+ S+  A+IGS
Sbjct: 187 TFLVGAVVAFLGATVLQNFGASIFTVDLVAYSFLREFGVLLTAIIVAGRTASSFTAQIGS 246

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M+ NEEIDAIR +GLD V +L+ PR++AL+++LP+LT +A  + I+G  +V     DI  
Sbjct: 247 MRANEEIDAIRVLGLDPVELLVLPRVYALLVALPILTFVAMIAGIVGGMLVSAMTLDISP 306

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
            +F SR      L + + G+ KAP  A  I ++   EGF V   + S+G+  T+ VVQSI
Sbjct: 307 VLFLSRIEDNVGLIHFWVGMAKAPIFAFLIAVIGCLEGFRVQGSAQSVGEHTTSAVVQSI 366

Query: 355 SIVIIIDSLFAIFYFAIG 372
            +VI++D++ A+F   +G
Sbjct: 367 FVVIVVDAIAALFCMEMG 384


>gi|188993114|ref|YP_001905124.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734874|emb|CAP53086.1| ABC transporter permease [Xanthomonas campestris pv. campestris]
          Length = 370

 Score =  196 bits (499), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 202/367 (55%), Gaps = 21/367 (5%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W        A+ ++ A+   ++     +D   I ++D+ G   ++ F  +    +
Sbjct: 20  RLAGSWVLATALPQAE-LLQAVPDGVRR----IDARGIGQLDSAGVLQLLRFASRM--GL 72

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFY----NSFKNLHYHIGKKIVKFINDS 125
           K   +    E   +L+        +  KP+R + +    +      + +G+ I++  +  
Sbjct: 73  KEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALDRLGRTTHGVGQGILELNS-- 129

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 LG  +   G       +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  
Sbjct: 130 -----FLGENLVKIGRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFL 182

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIR
Sbjct: 183 GSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIR 242

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T 
Sbjct: 243 TLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTI 302

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A
Sbjct: 303 QLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAA 362

Query: 366 IFYFAIG 372
           +++  +G
Sbjct: 363 LWFMKMG 369


>gi|146305413|ref|YP_001185878.1| hypothetical protein Pmen_0373 [Pseudomonas mendocina ymp]
 gi|145573614|gb|ABP83146.1| protein of unknown function DUF140 [Pseudomonas mendocina ymp]
          Length = 379

 Score =  196 bits (497), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 119/359 (33%), Positives = 199/359 (55%), Gaps = 9/359 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +  +  R  G+W     S + +  V+A+ + +    + VDL  +  +DT GA L++  
Sbjct: 13  STDAASGLRIGGDWTLAHYSRL-EPQVLALRERLHGQES-VDLDELAALDTAGAALLVEL 70

Query: 62  M--EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
           +  E+     +   +ST    L   ++        +Q+ Q+    ++ + +  HIG+ + 
Sbjct: 71  LGSERLRQLAQQDNLSTERRALLLAVA---DAMAGSQQVQQHATPSALREVLGHIGEAVE 127

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                       +GL +S          +++  L SL   +   G++ VP+V L++F+ G
Sbjct: 128 TTWCHGRELLGFMGLTLSGMLTILLRPARWR--LTSLAAHLEQCGLNAVPIVALLTFLVG 185

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A  GA  L+ FGA I++++L++   LRE GVLLTA+++AGR+ SA  A+IGSMK NE
Sbjct: 186 AVVAFLGATILADFGASIYTVNLVAFSFLREFGVLLTAILMAGRTASAFTAQIGSMKANE 245

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDAIRT+GL  + +L+ PR++A++I+LP+LT +A  S I+G ++V     DIP  ++ S
Sbjct: 246 EIDAIRTLGLSPIELLVLPRVFAMLIALPILTFIAMLSGIVGGAVVCAVSLDIPLTMYMS 305

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               +  L +   GL+KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI
Sbjct: 306 ILQDSDLLRHFLVGLLKAPIFAFLIALIGCLEGFKVSGSAQSVGEHTTSAVVQSIFVVI 364


>gi|325923308|ref|ZP_08184981.1| conserved hypothetical integral membrane protein [Xanthomonas
           gardneri ATCC 19865]
 gi|325546235|gb|EGD17416.1| conserved hypothetical integral membrane protein [Xanthomonas
           gardneri ATCC 19865]
          Length = 370

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 201/367 (54%), Gaps = 21/367 (5%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W        A+ ++ A+   I+     +D   I ++D+ G   ++ F  +    +
Sbjct: 20  RLAGSWVLATALPQAE-LLQAVPDGIRR----IDARGIAQLDSAGVLQLLRFASRM--GL 72

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFY----NSFKNLHYHIGKKIVKFINDS 125
           K   +    E   +L+        +  KP+R + +    +      + +G+ I++  +  
Sbjct: 73  KEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALDRLGRTTHGVGQGILELNS-- 129

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  
Sbjct: 130 -----FLGENLVKIARLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFL 182

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIR
Sbjct: 183 GSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIR 242

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T 
Sbjct: 243 TLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTI 302

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A
Sbjct: 303 QLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAA 362

Query: 366 IFYFAIG 372
           +++  +G
Sbjct: 363 LWFMKMG 369


>gi|103485974|ref|YP_615535.1| hypothetical protein Sala_0481 [Sphingopyxis alaskensis RB2256]
 gi|98976051|gb|ABF52202.1| protein of unknown function DUF140 [Sphingopyxis alaskensis RB2256]
          Length = 368

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 188/333 (56%), Gaps = 9/333 (2%)

Query: 40  AIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ 99
           A +DLSAI  IDT+GA ++      +  +I   G S   ++L   ++ + + + +  + +
Sbjct: 43  ATLDLSAIDRIDTVGAWIVTRTAADHDARIT--GASADAQRLLDALA-SDKSEYRVHRDR 99

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           R     ++  +   IG   V   N+        G +I        +  + +    +++ +
Sbjct: 100 RP----AWVRMLEQIGTASVAVWNELLGIVGFFGAMIVAIFNQIRARRRLR--WNAIVTR 153

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
              VGV  +P++ L+SF+ G VIAQQGA QL QFG E+F+I+L+    +RE+G+L+TA+M
Sbjct: 154 FQTVGVDALPIIGLMSFLIGIVIAQQGAVQLEQFGLEVFTINLVGRASIRELGLLMTAIM 213

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           +AGRSGSA  A+IG+MK+ EE+DA+RT+G+  +  ++ PR+ A  I++PLL   A+  AI
Sbjct: 214 VAGRSGSAFAAQIGTMKLTEEVDAMRTIGVSPMEAIVLPRVAASTITMPLLGFYASLCAI 273

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
            G  +  W   DIP   +  R      + + +  LIKAP     IG+    EG  V  ++
Sbjct: 274 AGGGLFCWVGLDIPPLTYIQRLREIIPMTDFWIMLIKAPVFGILIGVTGCYEGMQVRQNA 333

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             +G++ T+ VV +I +VI++D+ FA+F+ ++G
Sbjct: 334 EEVGQRTTSAVVAAIFLVIVLDAFFAVFFSSLG 366


>gi|166713439|ref|ZP_02244646.1| ABC transporter permease [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 370

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 199/368 (54%), Gaps = 21/368 (5%)

Query: 9   FRFAGNW----KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
            R AG+W      P+ +E+   V   + +        +D   I ++D+ G   ++ F  +
Sbjct: 19  LRLAGSWVLATALPQ-AELLQTVPDGVRR--------IDARGIQQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               +K   +    E   +L+        +  KP+R + + +  +    +G+   +   D
Sbjct: 70  M--GLKEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRIGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|21244295|ref|NP_643877.1| ABC transporter permease [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109945|gb|AAM38413.1| ABC transporter permease [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 370

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 203/364 (55%), Gaps = 15/364 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W        A+ ++ A+   ++     +D   I ++D+ G   ++    ++ G++
Sbjct: 20  RLAGSWVLATALPQAE-LLQAVPDGVRR----IDARGIQQLDSAGVLQLL----RFAGRM 70

Query: 70  KLQGVSTHI-EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            L+  +    ++  +L+        +  KP+R + + +  +    +G+   +   D    
Sbjct: 71  GLKEDAIDFRDEHQALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRVGQDILEL 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  G+ 
Sbjct: 128 NSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFLGST 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIRT+G
Sbjct: 186 ILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIRTLG 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T  L 
Sbjct: 246 LDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTIQLR 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A+++
Sbjct: 306 HFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAALWF 365

Query: 369 FAIG 372
             +G
Sbjct: 366 MKMG 369


>gi|294624127|ref|ZP_06702865.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294663966|ref|ZP_06729386.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292601572|gb|EFF45571.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292606261|gb|EFF49492.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 370

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 204/364 (56%), Gaps = 15/364 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W        A+ ++ A+ + ++     +D   I ++D+ G   ++    ++ G++
Sbjct: 20  RLAGSWVLATALPQAE-LLQAVPEGVRR----IDARGIQQLDSAGVLQLL----RFAGRM 70

Query: 70  KLQGVSTHI-EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            L+  +    ++  +L+        +  KP+R + + +  +    +G+   +   D    
Sbjct: 71  GLKEDAIDFRDEHQALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRVGQDILEL 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  G+ 
Sbjct: 128 NSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFLGST 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIRT+G
Sbjct: 186 ILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIRTLG 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ AL+ +LPLLT +A  + + G   V     DIP  ++ +R H T  L 
Sbjct: 246 LDPIDLLVIPRLLALVFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTIQLR 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A+++
Sbjct: 306 HFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAALWF 365

Query: 369 FAIG 372
             +G
Sbjct: 366 MKMG 369


>gi|325928564|ref|ZP_08189752.1| putative integral membrane protein [Xanthomonas perforans 91-118]
 gi|325541103|gb|EGD12657.1| putative integral membrane protein [Xanthomonas perforans 91-118]
          Length = 370

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 203/364 (55%), Gaps = 15/364 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W        A+ ++ A+   ++     +D   I ++D+ G   ++    ++ G++
Sbjct: 20  RLAGSWVLATALPQAE-LLQAVPDGVRR----IDARGIQQLDSAGVLQLL----RFAGRM 70

Query: 70  KLQGVSTHI-EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            L+  +    ++  +L+        +  KP+R + + +  +    +G+   +   D    
Sbjct: 71  GLKEDAIDFRDEHQALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRVGQDILEL 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  G+ 
Sbjct: 128 NSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFLGST 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIRT+G
Sbjct: 186 ILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIRTLG 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T  L 
Sbjct: 246 LDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHETIQLR 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A+++
Sbjct: 306 HFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAALWF 365

Query: 369 FAIG 372
             +G
Sbjct: 366 MKMG 369


>gi|84622391|ref|YP_449763.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578633|ref|YP_001915562.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84366331|dbj|BAE67489.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523085|gb|ACD61030.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 370

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 199/368 (54%), Gaps = 21/368 (5%)

Query: 9   FRFAGNW----KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
            R AG+W      P+ +E+   V   + +        +D   I ++D+ G   ++ F  +
Sbjct: 19  LRLAGSWVLATALPQ-AELLQTVPDGVRR--------IDARGIQQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               +K   +    E   +L+        +  KP+R + + +  +    +G+   +   D
Sbjct: 70  I--GLKEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRIGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|58580429|ref|YP_199445.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58425023|gb|AAW74060.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 398

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 199/368 (54%), Gaps = 21/368 (5%)

Query: 9   FRFAGNW----KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
            R AG+W      P+ +E+   V   + +        +D   I ++D+ G   ++ F  +
Sbjct: 47  LRLAGSWVLATALPQ-AELLQTVPDGVRR--------IDARGIQQLDSAGVLQLLRFASR 97

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               +K   +    E   +L+        +  KP+R + + +  +    +G+   +   D
Sbjct: 98  I--GLKEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRIGQD 151

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 152 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 209

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 210 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 269

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 270 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 329

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 330 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 389

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 390 ALWFMKMG 397


>gi|289662615|ref|ZP_06484196.1| ABC transporter permease [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289668440|ref|ZP_06489515.1| ABC transporter permease [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 370

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 122/368 (33%), Positives = 199/368 (54%), Gaps = 21/368 (5%)

Query: 9   FRFAGNW----KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
            R AG+W      P+ +E+   V   + +        +D   I ++D+ G   ++ F  +
Sbjct: 19  LRLAGSWVLATALPQ-AELLQTVPDGVRR--------IDARGIQQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               +K   +    E   +L+        +  KP+R + + +  +    +G+   +   D
Sbjct: 70  M--GLKEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALD---RLGRATHRVGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVTGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|330806719|ref|YP_004351181.1| Putative ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327374827|gb|AEA66177.1| Putative ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 382

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 118/342 (34%), Positives = 186/342 (54%), Gaps = 19/342 (5%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFM-------EKYHGKIKLQGVSTHIEQLF--SLISF 87
            ++ ++DL+ +  +DT GA L++  +          H    L      + Q    SL  F
Sbjct: 47  DENTLIDLNGLGALDTAGASLLVELLGSERLGKTTEHPDCSLPAAERALLQTVYCSLTDF 106

Query: 88  THRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSY 147
                +  ++PQ          L   IG+ + K   D+      +GL++           
Sbjct: 107 C----VPVKEPQ----VGVLTQLLTRIGRAVEKVWQDTLQLLGFVGLILETLARNLLRPR 158

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           +++  +  ++  +   G+   P+V L++F+ GAV+A  GA  L+ FGA IF++DL++   
Sbjct: 159 RWR--MTPMVVHIEQTGLDAAPIVALLTFLVGAVVAFLGATVLADFGASIFTVDLVAFSF 216

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           LRE GVLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+GLD V +L+ PR+ AL+++L
Sbjct: 217 LREFGVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLGLDPVELLVIPRVLALLVAL 276

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIV 327
           P+LT LA  S IIG  +V      I  A+F +   S   + +   G++KAP  A  I  V
Sbjct: 277 PMLTFLAMLSGIIGGGVVCALSLGISPAMFLTLLQSDIGVQHFLVGMVKAPIFAFLIAAV 336

Query: 328 AMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              EGF V   + S+G   T+ VVQSI +VI++D++ A+F+ 
Sbjct: 337 GCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAALFFM 378


>gi|114764121|ref|ZP_01443360.1| ABC transporter, inner membrane subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114543479|gb|EAU46494.1| ABC transporter, inner membrane subunit [Roseovarius sp. HTCC2601]
          Length = 377

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 121/338 (35%), Positives = 193/338 (57%), Gaps = 10/338 (2%)

Query: 39  SAIVDLSAITEIDTIGAELIMYFMEKYH---GKIKLQGVSTHIEQLFSLISFTHRKKIKN 95
           S +VDL+ +  IDT GA L++    +     G   L+ VS     L   +     ++ + 
Sbjct: 47  SLVVDLAGVERIDTAGAWLLVDLEARAQAAGGSFGLRNVSDTTALLLDNV-----RQARP 101

Query: 96  QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
           ++  R       + L   IG+ +V  +         LGL ++  G       +F+  L +
Sbjct: 102 EREDRPAAARGIQALLEQIGRAVVGGLRYFADLTGFLGLFLARLGRVLRHPSQFR--LTA 159

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+     VG+  VP+V L+SF+ G V+A QG+ QL QFGAE+F +DL++I  LRE+G+LL
Sbjct: 160 LVAHCEDVGLRAVPIVALMSFLIGVVLAFQGSEQLRQFGAEVFVVDLIAISVLRELGILL 219

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+++AGR+ SA  A IGSMK+ EEIDA+RT+GLD   +L  PRI AL++ LP+L ++A+
Sbjct: 220 TAIIVAGRTASAFTAAIGSMKMREEIDAMRTLGLDPGVMLFVPRILALLLMLPILGLIAD 279

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  + G +++ W    I  ++F +R      + ++  GL+KAP  A  IG+V    G  V
Sbjct: 280 FMGLFGGALMAWLELGISPSMFVTRLIEGTGVGHLLVGLVKAPAFALIIGVVGCHAGMQV 339

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             ++ SLG+  +  VV +I  VI+ D+LF++F+  +GI
Sbjct: 340 KGNAESLGRMTSGAVVAAIFAVILADALFSVFFAKVGI 377


>gi|21230110|ref|NP_636027.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769899|ref|YP_244661.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111638|gb|AAM39951.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575231|gb|AAY50641.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 370

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 121/367 (32%), Positives = 201/367 (54%), Gaps = 21/367 (5%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W        A+ ++ A+   ++     +D   I ++D+ G   ++ F  +    +
Sbjct: 20  RLAGSWVLATALPQAE-LLQAVPDGVRR----IDARGIGQLDSAGVLQLLRFASRM--GL 72

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFY----NSFKNLHYHIGKKIVKFINDS 125
           K   +    E   +L+        +  KP+R + +    +      + +G+ I++  +  
Sbjct: 73  KEDAIDFRDEHQ-ALVCTIEELNDERPKPKRDYGFVAALDRLGRTTHGVGQGILELNS-- 129

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  
Sbjct: 130 -----FLGENLVKIARLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFL 182

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIR
Sbjct: 183 GSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIR 242

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T 
Sbjct: 243 TLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTI 302

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A
Sbjct: 303 QLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAA 362

Query: 366 IFYFAIG 372
           +++  +G
Sbjct: 363 LWFMKMG 369


>gi|78049251|ref|YP_365426.1| ABC transporter permease [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037681|emb|CAJ25426.1| ABC transporter permease [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 409

 Score =  193 bits (490), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 114/332 (34%), Positives = 190/332 (57%), Gaps = 10/332 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHI-EQLFSLISFTHRKKIKNQKPQR 100
           +D   I ++D+ G   ++    ++ G++ L+  +    ++  +L+        +  KP+R
Sbjct: 86  IDARGIQQLDSAGVLQLL----RFAGRMGLKEDAIDFRDEHQALVCTIEELNDERPKPKR 141

Query: 101 SFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQM 160
            + + +  +    +G+   +   D       LG  +           +F+  L S +  M
Sbjct: 142 DYGFVAALD---RLGRATHRVGQDILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHM 196

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
             VG+  VP+V+L+S++ GAVIA  G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++
Sbjct: 197 EQVGLDAVPLVVLLSYLVGAVIAFLGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVL 256

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGR+ SA  A+IG+MK  EE+DAIRT+GLD + +L+ PR+ ALI +LPLLT +A  + + 
Sbjct: 257 AGRTASAFTAQIGAMKSREEVDAIRTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLA 316

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G   V     DIP  ++ +R H T  L +   GL KAP  A  IG++   EG  V   + 
Sbjct: 317 GGVTVGAFDLDIPPQMYLARMHETIQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQ 376

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           S+G++ T+ VVQ+IS+VII+D++ A+++  +G
Sbjct: 377 SVGERTTSSVVQTISLVIILDAIAALWFMKMG 408


>gi|146277759|ref|YP_001167918.1| hypothetical protein Rsph17025_1720 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556000|gb|ABP70613.1| protein of unknown function DUF140 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 366

 Score =  193 bits (490), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 107/335 (31%), Positives = 189/335 (56%), Gaps = 9/335 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHG---KIKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           +D+ A+  +DT GA  I+   ++        ++  +S     L + ++      +   +P
Sbjct: 38  LDMGAVEALDTAGAWAILSAQKRAEAGGRPFEIVNLSEAHRHLLATVA----DAMPEPEP 93

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
           +R        +    +G+++   +  S       G V+++ G       + +  L  L+ 
Sbjct: 94  RRRTIPGRPGDGLAQLGQEVAGGLRGSLDSMAFFGQVVAHLGGLLIHPRRLR--LTPLVH 151

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            M   G + VP+V L+ F+ G V+A QG+ QL  FGAE++ +DL++I  LRE+G+LLTA+
Sbjct: 152 HMQEAGWNAVPIVTLMGFLIGIVLAFQGSTQLKAFGAEVYVVDLVAISILRELGILLTAI 211

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSA  A IGSMK+ EEIDA+R +GLD +  L+ PR+ AL+I LP+L  +A+ + 
Sbjct: 212 IVAGRSGSAFTAAIGSMKMREEIDAMRVLGLDPIDRLVLPRLIALVILLPVLGFIASMAG 271

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++G +++ W    I   +F ++  +   + +   GL+KAPF A  I ++   +G  V  +
Sbjct: 272 LVGGALMAWIDLGITPGMFRTQLLADTDVNHAIIGLVKAPFFAVIIAVIGCHQGMQVSGN 331

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SLG   +  VVQ+I +VI++D+LF++F+   G+
Sbjct: 332 AESLGSHTSRSVVQAIFLVIVVDALFSVFFAVWGL 366


>gi|28198464|ref|NP_778778.1| ABC transporter permease [Xylella fastidiosa Temecula1]
 gi|28056548|gb|AAO28427.1| ABC transporter permease [Xylella fastidiosa Temecula1]
          Length = 372

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 201/350 (57%), Gaps = 14/350 (4%)

Query: 24  ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFS 83
           A +++ + + SIQ     ++   I ++D+ GA  ++ F  +    +K + +    E+   
Sbjct: 35  ASELLQSYSNSIQH----INARNIDQLDSAGALQLLRFTTRT--GLKNEAIEFR-EEHRP 87

Query: 84  LISFTHRKKIKNQKPQRSF-FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEF 142
           LIS       ++ KP+R + F  + + L   +  K  + I D CS    LG  +    + 
Sbjct: 88  LISTIEILDDEHPKPERDYGFLAALERLGIAV-VKTRRNIIDVCS---FLGENLVKIAQL 143

Query: 143 CASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDL 202
                +F+  + S +  M  VG+  VP+V+++S++ GAVIA  G+  L  FGAEIF ++L
Sbjct: 144 AREPRRFR--ITSTVHHMEQVGLDAVPLVVVLSYLVGAVIAFLGSTILRNFGAEIFVVEL 201

Query: 203 MSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWA 262
           ++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI+T+GLD + +L+ PR+ A
Sbjct: 202 VNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAIQTLGLDPIDLLVIPRLIA 261

Query: 263 LIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMAC 322
           L++ LPLLT +A  + + G   V      IP  ++ SR H T  L +   G+ KAP  A 
Sbjct: 262 LLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHETMQLRHFIIGMSKAPLFAL 321

Query: 323 AIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L A+++  +G
Sbjct: 322 IIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALAALWFMRMG 371


>gi|126462257|ref|YP_001043371.1| hypothetical protein Rsph17029_1489 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103921|gb|ABN76599.1| protein of unknown function DUF140 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 366

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 190/335 (56%), Gaps = 9/335 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           +D++A+  +DT GA  I+   ++       +++  +S     L   ++    +  + ++ 
Sbjct: 38  IDMAAVEALDTAGAWAILQAQKRAEAAGQALEIVNLSESHRHLLETVAAAMPEPERRRRT 97

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
                 +   NL    G+++ + +  S +     G V+++ G       + K  L  L+ 
Sbjct: 98  IPGRPDDGLANL----GQEVAQGLRGSLTSVGFFGEVVAHLGALVLHPTRLK--LTPLVH 151

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            M   G + VP+V L+ F+ G V+A QG+ QL  FGAE++ +DL++I  LRE+G+LLTA+
Sbjct: 152 HMQEAGWNAVPIVSLMGFLIGIVLAFQGSTQLKSFGAEVYVVDLVAISILRELGILLTAI 211

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRS SA  A IGSMK+ EEIDA+R +GLD +  L+ PR+ AL+I LP L  +A+ + 
Sbjct: 212 IVAGRSASAFTAAIGSMKMREEIDAMRVLGLDPIDRLVLPRLIALVILLPALGFIASLAG 271

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++G  ++ W    I   +F ++  +   +++   GL+KAPF A  I ++   +G  V  +
Sbjct: 272 LVGGGLMAWIDLGITPGMFRTQLLADTDVSHAIIGLVKAPFFAVIIAVIGCHQGMQVSGN 331

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SLG   +  VVQ+I +VI++D+LF+IF+   G+
Sbjct: 332 AESLGSHTSRSVVQAIFLVIVVDALFSIFFAVWGL 366


>gi|182681137|ref|YP_001829297.1| hypothetical protein XfasM23_0579 [Xylella fastidiosa M23]
 gi|182631247|gb|ACB92023.1| protein of unknown function DUF140 [Xylella fastidiosa M23]
 gi|307579585|gb|ADN63554.1| ABC transporter permease [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 396

 Score =  192 bits (488), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 201/350 (57%), Gaps = 14/350 (4%)

Query: 24  ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFS 83
           A +++ + + SIQ     ++   I ++D+ GA  ++ F  +    +K + +    E+   
Sbjct: 59  ASELLQSYSNSIQH----INARNIDQLDSAGALQLLRFTTRT--GLKNEAIEFR-EEHRP 111

Query: 84  LISFTHRKKIKNQKPQRSF-FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEF 142
           LIS       ++ KP+R + F  + + L   +  K  + I D CS    LG  +    + 
Sbjct: 112 LISTIEILDDEHPKPERDYGFLAALERLGIAV-VKTRRNIIDVCS---FLGENLVKIAQL 167

Query: 143 CASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDL 202
                +F+  + S +  M  VG+  VP+V+++S++ GAVIA  G+  L  FGAEIF ++L
Sbjct: 168 AREPRRFR--ITSTVHHMEQVGLDAVPLVVVLSYLVGAVIAFLGSTILRNFGAEIFVVEL 225

Query: 203 MSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWA 262
           ++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI+T+GLD + +L+ PR+ A
Sbjct: 226 VNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAIQTLGLDPIDLLVIPRLIA 285

Query: 263 LIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMAC 322
           L++ LPLLT +A  + + G   V      IP  ++ SR H T  L +   G+ KAP  A 
Sbjct: 286 LLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHETMQLRHFIIGMSKAPLFAL 345

Query: 323 AIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L A+++  +G
Sbjct: 346 IIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALAALWFMRMG 395


>gi|221639257|ref|YP_002525519.1| ABC transporter inner membrane subunit [Rhodobacter sphaeroides
           KD131]
 gi|221160038|gb|ACM01018.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           KD131]
          Length = 356

 Score =  192 bits (488), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 108/335 (32%), Positives = 190/335 (56%), Gaps = 9/335 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           +D++A+  +DT GA  I+   ++       +++  +S     L   ++    +  + ++ 
Sbjct: 28  IDMAAVEALDTAGAWAILQAQKRAEAAGQALEIVNLSESHRHLLETVAAAMPEPERRRRT 87

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
                 +   NL    G+++ + +  S +     G V+++ G       + K  L  L+ 
Sbjct: 88  IPGRPDDGLANL----GQEVAQGLRGSLTSVGFFGEVVAHLGALVLHPTRLK--LTPLVH 141

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            M   G + VP+V L+ F+ G V+A QG+ QL  FGAE++ +DL++I  LRE+G+LLTA+
Sbjct: 142 HMQEAGWNAVPIVSLMGFLIGIVLAFQGSTQLKSFGAEVYVVDLVAISILRELGILLTAI 201

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRS SA  A IGSMK+ EEIDA+R +GLD +  L+ PR+ AL+I LP L  +A+ + 
Sbjct: 202 IVAGRSASAFTAAIGSMKMREEIDAMRVLGLDPIDRLVLPRLIALVILLPALGFIASLAG 261

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++G  ++ W    I   +F ++  +   +++   GL+KAPF A  I ++   +G  V  +
Sbjct: 262 LVGGGLMAWIDLGITPGMFRTQLLADTDVSHAIIGLVKAPFFAVIIAVIGCHQGMQVSGN 321

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SLG   +  VVQ+I +VI++D+LF+IF+   G+
Sbjct: 322 AESLGSHTSRSVVQAIFLVIVVDALFSIFFAVWGL 356


>gi|114570554|ref|YP_757234.1| hypothetical protein Mmar10_2004 [Maricaulis maris MCS10]
 gi|114341016|gb|ABI66296.1| protein of unknown function DUF140 [Maricaulis maris MCS10]
          Length = 384

 Score =  192 bits (488), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 195/376 (51%), Gaps = 13/376 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            E   T+    G+W    I    D+ + A+  S    S +VD+S +  +DT GA    Y 
Sbjct: 18  EEGERTILEPHGDWVIDTIGR-HDNAIRAVEASADPCSIVVDVSHLGRVDTAGA----YL 72

Query: 62  MEKYHGKIKLQGVSTH-IEQLFSLISFTHRKKIKNQ--KPQRSFFYNSFKNLHYHIGKKI 118
           + +   K        H + Q  ++       +++ Q   P     +   K L   +G  I
Sbjct: 73  LGRATRKCPTPDADFHFVGQHRTVRRLIEEVRMRTQVCGPDEVPTFGFIKAL-ARLGAGI 131

Query: 119 VKFINDSCSQAHILGLVISNTGEFC-ASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
                ++       G  ++ TG  C    ++F+  L   +  M  VGV+ +P+V  ++F 
Sbjct: 132 EVAYQEAVDTFAFFGKTLT-TGLSCFIQPWRFR--LTPTVWAMEEVGVNALPIVATLTFF 188

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            GAV+A  GA  L  FGA +F++DL+ +  LRE GVL+TA+M+A RS SA  A IG+MK+
Sbjct: 189 IGAVVAYMGATLLQSFGASVFTVDLVGLAVLREFGVLITAIMLAARSDSAFTASIGAMKM 248

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            +EIDA+R +GLD    L+ PR+ A ++  PLLT  A  + I G  +V W   DI  A+F
Sbjct: 249 QQEIDAMRVLGLDPYEALVLPRVVACVLMAPLLTFGAMVAGIFGGMLVAWTAQDISPALF 308

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           F+R HS   +++ + G+ KAP     + I+  ++G  V     SLG++VT  VVQSI  +
Sbjct: 309 FTRLHSEIDISHFWVGMSKAPVFGMVVAIIGCRQGMQVQGDVESLGRRVTASVVQSIFAI 368

Query: 358 IIIDSLFAIFYFAIGI 373
           I++++LFA+ Y  + I
Sbjct: 369 IVLEALFAMMYLELEI 384


>gi|330501346|ref|YP_004378215.1| hypothetical protein MDS_0432 [Pseudomonas mendocina NK-01]
 gi|328915632|gb|AEB56463.1| hypothetical protein MDS_0432 [Pseudomonas mendocina NK-01]
          Length = 381

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 120/367 (32%), Positives = 200/367 (54%), Gaps = 25/367 (6%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +  +  R  G+W     S++ +  V+A+ + +    + VDL  +  +DT GA L+   
Sbjct: 15  STDAASGLRLGGDWTLAHYSQL-EPQVLALRERLHGKES-VDLGDLAALDTAGAALL--- 69

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKK---------IKNQKPQRSFFYNS-FKNLH 111
                  ++L G S  + QL        R++         +    P ++    S  + + 
Sbjct: 70  -------VELFG-SERLRQLIQQAELDERRRALLLTVADAMAGSAPAQAASEPSVLREVL 121

Query: 112 YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVV 171
            HIG+ +    +   +    +GL +++         +++  L SL   +   G++ VP+V
Sbjct: 122 GHIGEVVEGMWHQGRALLGFMGLTLTSMLAILVRPMRWR--LTSLAAHLEQCGLNAVPIV 179

Query: 172 ILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAE 231
            L++F+ GAV+A  GA  L+ FGA I++++L++   LRE GVLLTA+++AGR+ SA  A+
Sbjct: 180 ALLTFLVGAVVAFLGATILADFGATIYTVNLVAFSFLREFGVLLTAILMAGRTASAFTAQ 239

Query: 232 IGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYD 291
           IGSMK NEEIDAIRT+GL  + +L+ PR++A++I+LP+LT +A  S I+G  +V     D
Sbjct: 240 IGSMKANEEIDAIRTLGLSPIELLVLPRVFAMLIALPILTFIAMLSGIVGGGLVCAVSLD 299

Query: 292 IPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVV 351
           IP  ++ S    +  L +   GL+KAP  A  I ++   EGF V   + S+G+  T+ VV
Sbjct: 300 IPVTMYLSILQDSDLLRHFLVGLLKAPIFAFLIALIGCLEGFKVSGSAQSVGEHTTSAVV 359

Query: 352 QSISIVI 358
           QSI +VI
Sbjct: 360 QSIFVVI 366


>gi|254292866|ref|YP_003058889.1| hypothetical protein Hbal_0490 [Hirschia baltica ATCC 49814]
 gi|254041397|gb|ACT58192.1| protein of unknown function DUF140 [Hirschia baltica ATCC 49814]
          Length = 380

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 112/373 (30%), Positives = 199/373 (53%), Gaps = 12/373 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G  V    G W +  +  I   +    +K +  D ++ D+S + + DT GA ++   + +
Sbjct: 16  GDPVMVLEGAWTAFTVGAIDKPLRQLTSKDVSKDVSL-DVSQLEDFDTAGAYVVDRTLRQ 74

Query: 65  YHGK----IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                    K+ G +  +  L + ++    + +K  K +     + F  L   +G   V 
Sbjct: 75  LGAPSGSLAKIVGDTHSVISLLTAVNAAKPEPVKKAKDR-----HGFTQLLDRVGHGTVD 129

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
            + +       +G   +       +  K +    S++  M   G++ +P+V ++SF  G 
Sbjct: 130 ALKEGWGILEFIGEAFTTVFFLLLNPKKIR--WTSVVAIMEEAGLNALPIVSMLSFFIGI 187

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           VIA  G   L  FGA++F+++++  L LRE G++LTA+++AGR+ S+  AEIG+MK+ EE
Sbjct: 188 VIAFLGVNLLQSFGAQVFTVEMVGFLMLREFGLVLTAILLAGRTDSSFTAEIGAMKMREE 247

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MGL+ + +L++PR+ AL++  P L+  A  S ++G  +V+W   DI  A+F  R
Sbjct: 248 VDAMRVMGLNPMEVLVAPRLIALLVMTPFLSFFAMISGLVGGLLVMWGVMDISPAMFIQR 307

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
              T    N + G++KAP  A  I +V  ++G  V     SLG++ T+ VVQ+I +VI+I
Sbjct: 308 IQDTVPGQNFWVGIVKAPVFATVIALVGCRQGLLVSGDVQSLGQRTTSSVVQAIFLVIVI 367

Query: 361 DSLFAIFYFAIGI 373
           D++FAI Y  +G+
Sbjct: 368 DAIFAILYMEMGL 380


>gi|77463402|ref|YP_352906.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           2.4.1]
 gi|77387820|gb|ABA79005.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           2.4.1]
          Length = 366

 Score =  192 bits (487), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/335 (31%), Positives = 190/335 (56%), Gaps = 9/335 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           +D++A+  +DT GA  ++   ++       +++  +S     L   ++    +  + ++ 
Sbjct: 38  IDMAAVEALDTAGAWALLQAQKRAEAAGQALEIVNLSESHRHLLETVAAAMPEPERRRRT 97

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
                 +   NL    G+++ + +  S +     G V+++ G       + K  L  L+ 
Sbjct: 98  IPGRPDDGLANL----GQEVAQGLRGSLTSVGFFGEVVTHLGALVLHPTRLK--LTPLVH 151

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            M   G + VP+V L+ F+ G V+A QG+ QL  FGAE++ +DL++I  LRE+G+LLTA+
Sbjct: 152 HMQEAGWNAVPIVSLMGFLIGIVLAFQGSTQLKSFGAEVYVVDLVAISILRELGILLTAI 211

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRS SA  A IGSMK+ EEIDA+R +GLD +  L+ PR+ AL+I LP L  +A+ + 
Sbjct: 212 IVAGRSASAFTAAIGSMKMREEIDAMRVLGLDPIDRLVLPRLIALVILLPALGFIASLAG 271

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++G  ++ W    I   +F ++  +   +++   GL+KAPF A  I ++   +G  V  +
Sbjct: 272 LVGGGLMAWIDLGITPGMFRTQLLADTDVSHAIIGLVKAPFFAVIIAVIGCHQGMQVSGN 331

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SLG   +  VVQ+I +VI++D+LF+IF+   G+
Sbjct: 332 AESLGSHTSRSVVQAIFLVIVVDALFSIFFAVWGL 366


>gi|325915744|ref|ZP_08178046.1| hypothetical integral membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538008|gb|EGD09702.1| hypothetical integral membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 370

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 119/368 (32%), Positives = 205/368 (55%), Gaps = 23/368 (6%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R +G+W        A+ ++ A+   ++     +D   I ++D+ G   ++    ++ G++
Sbjct: 20  RLSGSWVLATALPQAE-LLQAVPDGVRR----IDARGIGQLDSAGVLQLL----RFAGRM 70

Query: 70  KLQGVSTHI-EQLFSLISFTHRKKIKNQKPQRSFFY----NSFKNLHYHIGKKIVKFIND 124
            L+  +    ++  +L+        +  KP+R + +    +      + +G+ I++  + 
Sbjct: 71  GLKEDAIDFRDEHQALVCTIEELNDERPKPKRDYGFVAALDRLGRTTHGVGQGILELNS- 129

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 130 ------FLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|319788025|ref|YP_004147500.1| hypothetical protein Psesu_2437 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466537|gb|ADV28269.1| protein of unknown function DUF140 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 371

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 199/371 (53%), Gaps = 29/371 (7%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G+W      E+A     A  + I  D A VD S +  ID+ G    M  + ++  + 
Sbjct: 21  RLQGDWILDHALEMA-----ARLREIPGDVASVDASGVGRIDSAG----MMQLARFARRR 71

Query: 70  KLQGVSTHI-EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLH------YHIGKKIVKFI 122
           +L   + H  E    L+     + + + +P+R   Y     L       + +G+ IV+  
Sbjct: 72  ELADDALHFSESHLPLVQLI--EDVPDDRPRRKRDYGFAAALERLGRATHTVGRNIVE-- 127

Query: 123 NDSCSQAHILGLVISN-TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                   +LG    N            +  L + +  M  VG+  +P+V L+S++ GAV
Sbjct: 128 --------LLGFTGENLVKLLRLLRQPRRFRLTATVSHMEQVGLDALPLVALLSYLVGAV 179

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IA  G+  L+ FGAEIF ++L+SI  LRE  VLLTA+++AGR+ SA  A+IGSMK  EEI
Sbjct: 180 IAFLGSTILADFGAEIFVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGSMKAREEI 239

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DAIRT+GLD + +L+ PR+ AL++ LPLLT +A  + + G   V     +IP  ++ +R 
Sbjct: 240 DAIRTLGLDPIELLVIPRLVALLVMLPLLTFVAMMAGLAGGVTVGAFDLEIPPQMYLARM 299

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             T  + +   G+ KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID
Sbjct: 300 EETMQVRHFLVGMSKAPVFAMVIGLIGCLEGMRVQGSAQSVGERTTSSVVQTISLVIIID 359

Query: 362 SLFAIFYFAIG 372
           +L A+++  +G
Sbjct: 360 ALAALWFMNMG 370


>gi|71274907|ref|ZP_00651195.1| Protein of unknown function DUF140 [Xylella fastidiosa Dixon]
 gi|71898795|ref|ZP_00680963.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|71901849|ref|ZP_00683912.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|170729829|ref|YP_001775262.1| ABC transporter permease [Xylella fastidiosa M12]
 gi|71164639|gb|EAO14353.1| Protein of unknown function DUF140 [Xylella fastidiosa Dixon]
 gi|71728377|gb|EAO30545.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|71731381|gb|EAO33444.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|167964622|gb|ACA11632.1| ABC transporter permease [Xylella fastidiosa M12]
          Length = 372

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 205/363 (56%), Gaps = 15/363 (4%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
            +G+W    +   A +++ + + SIQ     ++   I ++D+ GA  ++ F  +    +K
Sbjct: 23  LSGSWVLANVLT-ASELLQSYSNSIQH----INARNIDQLDSAGALQLLRFATRT--GLK 75

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF-FYNSFKNLHYHIGKKIVKFINDSCSQA 129
            + +    E+   LIS       ++ KP+R + F  + + L   +  K  + I D CS  
Sbjct: 76  NEAIEFR-EEHRPLISTIEILDDEHPKPERDYGFLAALERLGIAV-VKTRRNIIDVCS-- 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             LG  +    +      +F+  + S +  M  VG+  VP+V+++S++ GAVIA  G+  
Sbjct: 132 -FLGENLVKIAQLAREPRRFR--ITSTVHHMEQVGLDAVPLVVVLSYLVGAVIAFLGSTI 188

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L  FGAEIF ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI+T+GL
Sbjct: 189 LRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAIQTLGL 248

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           D + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ SR H T    +
Sbjct: 249 DPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHETMQFRH 308

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              G+ KAP  A  IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L A+++ 
Sbjct: 309 FIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALAALWFM 368

Query: 370 AIG 372
            +G
Sbjct: 369 RMG 371


>gi|114798707|ref|YP_761599.1| hypothetical protein HNE_2921 [Hyphomonas neptunium ATCC 15444]
 gi|114738881|gb|ABI77006.1| putative membrane protein [Hyphomonas neptunium ATCC 15444]
          Length = 375

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 113/372 (30%), Positives = 197/372 (52%), Gaps = 10/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S+ G  V R  G+W    I+++ D  + A+++S+      +D+S +  +DT GA LI   
Sbjct: 14  SDEG-NVLRLGGDWTVATINQL-DAQLRAVSQSV---PICLDVSGLGRLDTSGAYLIDRT 68

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +       + V  H     SL+   H        P ++        +    GK  V F
Sbjct: 69  WRENGAAWPPRIVGDHASAA-SLLEQVHAHAEPVPPPAKA--DAGLLAMLERTGKGSVDF 125

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             ++ +    LG  +          +K +    S++  M   G++ +P++  +SF  G V
Sbjct: 126 YKETTASLAFLGETLVTIVRLLVQPWKLR--WTSIVAVMEEAGLNAMPIIAFLSFFVGMV 183

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA  L  F  EI++I+L+    LRE GV+LT +++AGR+ S+  A+IG+MK+ +E+
Sbjct: 184 VAFIGATTLKDFDLEIYTIELIGFSMLREFGVVLTGIVLAGRTNSSFTAQIGTMKMRQEV 243

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++T+GL  + +L++PR+ A+++  P+LT +A  + + G + V W   DI  AVF  R 
Sbjct: 244 DAMQTLGLKPMDVLVAPRVLAMLVMTPILTFVATLAGVAGGATVAWAALDINPAVFVERM 303

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            ++  +   + G+ K+P     + ++A ++G  VG    SLGK  TT VVQ+I  +I+ID
Sbjct: 304 RNSVPIDQFWIGMSKSPVFGLVVALIACRQGLQVGGSVQSLGKATTTSVVQAIFAIIVID 363

Query: 362 SLFAIFYFAIGI 373
           ++FAIFY  +G+
Sbjct: 364 AIFAIFYMELGL 375


>gi|15837904|ref|NP_298592.1| hypothetical protein XF1303 [Xylella fastidiosa 9a5c]
 gi|9106294|gb|AAF84112.1|AE003963_9 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 396

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 200/363 (55%), Gaps = 15/363 (4%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
            +G+W    +   A +++ + + SIQ     ++   I ++D+ GA  ++ F  +   K  
Sbjct: 47  LSGSWVLANVLT-ASELLQSYSNSIQH----INARNIDQLDSAGALQLLRFATRTGLKND 101

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF-FYNSFKNLHYHIGKKIVKFINDSCSQA 129
             G       L S I     +     KP+R + F  + + L   +  K  + I D CS  
Sbjct: 102 AIGFREEHRPLISTIEILDDEY---PKPERDYGFLAALERLGIAV-VKTRRNIVDVCS-- 155

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             LG  +    +      +F+  + S +  M  VG+  VP+V+++S++ GAVIA  G+  
Sbjct: 156 -FLGENLVKIAQLAREPRRFR--ITSTVHHMEQVGLDAVPLVVVLSYLVGAVIAFLGSTI 212

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L  FGAEIF ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI+T+GL
Sbjct: 213 LRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAIQTLGL 272

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           D + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ SR H T    +
Sbjct: 273 DPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHETMQFRH 332

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              G+ KAP  A  IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L A+++ 
Sbjct: 333 FIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALAALWFM 392

Query: 370 AIG 372
            +G
Sbjct: 393 RMG 395


>gi|307297001|ref|ZP_07576817.1| protein of unknown function DUF140 [Sphingobium chlorophenolicum
           L-1]
 gi|306877527|gb|EFN08755.1| protein of unknown function DUF140 [Sphingobium chlorophenolicum
           L-1]
          Length = 376

 Score =  189 bits (481), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 199/370 (53%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G TV R +GN     + ++ + +      +I+     +DLS +  +DTIGA ++   +
Sbjct: 19  REGRTVIRLSGNLSIACLHDLPNRL-----DAIEGPVDTIDLSGVDHMDTIGAWVLHRTI 73

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   KI   G     E+L + +         N +P        ++ +   IG+ +V   
Sbjct: 74  KRLDCKIT--GDKCDAERLITTVGSVDEPV--NIRPDHE---PPWQRVVGQIGEAVVNSG 126

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                     G  +  T        +F+  + +++++   VGVS + ++ L+SF+ G VI
Sbjct: 127 TTLLGLLGFFGGTLVATWNVIRHPGRFR--INAVVQRFEVVGVSALGIIGLMSFLIGIVI 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+D
Sbjct: 185 AQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVD 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PR  A+++ +PLL+  A+  AIIG   +     DIP   F  R  
Sbjct: 245 AMRTIGVSPMEALVLPRTLAVVVMMPLLSFYASIVAIIGGGFLCAVSLDIPPITFVQRLR 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+I +VI++D+
Sbjct: 305 EVVPIHDLWVGLIKAPVFGVIIALAGCFQGMQVKANAEEVGLRTTAAVVQAIFLVIVLDA 364

Query: 363 LFAIFYFAIG 372
            FA+F+  +G
Sbjct: 365 FFAVFFTWVG 374


>gi|82702739|ref|YP_412305.1| hypothetical protein Nmul_A1612 [Nitrosospira multiformis ATCC
           25196]
 gi|82410804|gb|ABB74913.1| Protein of unknown function DUF140 [Nitrosospira multiformis ATCC
           25196]
          Length = 384

 Score =  189 bits (480), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 117/365 (32%), Positives = 198/365 (54%), Gaps = 11/365 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKS--IQSDSAIVDLSAITEIDTIGAELIMYFM-EKYHGKI 69
           GNW     + + + + +  ++S  + +    VDL  +  +DT GA  +   +  +  G++
Sbjct: 25  GNWTLENYAALGEQIALLRHRSRGLAAAGRNVDLGGLAALDTAGAARLYELLGAELAGEL 84

Query: 70  KL-QGVSTHIEQLFSLISFTHRKKIK-NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                +S     L  +++       K +Q+ QR  F   F     H G  +  F     +
Sbjct: 85  AASDALSRERSALLLMVAKAMEAAGKVSQRRQRGAFIEIFG----HAGVALEIFRQQILA 140

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +G  +           +++  L S++ Q++  G++ VP++ L++F+ GAVIA  GA
Sbjct: 141 LLGFMGFTLDALARGLLHPKRWR--LTSIVAQIHETGLNAVPIIALLNFMVGAVIAFLGA 198

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L+ FGA I++++L++   LRE+GVLLTA+++AGR+ S   A++GSMKINEEIDA R +
Sbjct: 199 TVLANFGASIYTVNLVTFAFLRELGVLLTAILMAGRTASTFTAQLGSMKINEEIDATRVL 258

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL+ V +L+ PR+ AL +SLP+LT +   S I+G ++V     DI  A+F + F     L
Sbjct: 259 GLNPVNLLVLPRVLALFVSLPILTFVGMISGILGGALVCALQLDISLAMFLTIFQDQIEL 318

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   G+ KAP  A  IG++   EG  V   + S+G+  T  VV SI +VI +D++ A+F
Sbjct: 319 RHFLVGMSKAPVFAFVIGVIGCLEGLKVSGSALSVGQHTTASVVHSIFVVIFLDAMAALF 378

Query: 368 YFAIG 372
           +  +G
Sbjct: 379 FMEMG 383


>gi|194364302|ref|YP_002026912.1| hypothetical protein Smal_0524 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347106|gb|ACF50229.1| protein of unknown function DUF140 [Stenotrophomonas maltophilia
           R551-3]
          Length = 373

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 122/366 (33%), Positives = 202/366 (55%), Gaps = 21/366 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH- 66
           + R +G W + + +  A +V+  +  ++      +D + I ++D+ G   ++    +   
Sbjct: 21  LIRLSGTW-TLKTALAAAEVLRDVPDTLTG----IDATGIEKMDSAGVLQVLRVAHRADL 75

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF-FYNSFKNL--HYHIGKKIVKFIN 123
           G+  LQ    H     +L+           KP+R F    + + L    H     +K + 
Sbjct: 76  GEDALQFRPDH----QALVCTIEEVADDRPKPKRDFGVLAALERLGVSVHATGHNIKAL- 130

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
             CS    LG  +           +F+  L + + QM  VG+  VP+V L+S++ GAVIA
Sbjct: 131 --CS---FLGENLVKAARLVKEPRRFR--LTATVHQMEQVGLDAVPLVALLSYLVGAVIA 183

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G+  L  FGAEI+ ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDA
Sbjct: 184 FLGSTILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDA 243

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+GLD + +L+ PR++AL+++LPLLT +A  + + G   V     DIP  ++ +R H 
Sbjct: 244 MRTLGLDPIDLLVLPRLFALLVTLPLLTFIAMVAGLAGGITVGAFDLDIPPQMYIARMHD 303

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           T  + ++  GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+ 
Sbjct: 304 TMEVRHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQSVGERTTSSVVQTISLVIIIDAF 363

Query: 364 FAIFYF 369
            A+++ 
Sbjct: 364 AALWFM 369


>gi|237808113|ref|YP_002892553.1| hypothetical protein Tola_1352 [Tolumonas auensis DSM 9187]
 gi|237500374|gb|ACQ92967.1| protein of unknown function DUF140 [Tolumonas auensis DSM 9187]
          Length = 381

 Score =  188 bits (478), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 117/377 (31%), Positives = 210/377 (55%), Gaps = 24/377 (6%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIV--DLSAITEIDTIGAELIMY 60
           E+G  + R +G+W       +   +  ++ + + +D+ I+  DL ++   DT GA L++ 
Sbjct: 15  ESGHVLLRISGDWTLTHYVMLKRQIT-SVQEQMIADTPILWDDLGSL---DTAGAALLVE 70

Query: 61  FMEKYHGKIKLQGVSTH--------IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHY 112
            +    G+++L  ++T         +  L S+ +         ++P+ S    +   +  
Sbjct: 71  LL----GQVRLSLLTTQDSGLSAERLALLHSVAAALKESTNIEKQPKES----AISEMLA 122

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVI 172
           HIG+ ++       +    +GL I           +++  + SL   +   G++ +P++ 
Sbjct: 123 HIGQVVIHLGQQQIALLGFIGLTIETLVRSLIHPRRWR--ITSLAAHIEQTGLNAIPIIA 180

Query: 173 LISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEI 232
           L++F+ GAV+A  G   LS FGA I+++DL++   LRE GVLLTA+++AGR+ SA  A+I
Sbjct: 181 LLTFLVGAVVAFLGTTVLSDFGASIYTVDLVAFAFLREFGVLLTAILMAGRTASAFTAQI 240

Query: 233 GSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDI 292
           GSMK NEEIDAIR +GL+ + +L+ PR+ A++ISLP+LT +A    +IG ++V +   DI
Sbjct: 241 GSMKANEEIDAIRALGLNPIELLVLPRVLAMLISLPILTFIAMACGMIGGAVVCFLELDI 300

Query: 293 PFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQ 352
              +F +       +++ F G+ KAP  A  + ++   EGF VG  + S+G+   + VVQ
Sbjct: 301 TPRLFLTILQRDIDISHFFVGIGKAPLFAFIVAVIGCLEGFKVGGSAQSVGEHTISSVVQ 360

Query: 353 SISIVIIIDSLFAIFYF 369
           SI +VI++D+L A+F+ 
Sbjct: 361 SIFMVILLDALAALFFM 377


>gi|153951693|ref|YP_001398923.1| ABC transporter permease [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152939139|gb|ABS43880.1| putative ABC transporter, permease protein [Campylobacter jejuni
           subsp. doylei 269.97]
          Length = 369

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 126/379 (33%), Positives = 197/379 (51%), Gaps = 24/379 (6%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   + EIDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKEIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKDKNIKITKEGLNSRFQTLFELCEKNYQRLNKTKKSHKNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K + KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILRKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
           A F  RF     + +IF GL+KAP     IG++A   GF V   + S+G   T  VV +I
Sbjct: 291 AEFLRRFREAVDIKHIFIGLVKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAI 350

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++   + GI
Sbjct: 351 FWVIAFDALFSVILTSAGI 369


>gi|296284592|ref|ZP_06862590.1| putative ABC transport system permease protein [Citromicrobium
           bathyomarinum JL354]
          Length = 370

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 198/371 (53%), Gaps = 14/371 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            + G TV R  G +    I+ +   +     + +  D  ++DL+ ++EIDT+GA      
Sbjct: 12  GDGGRTVLRLKGPYLLSTIANVDRGL-----RKLDDDIDVIDLAEVSEIDTVGAWFACTL 66

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              +   I  +  S   ++L + +  +         P+      + + +    G+K+ + 
Sbjct: 67  ARNHSASI--ENASERADRLLTAVGESANSS-DVSAPRLPLLTRAPEAM----GEKVFEA 119

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                S     G +++          +F+    +++ Q   VGV+ +P++ L+SF+ G V
Sbjct: 120 GRGIVSVVGFFGQILAGAASLIRHPRRFR--HRAMVHQFESVGVNALPIIGLMSFLIGIV 177

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGA QL  FGAE  +++L+  + LRE+GVL+TA+M+AGRSGSA  A+IG+MK+ EEI
Sbjct: 178 IAQQGAVQLQAFGAEALTVNLVGRITLRELGVLMTAIMVAGRSGSAFAAQIGTMKLTEEI 237

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+RT+G+  V +L+ PR+ A +  + LL   A+  AIIG ++V      IPF  F  R 
Sbjct: 238 DAMRTIGISPVEVLVIPRLVACVFMMILLGFYASCMAIIGGAVVSDVMLGIPFWTFLMRI 297

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H      +++ G+IKAP     +G+    +G  V  +S  +G + T  VVQ+I  VI++D
Sbjct: 298 HEVVPAHDVWVGMIKAPVFGLIVGMSGCYQGMQVRGNSEEVGLRTTKAVVQAIFTVIVLD 357

Query: 362 SLFAIFYFAIG 372
           + FA+F+  IG
Sbjct: 358 AFFAVFFTGIG 368


>gi|326388333|ref|ZP_08209929.1| hypothetical protein Y88_3216 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207065|gb|EGD57886.1| hypothetical protein Y88_3216 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 370

 Score =  187 bits (474), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 183/340 (53%), Gaps = 8/340 (2%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           + I++  A +DL+ +  +DT+GA            +I       H  +    +     K 
Sbjct: 37  REIETPIARIDLADVPMMDTVGAWTCWRLSRDTGAEI------VHPCEAAERLIGALEKV 90

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF 152
               +P ++     +  +   +G  +      +       G ++  T        +F+  
Sbjct: 91  DDGGEPTQAGGLPVWLRVPAKVGDTVFGLAAGAVEVLGFFGQMLLATWGLLRHPGRFR-- 148

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             +L+ QM  VGV+ + +V L+SF+ G VIAQQGA QL QFGAE+++++L+  L LRE+G
Sbjct: 149 FNALVHQMELVGVNALAIVGLMSFLVGIVIAQQGAVQLRQFGAEVYTVNLVGRLTLRELG 208

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           +L+TA+M+AGRSGSA  A++G+MK+NEEIDA+RT+G+  +  L+ PRI A ++ LP+L +
Sbjct: 209 ILMTAIMVAGRSGSAFAAQLGTMKLNEEIDAMRTIGVSPMEALVLPRILATVLMLPVLGV 268

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
            +    IIG + +     DIPF  F +R      + +++ GL K P     + +    +G
Sbjct: 269 YSAVVGIIGGAFLSSLTLDIPFFSFLARIREVVPVHDVWVGLFKGPVFGLIVSVAGCYQG 328

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             V  ++  +G + T+ VV +I  VI++D+ FA+F+  +G
Sbjct: 329 MQVKANAEEVGLRTTSAVVMAIFTVIVLDAFFAVFFTEVG 368


>gi|300312192|ref|YP_003776284.1| organic solvents resistance ABC transporter permease
           [Herbaspirillum seropedicae SmR1]
 gi|300074977|gb|ADJ64376.1| ABC-type transport system involved in resistance to organic
           solvents, permease component protein [Herbaspirillum
           seropedicae SmR1]
          Length = 380

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 110/369 (29%), Positives = 200/369 (54%), Gaps = 12/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V    G+W       ++  +  A  +    +  +++ SA++  DT+GA+L++  +     
Sbjct: 19  VLHVEGDWTLRNYRALSRQIAQA--RPALGEQTVLEFSALSAFDTVGAKLLVDLLGVPAA 76

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKI----KNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
             + Q  ST      +L++     K     K   P++++  +  +     +G   +    
Sbjct: 77  LRQTQADSTLAPAWRALLAVVAEAKAIAMPKPAPPRQAWITDMLE----RVGAATLSLRA 132

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
            +      +GL +           +++  + +++ Q+   G+  VP+V L++F+ GAV+A
Sbjct: 133 CALGLLGFMGLCLQTLLSSFWRPSRWR--VTAVVAQIEQTGLDAVPIVSLLTFMVGAVVA 190

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA  L+ FGA I+++DL++   LRE  VLLTA+++AGR+ S+  A+IGSMK NEEIDA
Sbjct: 191 FLGATVLANFGASIYTVDLVAFSFLREFAVLLTAILMAGRTASSFTAQIGSMKANEEIDA 250

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           IR +GLD +++L+ PR+ AL++++P LT +A  S + G ++V     DI   +F S    
Sbjct: 251 IRALGLDPIKLLVLPRLIALLVAMPALTFIAMLSGLFGGAMVCALSLDISPTMFLSLLQQ 310

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +   G++KAP  A  + ++   EGF V   + S+G+  T+ VVQSI +VI++D+L
Sbjct: 311 DVGIRHFILGMVKAPLFAFVVAVIGCNEGFKVSGSAQSVGQHTTSSVVQSIFVVILLDAL 370

Query: 364 FAIFYFAIG 372
            A+F+  +G
Sbjct: 371 AALFFMEMG 379


>gi|83858858|ref|ZP_00952380.1| ABC transporter, permease protein, putative [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853681|gb|EAP91533.1| ABC transporter, permease protein, putative [Oceanicaulis
           alexandrii HTCC2633]
          Length = 384

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 120/367 (32%), Positives = 182/367 (49%), Gaps = 17/367 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G+W    +    D  +  I         ++DLS +  IDT GA    Y + +   + +  
Sbjct: 29  GDWLMEAVGRF-DRRLRRIESETDPKDLVIDLSGLGRIDTAGA----YVLGRTLSRCREP 83

Query: 73  GVSTHIEQLFSLISFTHRKKIKN--QK----PQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
               H    F     T R+ +    Q+    P+         +    IG+ +   + ++ 
Sbjct: 84  DADRH----FIGEHQTARRMMGEMLQRLADCPEDEIQPRGVISTLARIGQGVEDGLKETV 139

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                 G   +       +  K +    S I  M   GV  +P++ ++SF  GAV+A  G
Sbjct: 140 ESFAFFGRTFTTGLSVLVNPTKMR--WTSTIHLMETAGVDALPIISVLSFFIGAVVAFMG 197

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L  FGA +F++DL+ I  LRE GV++TA+++AGRS SA  A IGSMK+ +EIDA++ 
Sbjct: 198 ASLLETFGASVFTVDLVGIAVLREFGVIITAILLAGRSDSAFTAAIGSMKMQQEIDAMKV 257

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MGLD   +L+ PR+ A ++  PLLT+ A  + + G  +V W   DI    F +R + T  
Sbjct: 258 MGLDPYEVLVLPRVIACVVMAPLLTLSAMVAGVFGGMLVSWMTLDISPNFFLTRLNDTID 317

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L +   G+ KAP     I IV  + G  VG    SLGK+VTT VVQ+I  VI+ID+LFA+
Sbjct: 318 LKHFLVGMSKAPVFGLVIAIVGCRHGLQVGGDVESLGKRVTTSVVQAIFAVIVIDALFAM 377

Query: 367 FYFAIGI 373
            Y  + I
Sbjct: 378 MYLELDI 384


>gi|329851286|ref|ZP_08266043.1| hypothetical protein ABI_41270 [Asticcacaulis biprosthecum C19]
 gi|328840132|gb|EGF89704.1| hypothetical protein ABI_41270 [Asticcacaulis biprosthecum C19]
          Length = 363

 Score =  186 bits (473), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 123/370 (33%), Positives = 195/370 (52%), Gaps = 21/370 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + R  GNW    I  +++ +  A+ KS Q  +  VD S I  +DT GA    Y +    G
Sbjct: 1   MLRPKGNWIVTRIEGLSERLRQAL-KSYQQIT--VDGSQIEALDTAGA----YLLRTAVG 53

Query: 68  KIKLQGV----STHIEQLFSLISFTHRKKI-----KNQKPQRSFFYNSFKNLHYHIGKKI 118
             +LQG       +  +L+ ++   H   I     +N +P + + +  +  L   +GK  
Sbjct: 54  D-RLQGEVFAGQDNFARLYGIVG-NHAAPISNYAQENPEPPKMWLHPFYFGL-VKLGKLA 110

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
            +F     +QA  +G +I+      A     +    +L+  M   G+  +P+V++ SF  
Sbjct: 111 ERFKTGFIAQAVFMGHIIAQLMISIAKPGSMR--WAALVNVMQRAGIEAIPIVLMTSFFI 168

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GAV+   G  QL+QFG+ IF++D++++  LRE   L+TAV++AGRS SA  AE+G+MK+N
Sbjct: 169 GAVLGFIGVLQLNQFGSGIFAVDMVAMFALREFAPLVTAVLLAGRSASAFAAEVGAMKMN 228

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           +EIDA+R MG+D    LI PR+  L++    +T L+    + G  + IW       +VF 
Sbjct: 229 QEIDAMRVMGIDPYEALILPRLIGLVLMSTFITFLSTLGMMFGGMLAIWSALGAGPSVFL 288

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R        N F G+++ PF A  I IV   +G  V     SLG++VTT VVQSI +V 
Sbjct: 289 QRVQDYVPFYNFFVGIVRPPFFAATIAIVGCWQGMQVKDDVLSLGRQVTTAVVQSIFLVF 348

Query: 359 IIDSLFAIFY 368
           ++D+LFAI +
Sbjct: 349 MLDALFAILF 358


>gi|294010007|ref|YP_003543467.1| ABC-type transport system permease component LinK [Sphingobium
           japonicum UT26S]
 gi|292673337|dbj|BAI94855.1| ABC-type transport system permease component LinK [Sphingobium
           japonicum UT26S]
          Length = 376

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 116/370 (31%), Positives = 197/370 (53%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G TV R +GN     + ++ D +      +I+     +DLS +  +DTIGA ++   +
Sbjct: 19  REGRTVIRLSGNLSIACLHDLPDRL-----DAIEGPVDTIDLSDVGHMDTIGAWVLHRAI 73

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I   G     E+L + +         N +P        ++ +   IG+ +V   
Sbjct: 74  KRLDCGIT--GDKCDAERLIATVGSVDEPV--NIRPDHE---PPWQRVVGQIGEAVVNSG 126

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                     G  +  T        +F+  + +++++   VGVS + ++ L+SF+ G VI
Sbjct: 127 TTLLGLLGFFGGTLVATWNVIRHPGRFR--INAVVQRFEVVGVSALGIIGLMSFLIGIVI 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+D
Sbjct: 185 AQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVD 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PR  A+++ +PLL   ++  AIIG   +     DIP   F  R  
Sbjct: 245 AMRTIGVSPMEALVLPRTLAVVVMMPLLGFYSSIVAIIGGGFLCAVSLDIPPITFVQRLR 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+I +VI+ID+
Sbjct: 305 EVVPIHDLWVGLIKAPVFGVIIALAGCFQGMQVKANAEEVGLRTTAAVVQAIFLVIVIDA 364

Query: 363 LFAIFYFAIG 372
            FA+F+  +G
Sbjct: 365 FFAVFFTWVG 374


>gi|332187454|ref|ZP_08389192.1| hypothetical protein SUS17_2546 [Sphingomonas sp. S17]
 gi|332012615|gb|EGI54682.1| hypothetical protein SUS17_2546 [Sphingomonas sp. S17]
          Length = 368

 Score =  186 bits (472), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 116/366 (31%), Positives = 191/366 (52%), Gaps = 18/366 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            RF GN     + ++ + +      S+Q     +DLS +  IDT+GA L+  F  +    
Sbjct: 17  LRFTGNLSLATLGDLPERLDRE-EASVQR----IDLSQVDRIDTVGAWLVHRFAARNDAA 71

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKP--QRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           I  +G+  +   L         K ++  +P   R    + F  +   +G  ++       
Sbjct: 72  I--EGLDENQRNLVD-------KVVEADQPVAMRPQPISPFARVAGEVGDAVITAFKTLY 122

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                +G  +           +F+    +++ +   VGVS + ++ L+SF+ G VIAQQG
Sbjct: 123 GLLGFMGATVIAGFAVLRHPRRFR--FNAVVHEFETVGVSALAIIGLMSFLIGIVIAQQG 180

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL QFGAE+F+I+L+  L LRE+GVL+TA+M+AGRSGSA  A++G+MK+ EEIDA+R 
Sbjct: 181 AVQLRQFGAEVFTINLVGRLTLRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEIDAMRV 240

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +G+  +  L+ PR  A +  +PLL   ++  A+IG   +      IP   F +R      
Sbjct: 241 IGVSPMEALVLPRTIAAVTLMPLLGFYSSLIAMIGGCFLAAVSLGIPPVTFIARIREVVP 300

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +++ GLIKAP     I I    +G  V   +  +G + T  VVQ+I +VI++D+ FA+
Sbjct: 301 ITDLYVGLIKAPVFGAIIAIAGCFQGMQVKSDAEQVGLRTTAAVVQAIFLVIVLDAFFAV 360

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 361 FFTWLG 366


>gi|283957032|ref|ZP_06374504.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 1336]
 gi|283791533|gb|EFC30330.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 1336]
          Length = 369

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 125/379 (32%), Positives = 196/379 (51%), Gaps = 24/379 (6%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   +  IDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKDKNIKITKEGLNSRFQTLFELCEKNYQRLSKTKKSHKNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K + KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILRKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
           A F  RF     + +IF GL+KAP     IG++A   GF V   + S+G   T  VV +I
Sbjct: 291 AEFLRRFREAVDIKHIFIGLVKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAI 350

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++   + GI
Sbjct: 351 FWVIAFDALFSVILTSAGI 369


>gi|260425314|ref|ZP_05779294.1| ABC transporter, inner membrane subunit [Citreicella sp. SE45]
 gi|260423254|gb|EEX16504.1| ABC transporter, inner membrane subunit [Citreicella sp. SE45]
          Length = 366

 Score =  185 bits (470), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 116/334 (34%), Positives = 196/334 (58%), Gaps = 7/334 (2%)

Query: 43  DLSAITEIDTIGAELIMYFMEK--YHGK-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ 99
           DLS +  +DT GA L+          G+ I + G S     L   ++       K ++P+
Sbjct: 37  DLSGVGVLDTAGAWLLASCRNAAALRGETIAVIGASPAQTLLLETVTDAMADAAKVRQPR 96

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
               +++  +    +G+ + K ++        LGLV++  G       + +  L +L+  
Sbjct: 97  G--LHHAMGDGLVGLGEAVSKKVSSIAESLGFLGLVMAQFGWTVLHPSRLR--LTALVHH 152

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           M+  G++ VP+V+L+ F+ G V++ QGA QL QFGAE++ +DL++I  LRE+G+LLTAV+
Sbjct: 153 MHLAGLNAVPIVVLMGFLIGIVLSFQGASQLKQFGAEVYVVDLIAISILRELGILLTAVI 212

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           +AGRS SA  A IGSMK+ EEIDA+R +GLD + +L+ PR+ AL+I LPLL  +A+ + +
Sbjct: 213 VAGRSASAFTATIGSMKMREEIDAMRVLGLDPIELLVLPRVLALVILLPLLGFIADMAGL 272

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           +G +++ W    I   +F ++  +   ++++  GL KAP  A  IG+V   +G  V   +
Sbjct: 273 VGGALMAWIELGISPGMFRTQLLNNTDVSHLLIGLAKAPVFAVIIGVVGCHQGMQVKGDT 332

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            SLG + +  VV +I +VI++D++F+IF+   GI
Sbjct: 333 ESLGNRTSRSVVAAIFLVIVVDAMFSIFFAVWGI 366


>gi|238784662|ref|ZP_04628667.1| ABC transporter, permease protein [Yersinia bercovieri ATCC 43970]
 gi|238714434|gb|EEQ06441.1| ABC transporter, permease protein [Yersinia bercovieri ATCC 43970]
          Length = 381

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 124/370 (33%), Positives = 202/370 (54%), Gaps = 24/370 (6%)

Query: 13  GNW-------KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
           G+W         PE++++  ++  A+         + DLS +  +DT GA L++  + + 
Sbjct: 25  GDWVLAHYRALEPEVTQLRANLPAAV---------VFDLSQLGALDTAGATLLVLLLGEE 75

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSF-KNLHYHIGKKIVKFIND 124
             K +L+ ++  +     ++  T    + +  P+ +     F   L  +IG+ +     D
Sbjct: 76  RVK-QLRKLAPTLPDERRVLLETVSHVLPDLTPEPATKAPPFWLELLSNIGRSMDNLWQD 134

Query: 125 SCSQAHILGLVISN--TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             S    +GL +    +  F  S ++      SLI  +  +G++ VP+++L++F+ GAVI
Sbjct: 135 IKSLLGFVGLTLEALLSTIFRPSRWRMT----SLIANIQQIGLNAVPIIMLLTFLVGAVI 190

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEID
Sbjct: 191 AFLGATVLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEID 250

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           AI+T+GL+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   
Sbjct: 251 AIQTLGLNPVELLVLPRVLALLISLPMLTFIGMICGIFGGMVVCALTLDISPTMFLSIMQ 310

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           ++  L +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D+
Sbjct: 311 NSNGLQHFLVGISKAPVFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDA 370

Query: 363 LFAIFYFAIG 372
           + A+F+  +G
Sbjct: 371 VAALFFMEMG 380


>gi|57238657|ref|YP_179788.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           RM1221]
 gi|57167461|gb|AAW36240.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           RM1221]
 gi|315059096|gb|ADT73425.1| Putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 369

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 126/379 (33%), Positives = 195/379 (51%), Gaps = 24/379 (6%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   +  IDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKDKNIKITKEGLNSRFQTLFELCEKNYQRLSKTKKSHKNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K + KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILRKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      +I PR+ ALI+++PL+  +++  +IIG  +V     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIIIPRVMALIVAMPLIVAISDAISIIGGMMVAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
           A F  RF     + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I
Sbjct: 291 AEFLRRFREAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAI 350

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++   + GI
Sbjct: 351 FWVIAFDALFSVVLTSAGI 369


>gi|261885878|ref|ZP_06009917.1| MTA/SAH nucleosidase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 354

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 114/337 (33%), Positives = 186/337 (55%), Gaps = 19/337 (5%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           +S++ D+  +DL  +  ID   A     F  K++   KL   +   +++F+L+S  +   
Sbjct: 32  RSLKVDT--LDLKNLIRIDYSAAT----FFAKHYNCPKLINSNDKFDKIFALVSDKYILN 85

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSY--KFK 150
           ++  K ++S       NL   IGK I+   N+  S    LG  + N  +   + +  +FK
Sbjct: 86  LQIIKFKKS-------NLIEQIGKNIINLKNELVSFCIFLGEFLFNLTKSLLNPFTVRFK 138

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
                L    Y  G+S V +V L SF+ G V+A QGA  L  FGA I+ +D+M I+ LRE
Sbjct: 139 ----ELSNHFYSAGISAVFIVCLTSFLIGIVLAYQGATMLENFGASIYVVDIMGIMTLRE 194

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G L+ A+++AGRS S+  A+IG MKI +E++A++TMG +  R ++ PR+ ALI+++P +
Sbjct: 195 VGPLIAAIVVAGRSASSYTAQIGVMKITDELEAMKTMGFEPFRFIVMPRVLALILAMPFI 254

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
             LAN  +I G  +V   Y D+ F+ +  RF S+  L + + GL KAPF    I ++  K
Sbjct: 255 VFLANAVSIFGQMMVCNWYLDLSFSDYLERFRSSIALRHFWVGLFKAPFFGAVIALIGCK 314

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            GF V    NS+G+  T  VV  I  +  +D++F ++
Sbjct: 315 RGFEVSGSINSVGELTTRSVVHEIFWISALDAIFLLY 351


>gi|157415866|ref|YP_001483122.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|157386830|gb|ABV53145.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|307748503|gb|ADN91773.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni M1]
 gi|315931385|gb|EFV10354.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           327]
          Length = 369

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 124/372 (33%), Positives = 195/372 (52%), Gaps = 18/372 (4%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---ME 63
           T+F F G W    I ++     +A+   IQS   I D   +  IDT G    +     ++
Sbjct: 11  TLFIF-GIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLK 66

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHIGKKIVKF 121
             + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   + K ++KF
Sbjct: 67  DKNIKITKEGLNSRFQTLFELCEKNYQRLSKTKKSHKNFSEYFIDLGKLSLELLKILIKF 126

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            N + +    L L + N   F     +F  FL  +    +      +P+VIL + + G V
Sbjct: 127 TNFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILTALLVGVV 177

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI
Sbjct: 178 LAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEI 237

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
            A+ TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF
Sbjct: 238 AAMNTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRF 297

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D
Sbjct: 298 REAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFD 357

Query: 362 SLFAIFYFAIGI 373
           +LF++   + GI
Sbjct: 358 ALFSVVLTSAGI 369


>gi|94496554|ref|ZP_01303130.1| hypothetical protein SKA58_17657 [Sphingomonas sp. SKA58]
 gi|94423914|gb|EAT08939.1| hypothetical protein SKA58_17657 [Sphingomonas sp. SKA58]
          Length = 369

 Score =  183 bits (465), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/379 (31%), Positives = 200/379 (52%), Gaps = 30/379 (7%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
             +G TV R +GN     + ++   +      ++Q     VD+S +  IDTIGA  +   
Sbjct: 11  QRDGGTVIRLSGNLAIACLHDLPARL-----DAVQGPINAVDVSQVDHIDTIGAWTVHSA 65

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++ +  I   G +   ++L   +         + +P +    +    +   IG  ++  
Sbjct: 66  AKRLNAPIT--GANEDAQRLIEAVGTLDEPF--SLRPDK---VSPLTRVVGQIGDAVIS- 117

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLL--------SLIRQMYYVGVSGVPVVIL 173
                +   ++GL+    G F AS     G +         +++++   VGVS + ++ L
Sbjct: 118 -----AGTTLMGLL----GFFGASLVAAWGLIRHPSRFRVNAVVQRFEVVGVSALGIIGL 168

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           +SF+ G VIAQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  A++G
Sbjct: 169 MSFLIGIVIAQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLG 228

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           +MK+ EEIDA+RT+G+  +  L+ PR  A+++ +PLL   A+  A+IG   +     DIP
Sbjct: 229 TMKLTEEIDAMRTIGVSPMEALVMPRTLAVVVMMPLLGFYASIVAVIGGGFLCAVALDIP 288

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F  R      + +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+
Sbjct: 289 PITFVQRLREVVPITDLWVGLIKAPVFGIIIALSGCYQGMQVKANAEEVGLRTTAAVVQA 348

Query: 354 ISIVIIIDSLFAIFYFAIG 372
           I +VI+ID+ FA+F+  +G
Sbjct: 349 IFLVIVIDAFFAVFFTWVG 367


>gi|86152328|ref|ZP_01070539.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 260.94]
 gi|121613751|ref|YP_001001289.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|167006183|ref|ZP_02271941.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|315125046|ref|YP_004067050.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni ICDCCJ07001]
 gi|85840817|gb|EAQ58068.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 260.94]
 gi|87249848|gb|EAQ72807.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|315018768|gb|ADT66861.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni ICDCCJ07001]
          Length = 369

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 125/372 (33%), Positives = 195/372 (52%), Gaps = 18/372 (4%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---ME 63
           T+F F G W    I ++     +A+   IQS   I D   +  IDT G    +     ++
Sbjct: 11  TLFIF-GIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLK 66

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHIGKKIVKF 121
             + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   + K + KF
Sbjct: 67  DKNIKITKEGLNSSFQTLFELCEKNYQRLSKTKKSHKNFSEYFIDLGKLSLELLKILRKF 126

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           IN + +    L L + N   F     +F  FL  +    +      +P+VIL + + G V
Sbjct: 127 INFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILTALLVGVV 177

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI
Sbjct: 178 LAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEI 237

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
            A+ TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF
Sbjct: 238 AAMNTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRF 297

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D
Sbjct: 298 REAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFD 357

Query: 362 SLFAIFYFAIGI 373
           +LF++   + GI
Sbjct: 358 ALFSVILTSAGI 369


>gi|238759499|ref|ZP_04620662.1| ABC transporter, permease protein [Yersinia aldovae ATCC 35236]
 gi|238702274|gb|EEP94828.1| ABC transporter, permease protein [Yersinia aldovae ATCC 35236]
          Length = 381

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 118/335 (35%), Positives = 187/335 (55%), Gaps = 4/335 (1%)

Query: 39  SAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           SA+ D S +  +DT GA L+   + +      L+ ++  +     ++  T  + + N  P
Sbjct: 49  SAMFDFSQLGGLDTAGATLLATLLGELRVS-NLRELAPRLPDERRVLLETVSQVLPNLVP 107

Query: 99  QRSFFYNSFK-NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           Q +     F   L   IG+ +     D  S    +GL +           +++  + SLI
Sbjct: 108 QLTVKPQPFWIGLLVPIGQSVDNLWQDFKSLLGFVGLTLEALLGTVFRPARWR--VTSLI 165

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
             +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  VLLTA
Sbjct: 166 ANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFAVLLTA 225

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT +    
Sbjct: 226 ILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTFIGMIC 285

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            I G  +V     DI   +F +   ++  L ++  G+ KAP  A  I I+   EGF V  
Sbjct: 286 GIFGGMVVCALALDISPTMFLTIMQNSNGLQHLLVGISKAPIFAFLIAIIGCLEGFKVSG 345

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 346 SAESVGMHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|197105491|ref|YP_002130868.1| ABC transporter, permease protein [Phenylobacterium zucineum HLK1]
 gi|196478911|gb|ACG78439.1| ABC transporter, permease protein [Phenylobacterium zucineum HLK1]
          Length = 375

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 109/337 (32%), Positives = 184/337 (54%), Gaps = 14/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQR 100
           +DLS +  +DT GA  ++          K++     + +L  ++    R +    Q+P+ 
Sbjct: 48  IDLSGVRRLDTAGAYAVVRAAGPAFDASKVE-ARPEVRRLLEVVDEAARIQPAVRQEPK- 105

Query: 101 SFFYNSFKNLHYHIGKKIVKFINDSCSQ----AHILGLVISNTGEFCASSYKFKGFLLSL 156
                 F +L   +GK +V F +D         H+L ++  +      +  K +    +L
Sbjct: 106 -----GFHDLTIRVGKGVVGFGHDFIDTMGFLGHLLVVLARSLVLLFVNPRKIR--WPAL 158

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +  M   G+  +PVV + +F  GAV+A  GA  L QFGAE+F+++L+ I  +RE  +++T
Sbjct: 159 VSIMERAGLDAIPVVAVATFFIGAVVAFIGADMLQQFGAEVFAVELIGISMMREFNIVIT 218

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           AV++AGRS S+  AEIGSMK+++EIDA++ MG+D    L+ PR  AL+I++PLLT +A  
Sbjct: 219 AVLLAGRSASSFAAEIGSMKMSQEIDAMKVMGIDPFEALVFPRFAALLITIPLLTFVATL 278

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           + ++G  +V W    +  A F  R      + + +  L KAP MA  I  +  ++G   G
Sbjct: 279 AGLLGGIVVTWSVLGLGPAFFLQRIVDNVGVDHFWIALSKAPVMAGVIAGIGCRQGLETG 338

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
               SLG++VT  VV +I  +I+ID++FA+ Y  +G+
Sbjct: 339 GDVESLGRRVTAAVVHAIFAIIVIDAIFAMIYMELGL 375


>gi|86149247|ref|ZP_01067478.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni CF93-6]
 gi|88596442|ref|ZP_01099679.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 84-25]
 gi|218563235|ref|YP_002345015.1| putative ABC transporter permease [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85840029|gb|EAQ57287.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni CF93-6]
 gi|88191283|gb|EAQ95255.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 84-25]
 gi|112360942|emb|CAL35743.1| putative ABC transport system permease [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926840|gb|ADC29192.1| putative ABC transport system permease [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315929480|gb|EFV08676.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 369

 Score =  183 bits (464), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 124/379 (32%), Positives = 195/379 (51%), Gaps = 24/379 (6%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   +  IDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKNKNIKITKEGLNSRFQTLFELCEKNYQRLGKTKKSHQNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K + KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILRKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      ++ PR+ AL++++PL+  +++  +IIG  +V     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIVIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
           A F  RF     + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I
Sbjct: 291 AEFLRRFREAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAI 350

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++   + GI
Sbjct: 351 FWVIAFDALFSVILTSTGI 369


>gi|295690462|ref|YP_003594155.1| hypothetical protein Cseg_3097 [Caulobacter segnis ATCC 21756]
 gi|295432365|gb|ADG11537.1| protein of unknown function DUF140 [Caulobacter segnis ATCC 21756]
          Length = 386

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 109/374 (29%), Positives = 200/374 (53%), Gaps = 15/374 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            ++G      +G+W +  + +    +  A++     D+   DL+ +   DT GA  I+  
Sbjct: 26  EQDGRPTAVLSGDWTARGLFDAGLRLAEALDGV---DNPTFDLTGVNRCDTAGAYAILRA 82

Query: 62  MEKYHGKIKLQGVSTH--IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
            ++   ++K + V     + +L  L++     ++K++   R    + F+ L   IG+ + 
Sbjct: 83  ADE---RLKPEDVKARHGVVRLLQLVAAA--IQVKSEPAVRP---SGFRALLERIGRGVF 134

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
              +D+ S    LG +++  G       + +     ++      G+  +P+V   +F  G
Sbjct: 135 GLFSDAFSTMAFLGHLLTAVGRSIVDPRRIR--WAPIVALCERAGLDAMPIVATTTFFIG 192

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A  GA  L+ FGA+++S++L+ I  +RE  +L+TA+++AGRS S+  AEIGSMK+N+
Sbjct: 193 AVVALLGANMLTDFGAQVYSVELIGISVMREFNILITAILLAGRSASSFAAEIGSMKMNQ 252

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA++ MG+D    L+ PR  AL++++P+LT +A  + + G  +V+W   D+    F  
Sbjct: 253 EIDAMQVMGVDPYEALVLPRFAALLLTIPILTFVATIAGLAGGILVVWIVLDLSPNFFLQ 312

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R        + + GL KAP MA  I  +  ++G  VG    +LG++VT  VV +I  +I+
Sbjct: 313 RIVDYVGPTHFWIGLSKAPVMAAVIAAIGCRQGMEVGQDVEALGRRVTAAVVHAIFAIIL 372

Query: 360 IDSLFAIFYFAIGI 373
           ID++FA+ Y  + I
Sbjct: 373 IDAVFALIYMELDI 386


>gi|120554124|ref|YP_958475.1| hypothetical protein Maqu_1197 [Marinobacter aquaeolei VT8]
 gi|120323973|gb|ABM18288.1| protein of unknown function DUF140 [Marinobacter aquaeolei VT8]
          Length = 382

 Score =  182 bits (462), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 118/371 (31%), Positives = 193/371 (52%), Gaps = 8/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +E G    +F+G+W     S +         ++   +    D S +  +DT GA L++  
Sbjct: 19  AEFGGHTLKFSGDWTLSHYSVLNRQTTALKPRAAACNP---DFSGLGRLDTAGASLMVKL 75

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           +        LQ      EQ  +LI      +  NQ        N        IGKK+   
Sbjct: 76  LGSDALISALQRAELPDEQR-ALIQAV--AEAMNQPSAAVATVNPVVAFLAEIGKKVTTL 132

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                  A  +G  +           +++  +   +  ++  G++ +P+V L++F+ GAV
Sbjct: 133 GQLVWLLAGFIGQTLGTLFYILPRPTRWR--ITPFVAALHDTGLNALPIVALLTFLVGAV 190

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA  L  FGA I+++DL++   LRE GVLL A+++AGR+ SA  A+IG+MK+NEE+
Sbjct: 191 VAFLGATVLEDFGATIYTVDLVAFSFLREFGVLLAAILLAGRTASAFTAQIGAMKVNEEL 250

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DAIRT+GL+ V +L+ PR+ A++ SLP+LT +   S ++G ++V     DIP + F +  
Sbjct: 251 DAIRTLGLNPVELLVVPRVLAMMFSLPILTFIGMISGMVGGAVVCAVALDIPPSQFIAIV 310

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L +   GL KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI++D
Sbjct: 311 ERDIALKHFLVGLGKAPVFAFLIAVIGCLEGFKVAGSAQSVGEHTTSSVVQSIFMVILLD 370

Query: 362 SLFAIFYFAIG 372
           S+ A+F+  +G
Sbjct: 371 SVAALFFMEMG 381


>gi|167647526|ref|YP_001685189.1| hypothetical protein Caul_3564 [Caulobacter sp. K31]
 gi|167349956|gb|ABZ72691.1| protein of unknown function DUF140 [Caulobacter sp. K31]
          Length = 371

 Score =  182 bits (462), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 115/372 (30%), Positives = 197/372 (52%), Gaps = 15/372 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G      +G+W +  + +  + ++ A++ S   D+  +DL  ++  DT GA  I+  
Sbjct: 11  DHEGRKTVMLSGDWTARGMVDAGERLITALDGS---DAVDLDLRDLSRCDTAGAYAIIRA 67

Query: 62  MEKY--HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
            +     G IK    ++   +L  L+    + + +   PQ+ F     + L   IG+ + 
Sbjct: 68  ADGRVSAGHIK---ANSRTLRLLQLVGDAIQVEPEAAPPQKGF-----QALLERIGRGVY 119

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
              +D       LG ++   G   A   + +     ++      G+  +P+V + +F  G
Sbjct: 120 GLGDDLYGTLGFLGHLLVAIGRCIAKPSRIR--WAPVVALAERSGLDAIPIVAVTTFFIG 177

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A  GA  L+QFGA++F+++L+ I  LRE  +L+TA+++AGRS S+  AEIGSMK+N+
Sbjct: 178 AVVALLGANLLTQFGAQVFAVELIGISVLREFNILITAILLAGRSASSFAAEIGSMKMNQ 237

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA++ MG+D    L+ PR  AL+I++PLLT +A  + + G  +V W   D+    F  
Sbjct: 238 EIDAMQVMGVDPYEALVLPRFAALLITIPLLTFIATLAGLAGGMLVTWAVLDLSPTFFLQ 297

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R   +  + + + GL KAP MA  I  +  ++G  VG    SLG++VT  VV +I  +I 
Sbjct: 298 RMQDSVGVQHYWIGLSKAPVMAMVIAAIGCRQGMEVGNDVESLGRRVTAAVVHAIFAIIA 357

Query: 360 IDSLFAIFYFAI 371
           ID++FA+ Y  +
Sbjct: 358 IDAVFALIYMEL 369


>gi|206575650|ref|YP_002235755.1| putative ABC transporter, permease protein [Klebsiella pneumoniae
           342]
 gi|206570494|gb|ACI12140.1| putative ABC transporter, permease protein [Klebsiella pneumoniae
           342]
          Length = 382

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 201/363 (55%), Gaps = 8/363 (2%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM-EKYHGKIK 70
           +G+W     + + +  V A+   + S+ AI DLS +  +DT GA L++  M EK   +++
Sbjct: 25  SGDWVLAHYAYL-EPAVSALQPQLLSN-AIFDLSQLGTLDTAGATLLVKLMGEKKVLELE 82

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQ-KPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
               +  IE+   ++  T R  I+N   P           L  +IGK +  F  +  +  
Sbjct: 83  RIAPTLPIER--RVLLQTVRSAIQNYVTPPAQHQPGIVTELLANIGKSVESFWQNLVALI 140

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             +GL +            ++  + SL+  +  +G++ VP++ L++F+ GAVIA  G+  
Sbjct: 141 GFIGLTMEALFATLLRPAHWR--VTSLVANLQQIGLNAVPIIALLTFMVGAVIAFLGSTV 198

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           LS FGA IF++ L++   LRE  VLL A+++AGR+ SA  A+IG MK NEEIDAI+TMGL
Sbjct: 199 LSTFGASIFTVQLVAFSFLREFAVLLAAILMAGRTASAFTAQIGLMKANEEIDAIQTMGL 258

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           + V +L+ PR+ AL+++LP++T +     I+G  +V     DI   +F +   +     +
Sbjct: 259 NPVELLVLPRVLALLVALPMMTFIGMICGILGGIVVCALTLDISPTMFLTIMQNNVGFEH 318

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
            + G+IKAP  A  I I+   EGF V   + S+G+  T  VV SI +VI++D++ A+F+ 
Sbjct: 319 FWVGMIKAPVFAFLIAIIGCLEGFKVSGSAESVGEHTTASVVHSIFVVILLDAVAALFFM 378

Query: 370 AIG 372
            +G
Sbjct: 379 EMG 381


>gi|152992948|ref|YP_001358669.1| ABC transporter, permease [Sulfurovum sp. NBC37-1]
 gi|151424809|dbj|BAF72312.1| ABC transporter, permease [Sulfurovum sp. NBC37-1]
          Length = 367

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 124/363 (34%), Positives = 190/363 (52%), Gaps = 28/363 (7%)

Query: 13  GNWKSPEISEIADDVVMAINKSI-QSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK--I 69
           G W    + EI  ++     K I    S + DLS +   D+ G  L M + +K   K  +
Sbjct: 21  GEWTLATVPEIEKEL-----KGIPMGKSVLWDLSGVEAFDSAGVLLFMEYYDKLKQKNAV 75

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQR--SFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +L G S   ++++ L+    RK +  + P+R  SFF          +GK  +  + D   
Sbjct: 76  ELVGYSESQKEMYDLL----RKHMIEKVPERKTSFFE--------ELGKSTLVVLGDIKD 123

Query: 128 QAHILGLVISNTGE--FCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
               LG +        F   + + K     ++  +++ G + + ++ L SF+ G VIA Q
Sbjct: 124 LITFLGHLFFTLFNVLFHPRNIRIK----EMVYHIHHSGFNALMIIGLTSFLVGMVIAYQ 179

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA QL++FGA+IF +D + I  +RE+G L+TA++IAGRSGSA  AEIG+MKI EEI A+R
Sbjct: 180 GAVQLAKFGADIFIVDTVGISMVRELGPLMTAIVIAGRSGSAYTAEIGAMKITEEIAAMR 239

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG D    L+ PRI+ALI++LPLL   ++   I G  +      +I  A F  R +   
Sbjct: 240 TMGFDPYNFLVMPRIFALIVALPLLIFFSDIMGIFGGMVASQMELNISMAQFVDRLNEVL 299

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   G+IK P  A  I  +    GF V  ++ SLG + T  VV SI +VI  D+LF+
Sbjct: 300 EVKHYILGMIKGPVFAFVIAAIGCFRGFQVSDNTESLGLQTTASVVNSIFLVIAFDALFS 359

Query: 366 IFY 368
           + Y
Sbjct: 360 VIY 362


>gi|16126557|ref|NP_421121.1| ABC transporter permease [Caulobacter crescentus CB15]
 gi|221235339|ref|YP_002517776.1| ABC transporter permease protein [Caulobacter crescentus NA1000]
 gi|13423841|gb|AAK24289.1| ABC transporter, permease protein, putative [Caulobacter crescentus
           CB15]
 gi|220964512|gb|ACL95868.1| ABC transporter permease protein [Caulobacter crescentus NA1000]
          Length = 371

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 114/379 (30%), Positives = 195/379 (51%), Gaps = 25/379 (6%)

Query: 2   SENGITVFRFAGNWKS-------PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIG 54
            ++G  V   AG+W +       P ++E  +D      + ++      DL+ +   DT G
Sbjct: 11  EQDGGLVAVLAGDWTARGLFDAGPRLTEALED-----RRDLR-----FDLTGVNRCDTAG 60

Query: 55  AELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHI 114
           A  I+        ++K   +    +Q+  L+       IK + PQR+     F  L   I
Sbjct: 61  AYAIL---RAAGDRLKSDRIIAR-KQVLRLLELVG-AAIKVE-PQRAARPTGFYALLERI 114

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
           G+ +     D       LG ++   G    S ++ +     ++      G+  +P++   
Sbjct: 115 GRGVFGLFADGYGTLVFLGHLLVALGRSIVSPHRIR--WAPIVALCERAGLDAMPIIATT 172

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           +F  GAV+A  GA  L+ FGA++++++L+ I  +RE  +L+TA+++AGRS S+  AEIGS
Sbjct: 173 TFFIGAVVALLGANMLTDFGAQVYAVELIGISVMREFNILITAILLAGRSASSFAAEIGS 232

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MK+N+EIDA++ MG+D    L+ PR  AL++++PLLT +A  + + G  +V+W   D+  
Sbjct: 233 MKMNQEIDAMQVMGVDPYEALVLPRFAALLLTIPLLTFVATIAGLAGGILVVWSVLDLSP 292

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F  R        + + GL KAP MA  I  +  ++G  VG    SLG++VT  VV +I
Sbjct: 293 TFFLQRIVDYVGATHFWIGLSKAPVMAMVIAAIGCRQGMEVGKDIESLGRRVTAAVVHAI 352

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             +I+ID++FA+ Y  + I
Sbjct: 353 FAIILIDAVFALIYMELDI 371


>gi|148925785|ref|ZP_01809473.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|145845795|gb|EDK22886.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
          Length = 369

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 124/379 (32%), Positives = 195/379 (51%), Gaps = 24/379 (6%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   +  IDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  + +++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKDKNIKITKESLNSRFQILFELCEKNYQRLGKTKKSHKNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K ++KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILIKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      ++ PR+ AL+I++PL+  +++  +IIG  +V     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIVIPRVMALVIAMPLIVAISDAISIIGGMMVAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
           A F  RF     + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I
Sbjct: 291 AEFLRRFREAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAI 350

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++   + GI
Sbjct: 351 FWVIAFDALFSVILTSTGI 369


>gi|285019443|ref|YP_003377154.1| ABC transporter permease [Xanthomonas albilineans GPE PC73]
 gi|283474661|emb|CBA17160.1| probable abc transporter permease protein [Xanthomonas albilineans]
          Length = 405

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 129/370 (34%), Positives = 208/370 (56%), Gaps = 27/370 (7%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA-ELIMYFMEKYHGK 68
           R  G+W +   + +A +V+    +S+ + +  +D S I ++D+ G  +LI Y       +
Sbjct: 55  RLTGSW-TLSTALVASEVL----RSMPAGTTGIDASGIAQLDSAGVLQLIRYATRNGIAQ 109

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYN---SFKNLHYHI---GKKIVKFI 122
             L     H   L S I     + + + +P+R   Y    + + L Y +   GK+IV  +
Sbjct: 110 ESLDFRQDH-RALVSTI-----EDVADDRPKRKRDYGFAAALERLGYTVHRNGKEIVALV 163

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                    LG  +        +  +F+  L S +  M  VG+  VP+V L+S++ GAVI
Sbjct: 164 G-------FLGETLVKLMRLMHAPRRFR--LTSTVHHMEQVGLDAVPLVALLSYLVGAVI 214

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEID
Sbjct: 215 AFLGSTVLRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEID 274

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           AI+T+GLD + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ +R H
Sbjct: 275 AIQTLGLDPMDLLVIPRLLALLLMLPLLTFVAMIAGLAGGVTVGAFDLGIPPQMYLARMH 334

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T  + ++  GL KAP  A AIG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+
Sbjct: 335 DTIQIRHMLVGLAKAPIFAIAIGLIGCLEGLRVEGTAQSVGERTTSSVVQTISLVIIIDA 394

Query: 363 LFAIFYFAIG 372
           + A+++  +G
Sbjct: 395 IAALWFMKMG 404


>gi|85707661|ref|ZP_01038727.1| ABC-type transport system permease component [Erythrobacter sp.
           NAP1]
 gi|85689195|gb|EAQ29198.1| ABC-type transport system permease component [Erythrobacter sp.
           NAP1]
          Length = 370

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/331 (33%), Positives = 180/331 (54%), Gaps = 9/331 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           VDLS + E+DT+GA ++  F    H    + G +   ++L   +            P R+
Sbjct: 47  VDLSDVEEMDTVGAWVVCRF--ATHQSAAITGTTPSAKRLLEAVEAASSDV--EITPDRT 102

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
             +   + +   +G+K+    +         G ++   G        F   L + +RQM 
Sbjct: 103 PVW---ERVPLALGEKVYAARSGVYGVVGFFGQILIGFGSLLRHPSTFP--LKATVRQME 157

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
            VGV+ +P++ L+SF+ G VIAQQGA QL+QFGAE  +++L+  + LRE+GVL+TA+M+A
Sbjct: 158 MVGVAALPIIGLMSFLIGIVIAQQGAVQLAQFGAETLTVNLVGRITLRELGVLMTAIMVA 217

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSGSA  A+IG+MK+ EE+DA+RT+G+  +  L+ PRI A    + +L   A+   I+G
Sbjct: 218 GRSGSAFAAQIGTMKLTEEVDAMRTIGISPIERLVIPRILACTFMMVVLGFYASIVGIVG 277

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
            ++V      IPF  F  R      L +++ GL+KAP     + +     G  V  +S  
Sbjct: 278 GAVVGHLSLGIPFFTFLERIQEVVPLHDVWVGLVKAPVFGLIVALAGCYHGMQVKGNSEQ 337

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           +G + T  VV +I  VI++D+ FA+F+  IG
Sbjct: 338 VGIRTTMAVVSAIFAVIVLDAFFAVFFTEIG 368


>gi|86152962|ref|ZP_01071167.1| ABC transporter, permease [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85843847|gb|EAQ61057.1| ABC transporter, permease [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 369

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 122/379 (32%), Positives = 195/379 (51%), Gaps = 24/379 (6%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   +  IDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKDKNIKITKEGLNSRFQILFELCEKNYQRLGKTKKSHKNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K ++KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILIKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      ++ PR+ AL++++PL+  +++  +IIG  ++     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIVIPRVMALVVAMPLIVAISDAISIIGGMMIAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F  RF     + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I
Sbjct: 291 VEFLRRFREAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAI 350

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++   + GI
Sbjct: 351 FWVIAFDALFSVVLTSAGI 369


>gi|170724242|ref|YP_001751930.1| hypothetical protein PputW619_5085 [Pseudomonas putida W619]
 gi|169762245|gb|ACA75561.1| protein of unknown function DUF140 [Pseudomonas putida W619]
          Length = 377

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 127/368 (34%), Positives = 201/368 (54%), Gaps = 15/368 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDS-AIVDLSAITEIDTIGAELIMYFM--EKY 65
            R AG+W     + +  D   +     Q D+ A+ DLS + ++DT GA L+   +  E+ 
Sbjct: 20  LRIAGDWTLAHYASLKRD---SERLRTQYDADAVADLSQLGQLDTAGASLLAELLGSERL 76

Query: 66  -HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            H   +L   S  +  L ++        I  ++P+R         L   IG+ +     D
Sbjct: 77  SHCTQELPDASRAL--LKNVYCSVQDYCIPVKEPERHVLI----LLLERIGRAVNTLWQD 130

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           +      +GL++          ++++  L  ++  +   G+   P+V L++F+ GAV+A 
Sbjct: 131 TLQLLGFIGLILETLLRRALQPHRWR--LTPVVSHIEQTGLDAAPIVALLTFLVGAVVAF 188

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            GA  L+ FGA +F++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAI
Sbjct: 189 LGATVLADFGATVFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAI 248

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GL+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S 
Sbjct: 249 RTLGLNPIELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALSLDISPAMFLSLLQSD 308

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ 
Sbjct: 309 IGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVA 368

Query: 365 AIFYFAIG 372
           A+F   +G
Sbjct: 369 ALFCMEMG 376


>gi|292490603|ref|YP_003526042.1| hypothetical protein Nhal_0469 [Nitrosococcus halophilus Nc4]
 gi|291579198|gb|ADE13655.1| protein of unknown function DUF140 [Nitrosococcus halophilus Nc4]
          Length = 380

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 117/383 (30%), Positives = 199/383 (51%), Gaps = 34/383 (8%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAI--VDLSAITEIDTIGAELIMY 60
           +   +  R  G W    IS++   + ++     QS   +  VD S IT++DT GA L+  
Sbjct: 20  DPATSTLRCLGTWTLYGISQLEQTLPLS-----QSHPPVHAVDASGITQMDTGGAWLLQR 74

Query: 61  FM---EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
            +   E+    I  +G+    ++L  L+      +     P         +    H+ + 
Sbjct: 75  LLADLEQQTRPIPCKGLGQEQQKLLRLVQGGSTSQQLTTAPPPGILERIGRLSWAHVEEA 134

Query: 118 I--VKFINDSC-----SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPV 170
           +  + FI ++      S AH              S  +++ FL +L       G++ +P+
Sbjct: 135 LSFLAFIGETLLYFLRSMAH-------------PSRIRWRPFLSNL----QTAGINALPI 177

Query: 171 VILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVA 230
           V L+ F+ G V+A QG  QL  +GA IF ++L+++  +RE+  L+ A++IAGR+GSA  A
Sbjct: 178 VGLLIFLVGVVLAYQGGIQLRAYGANIFIVELVTLTMVRELAPLMAAIIIAGRTGSAFTA 237

Query: 231 EIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYY 290
           +IG+M++ EEIDA+RT+G+  +  L+ P+I+AL+++LPLLT+ A+   I G  ++     
Sbjct: 238 QIGTMQVTEEIDALRTLGIPPMEQLVLPKIFALVLALPLLTVFADMVGIFGGMVMSQALL 297

Query: 291 DIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCV 350
           ++ F  F  R      L++   G+ KAP  A  I  V   +GF VG  + S+G+  TT V
Sbjct: 298 EVEFREFAQRIPEVVPLSSFLIGVGKAPVFAVIIATVGCYQGFRVGGGAESVGRHTTTSV 357

Query: 351 VQSISIVIIIDSLFAIFYFAIGI 373
           VQ+I +VII D+ F+I +  +GI
Sbjct: 358 VQAIFLVIIADATFSILFSWLGI 380


>gi|57168794|ref|ZP_00367925.1| conserved hypothetical integral membrane protein [Campylobacter
           coli RM2228]
 gi|57019841|gb|EAL56524.1| conserved hypothetical integral membrane protein [Campylobacter
           coli RM2228]
          Length = 371

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 124/371 (33%), Positives = 199/371 (53%), Gaps = 22/371 (5%)

Query: 2   SENGITVFRFAGNWKSPEISEIA-DDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM- 59
            EN + +F   G W    +S+I   D++  I+++    + I D S + EID  G    + 
Sbjct: 10  EENKVFIF---GIWDKTSVSKIKIKDLLSQISQT----NCIFDFSQLNEIDMAGVRFFLA 62

Query: 60  --YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHIG 115
             + ++K    I  QG++T  + LF L    +++  + Q+ + +F  F+ S   L + + 
Sbjct: 63  LEHDLKKNDILILKQGLNTRFKSLFELCEKNYQRINEKQEKKFNFTDFFISLGILSFDLL 122

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           K + KFIN + +    L L I N       +++F  FL  +    +      +P+VIL +
Sbjct: 123 KILQKFINFTGTFFTSLFLCIKN-----PKNFRFISFLYHIENSAF----KALPIVILTA 173

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
            + G V+A Q A+QL+QFGA IF +DL+ I   RE+  L+ A++IAGRS S+  A+IG M
Sbjct: 174 LLVGVVLAYQAAYQLAQFGANIFIVDLVGISATRELAPLIAAIVIAGRSASSYTAQIGVM 233

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           KI +EI+A+ TMG      +I PR+ AL+I++PL+  L++  +I+G  +V     DI F 
Sbjct: 234 KITDEINAMNTMGFRSFEFIIIPRVMALVIAMPLIVALSDAISILGGMVVAKINLDISFG 293

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            F  RF     + +I  GL KAP     IG++A   GF V   + S+G   T  VV +I 
Sbjct: 294 EFLRRFREAVEMKHIIIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIF 353

Query: 356 IVIIIDSLFAI 366
            VI  D+LF++
Sbjct: 354 WVIAFDALFSV 364


>gi|305432464|ref|ZP_07401626.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter coli JV20]
 gi|304444503|gb|EFM37154.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter coli JV20]
          Length = 371

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 125/371 (33%), Positives = 198/371 (53%), Gaps = 22/371 (5%)

Query: 2   SENGITVFRFAGNWKSPEISEIA-DDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM- 59
            EN + +F   G W    +S+I   D++  I+++    + I D S + EID  G    + 
Sbjct: 10  EENKVFIF---GIWDKTSVSKIKIKDLLSQISQT----NCIFDFSQLNEIDMAGVRFFLA 62

Query: 60  --YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHIG 115
             + ++K    I  QG++T  + LF L    +++  + Q+ + +F  F+ S   L + + 
Sbjct: 63  LEHDLKKNDILILKQGLNTRFKSLFELCEKNYQRINEKQEKKFNFTDFFISLGILSFDLL 122

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           K + KFIN + +    L L I N   F     +F  FL  +    +      +P+VIL +
Sbjct: 123 KILQKFINFTGAFFTSLFLCIKNPKNF-----RFISFLYHIENSAF----KALPIVILTA 173

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
            + G V+A Q A+QL+QFGA IF +DL+ I   RE+  L+ A++IAGRS S+  A+IG M
Sbjct: 174 LLVGVVLAYQAAYQLAQFGANIFIVDLVGISATRELAPLIAAIVIAGRSASSYTAQIGVM 233

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           KI +EI+A+ TMG      +I PR+ AL+I++PL+  L++  +I+G  +V     DI F 
Sbjct: 234 KITDEINAMNTMGFRSFEFIIIPRVMALVIAMPLIVALSDAISILGGMVVAKINLDISFG 293

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            F  RF     + +I  GL KAP     IG++A   GF V   + S+G   T  VV +I 
Sbjct: 294 EFLRRFREAVEMKHIIIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIF 353

Query: 356 IVIIIDSLFAI 366
            VI  D+LF++
Sbjct: 354 WVIAFDALFSV 364


>gi|283953736|ref|ZP_06371267.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 414]
 gi|283794777|gb|EFC33515.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 414]
          Length = 369

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 123/382 (32%), Positives = 196/382 (51%), Gaps = 30/382 (7%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T FRF  N       W    I ++     + +   IQS   I D   + +IDT G    +
Sbjct: 3   TDFRFQNNTFFIFGIWDKASIYKLKIKDFLTL---IQSKEVIFDFKDLEKIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  QG+++    LF L    +++  K +K  ++F  ++ +   L   +
Sbjct: 60  ALENDLKNKNIKITKQGLNSRFLTLFELCEKNYQRLNKTKKSHKNFSEYFINLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VPVV 171
            K + +FIN + +    L L + N   F             LI  +Y++  S    +P+V
Sbjct: 120 LKILREFINFTGAFFTSLFLCLKNPKNF------------RLIAFLYHIENSAFKALPIV 167

Query: 172 ILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAE 231
           IL + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+
Sbjct: 168 ILTALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQ 227

Query: 232 IGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYD 291
           IG MKI +EI A+ TMG      +I PR+ AL++++PL+  +++  +I+G  ++     D
Sbjct: 228 IGVMKITDEIAAMNTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIVGGMMIAKLNLD 287

Query: 292 IPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVV 351
           I FA F  RF     + +I  GL+KAP     IG++A   GF V   + S+G   T  VV
Sbjct: 288 ISFAEFLRRFREAVDIKHILIGLVKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVV 347

Query: 352 QSISIVIIIDSLFAIFYFAIGI 373
            +I  VI  D+LF++   + GI
Sbjct: 348 NAIFWVIAFDALFSVVLTSAGI 369


>gi|255322244|ref|ZP_05363390.1| ABC transport system permease [Campylobacter showae RM3277]
 gi|255300617|gb|EET79888.1| ABC transport system permease [Campylobacter showae RM3277]
          Length = 378

 Score =  180 bits (456), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 194/373 (52%), Gaps = 33/373 (8%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK-- 70
            NW     ++I       I  S + +  +++   I E+D   A   ++F   +    K  
Sbjct: 27  NNWNYKLPAQIWTQTAALIG-SKKFNKIVLNFKEIKELDYAAA---LFFKNTFLNACKNY 82

Query: 71  -LQGVSTHIEQLFSLISFTHRKKIK---NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
            L  ++ H +++F+ I+     KIK   + KP         +N    IGK +  F    C
Sbjct: 83  ELVNLTPHAQKIFASINSEINPKIKQIIDAKPH--------ENPFSQIGKNLTAFFAGFC 134

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIR----QMYY--VGVSGVPVVILISFVTGA 180
           +        ++ TGEF     K   F+L  IR      Y+   G+  V +V L SF+ G 
Sbjct: 135 A-------FLNFTGEFLVKFSKI--FMLKNIRVKEILAYFEDAGIKSVFIVCLTSFLIGI 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A QG+  L  FGA I  +++M +L LREI  L+ A+++AGR  S+  A+IG MKI EE
Sbjct: 186 VLAYQGSNLLESFGATIIIVEMMGLLTLREIAPLIAAIIVAGRLASSFTAQIGVMKITEE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA++TMG D  + L+ PR+ ALI+++PL+  LA+ + I G  +V+  Y +I F  + +R
Sbjct: 246 IDAMKTMGFDPFKFLVLPRVIALIVAMPLIVFLADVAGIFGEMVVMENYLNISFDSYLAR 305

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           F     + +++ GL KAPF    I  +    GF +G ++ S+G   T  VV +I  VI++
Sbjct: 306 FSQEVDIKHLYVGLFKAPFFGIVIAFIGCMRGFQIGGNTQSVGTYTTVSVVNAIFGVIMV 365

Query: 361 DSLFAIFYFAIGI 373
           D+LF+I +  +GI
Sbjct: 366 DALFSIIFTQLGI 378


>gi|302382565|ref|YP_003818388.1| hypothetical protein Bresu_1453 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193193|gb|ADL00765.1| protein of unknown function DUF140 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 372

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 115/374 (30%), Positives = 198/374 (52%), Gaps = 14/374 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAIN-KSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +  G +V R  G+W +  +   A  +   ++ ++IQS    VDLS +   DT GA  ++ 
Sbjct: 11  ATGGGSVLRLTGDWTTMSLGRTAARLSDGLSGRTIQS----VDLSGLGRFDTAGALALVQ 66

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                  K   Q       +++ ++    RK +   + Q S     F  + + +     +
Sbjct: 67  ASGLTLPKDAWQS-RPEAGRIYDMVETLERKSMPAPRRQASL-TRIFARMGHGVHDAAAE 124

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F+    S A  LG +++ TG         +    + + Q    G+  +P++ + +F  GA
Sbjct: 125 FL---LSMA-FLGRLMAATGNAVRHPGAIR--WPAWVSQAERSGLDAMPIIAVTNFFIGA 178

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           VIA  GA  L+QFGA +F++DL+ +  LRE+ VL+TA+++AGRS S+  AE+GSM++N+E
Sbjct: 179 VIAFLGADLLTQFGAGVFAVDLIGVSILRELAVLITAILLAGRSASSFAAEVGSMRMNQE 238

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA++ MG+D  + L+ PR+ A+++ +PLLT +   + + G  IV W    +  A F  R
Sbjct: 239 VDAMQVMGVDPFQALVIPRLAAMLVMVPLLTFVGMIAGLFGGLIVTWSQLALGPAFFLQR 298

Query: 301 FHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
              T  +  ++  GL KAP  A  I  +  ++G AV     SLG++VT  VVQ+I  +I 
Sbjct: 299 MVDTPDMFTHMLVGLSKAPVFAIVIAAIGCRQGLAVSGDVESLGRRVTAAVVQAIFAIIF 358

Query: 360 IDSLFAIFYFAIGI 373
           +D++FA+ Y  + I
Sbjct: 359 LDAVFALIYLELDI 372


>gi|154706662|ref|YP_001424136.1| ABC transporter permease protein [Coxiella burnetii Dugway
           5J108-111]
 gi|154355948|gb|ABS77410.1| ABC transporter permease protein [Coxiella burnetii Dugway
           5J108-111]
          Length = 377

 Score =  179 bits (453), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 189/368 (51%), Gaps = 21/368 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME--KYHGK-I 69
           G+W    +S + D + +   K   S+  I+    IT++D+ GA L    +   K  GK I
Sbjct: 24  GDWTVSHLSPLEDQLPLCAEK--LSEKVIIHADKITKMDSAGALLFYTLINHLKSLGKAI 81

Query: 70  KLQGVSTHIEQLFSLI----SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           ++ G+S + + L  LI     F  +    ++ P   +    +    + +    + F+ + 
Sbjct: 82  EITGLSENAQSLLKLIGNESKFLRQPLPSSKTPGVVYLLGEWAVTKWRVLIDFLTFVGEV 141

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            + A          G       +++  L    R +   G   +P+V L+SF+ G V+  Q
Sbjct: 142 ATTA--------GQGILKPQRIQWRAIL----RAIEETGYQALPIVALLSFLVGVVLTYQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  + A+IF +D+     LRE G L+TA++ AGR+ +A  A+IG+MK+NEEIDA+ 
Sbjct: 190 IALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMKVNEEIDALN 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG+  +  L+ P+I ALIISL LLT+ A+     G+ I+     DI +  F  RFH   
Sbjct: 250 TMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLAFLDRFHHAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GLIKAP     I  V   +GF VG  ++S+G+K T   VQSI ++II D++F+
Sbjct: 310 AVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFLIIIADAIFS 369

Query: 366 IFYFAIGI 373
           + +   GI
Sbjct: 370 VIFSLRGI 377


>gi|126666401|ref|ZP_01737380.1| ABC transporter, permease protein, putative [Marinobacter sp.
           ELB17]
 gi|126629202|gb|EAZ99820.1| ABC transporter, permease protein, putative [Marinobacter sp.
           ELB17]
          Length = 387

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 196/364 (53%), Gaps = 12/364 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL- 71
           G+W  P    +   V  A   S +  +  ++L  +  IDT GA L+   +  ++ +  L 
Sbjct: 31  GDWTLPYYHALYSSVTAAGQDSDRYQT--LNLQTLGRIDTAGAALLAELVGPHNLEQWLA 88

Query: 72  ---QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              Q VS     L S ++      + +Q+P  +    +   L   +G  + +      + 
Sbjct: 89  DNPQAVSRETAALLSAVA----TAMADQQPLPAPPGFTLSGLVRDVGAWVNELYQLVVTL 144

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G +I+          +++  + + +  +   G++ VP+V L++F+ GAV+A  GA 
Sbjct: 145 IGFIGQIIAALAWTTLHPRRWR--MTAFVAAVQDTGLNAVPIVALLTFLVGAVVAFLGAT 202

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA I++++L++   LRE GVLL A+++AGR+ S+  A+IG+MK+NEE+DA+RT+G
Sbjct: 203 VLADFGATIYTVNLVAFSFLREFGVLLAAILLAGRTASSFTAQIGAMKVNEELDALRTLG 262

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L  + +L+ PR+ A+++SLPLLT +   S ++G ++V     DI    F S       L 
Sbjct: 263 LSPIELLVLPRVLAMMVSLPLLTFVGMISGMVGGALVCSMTLDITPTQFISIVSQDVALK 322

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL KAP  A  I  VA  EGF V   + S+G   T+ VVQSI +VI+ DS+ A+F+
Sbjct: 323 HLLVGLSKAPIFAFLIAAVACLEGFKVSGSAQSVGVHTTSSVVQSIFMVILFDSIAALFF 382

Query: 369 FAIG 372
             +G
Sbjct: 383 MEMG 386


>gi|29654061|ref|NP_819753.1| ABC transporter permease [Coxiella burnetii RSA 493]
 gi|161830426|ref|YP_001596961.1| ABC transporter, permease protein [Coxiella burnetii RSA 331]
 gi|165924016|ref|ZP_02219848.1| ABC transporter, permease protein [Coxiella burnetii RSA 334]
 gi|212212807|ref|YP_002303743.1| ABC transporter permease protein [Coxiella burnetii CbuG_Q212]
 gi|29541327|gb|AAO90267.1| ABC transporter permease protein [Coxiella burnetii RSA 493]
 gi|161762293|gb|ABX77935.1| ABC transporter, permease protein [Coxiella burnetii RSA 331]
 gi|165916539|gb|EDR35143.1| ABC transporter, permease protein [Coxiella burnetii RSA 334]
 gi|212011217|gb|ACJ18598.1| ABC transporter permease protein [Coxiella burnetii CbuG_Q212]
          Length = 377

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 117/368 (31%), Positives = 189/368 (51%), Gaps = 21/368 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME--KYHGK-I 69
           G+W    +S + D + +   K   S+  I+    IT++D+ GA L    +   K  GK I
Sbjct: 24  GDWTVSHLSPLEDQLPLYAEK--LSEKVIIHADKITKMDSAGALLFYTLINHLKSLGKAI 81

Query: 70  KLQGVSTHIEQLFSLI----SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           ++ G+S + + L  LI     F  +    ++ P   +    +    + +    + F+ + 
Sbjct: 82  EITGLSENAQSLLKLIGNESKFLRQPLPSSKTPGVVYLLGEWAVTKWRVLIDFLTFVGEV 141

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            + A          G       +++  L    R +   G   +P+V L+SF+ G V+  Q
Sbjct: 142 ATTA--------GQGILKPQRIQWRAIL----RAIEETGYQALPIVALLSFLVGVVLTYQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  + A+IF +D+     LRE G L+TA++ AGR+ +A  A+IG+MK+NEEIDA+ 
Sbjct: 190 IALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMKVNEEIDALN 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG+  +  L+ P+I ALIISL LLT+ A+     G+ I+     DI +  F  RFH   
Sbjct: 250 TMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLAFLDRFHHAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GLIKAP     I  V   +GF VG  ++S+G+K T   VQSI ++II D++F+
Sbjct: 310 AVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFLIIIADAIFS 369

Query: 366 IFYFAIGI 373
           + +   GI
Sbjct: 370 VIFSLRGI 377


>gi|254450464|ref|ZP_05063901.1| ABC transporter, inner membrane subunit [Octadecabacter antarcticus
           238]
 gi|198264870|gb|EDY89140.1| ABC transporter, inner membrane subunit [Octadecabacter antarcticus
           238]
          Length = 376

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 145/220 (65%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L +L+     VG   VP+V L++F+ G V+A QG+ QL QFGAE+F +DL+++  LRE+G
Sbjct: 156 LTALVHHCQEVGFKAVPIVALMAFLIGVVLAFQGSTQLKQFGAEVFIVDLIAVSILRELG 215

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           +LLT++++AGR+ SA  A IGSMK+ EEIDA+R++GLD    L  PRI AL++ LP+L +
Sbjct: 216 ILLTSIIVAGRTASAFTAAIGSMKMREEIDAMRSLGLDPAATLFVPRILALVLMLPILGL 275

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +AN   + G +I+ W    I   +F +R  +   ++++  G+IKAP  A  IG+V    G
Sbjct: 276 IANVMGLFGGAIMAWIDLGISPEMFMTRLVNGTDVSHLAAGMIKAPVFALIIGVVGCHAG 335

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             V  ++ SLG+  ++ VV +I  VI+ D++F+IF+  IG
Sbjct: 336 MQVQSNAESLGRMTSSSVVAAIFAVIMADAVFSIFFAQIG 375


>gi|268678744|ref|YP_003303175.1| hypothetical protein Sdel_0102 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616775|gb|ACZ11140.1| protein of unknown function DUF140 [Sulfurospirillum deleyianum DSM
           6946]
          Length = 376

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 111/334 (33%), Positives = 180/334 (53%), Gaps = 22/334 (6%)

Query: 43  DLSAITEIDTIGAELIMYF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ 99
           D S+I   DT G  L+++    +EK +  ++  G S   + LFS+    +  ++   K +
Sbjct: 50  DFSSIETFDTHGIMLLLHHIKKLEKEYCIVQTTGASDAFKTLFSICQTHYPHEVPRPKKE 109

Query: 100 R---SFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
           R   SF  N  + +     K +  F + +   +H +G +             FK   + L
Sbjct: 110 RMVLSFLENVGRTMMEGY-KTLASFFSFTGELSHAIGALF------------FKPANIRL 156

Query: 157 IRQMYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGV 213
              +Y++  SG   +P+++L SF+ G VIA QGA QL +FGA IF +++++I  +RE+  
Sbjct: 157 KATLYHIEQSGAGAIPIILLTSFLIGVVIAYQGASQLEKFGANIFIVEMITISAVRELAP 216

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           LLTA+++AGRS S+  A+IG MK+ +EIDA+ +MG      L+ PR++ALIISLPLL   
Sbjct: 217 LLTAIVVAGRSASSYTAQIGVMKLTDEIDAMSSMGFSPWNFLVLPRLFALIISLPLLVFF 276

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           A+  +  G  ++     D+ F  F  R   T  L ++  GL+KAP   C I  +    GF
Sbjct: 277 ADVVSTFGGMVIASTRLDVSFVEFIDRIKETVALKHLVIGLVKAPIFGCIIATIGCFRGF 336

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +  ++ S+GK  T  VV +I  VI +D+L ++F
Sbjct: 337 QITSNTESVGKYTTISVVNAIFWVIAMDALISVF 370


>gi|226942634|ref|YP_002797707.1| ABC transporter protein [Azotobacter vinelandii DJ]
 gi|226717561|gb|ACO76732.1| ABC transporter protein [Azotobacter vinelandii DJ]
          Length = 382

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 116/368 (31%), Positives = 193/368 (52%), Gaps = 20/368 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G+W       +  ++  A  +    D+  V L  +  +DT GA L++  +    G  +L 
Sbjct: 26  GDWTLQHYPRLKREIERA--RPRLDDACPVVLDGLGALDTAGAGLLVELL----GARRLT 79

Query: 73  GVSTHIEQLFSLISFTHRKKIK--------NQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            ++    QL +      R             ++P+RS    + K+   HIG+ +      
Sbjct: 80  DIARWAPQLPAERQALLRTVAMAVAGAAGTEEEPERS----TLKDELAHIGRVVETLWEQ 135

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             +    +GL +S          +++  +  L+  +   G+  VP+V L++F+ GAV+A 
Sbjct: 136 QRTLYGFIGLTLSTLLATLPRPRRWR--ITPLVAHIERTGLDAVPIVALLTFMVGAVVAF 193

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            GA  L QFGA I++++L++   LRE GVLL A+++AGR+ SA  A+IG+MK NEEIDAI
Sbjct: 194 LGATVLGQFGATIYTVNLVAYSFLREFGVLLCAILMAGRTASAFAAQIGAMKANEEIDAI 253

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R +GLD + +L+ PR+ A++++LP+LT +A    I+G   V     DI    +F+     
Sbjct: 254 RALGLDPIELLVLPRVLAMLLTLPILTFIAMLCGILGGLAVCVLALDISPVQYFAILEQE 313

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +   GL KAP  A  I ++   EGF     + S+G++ T+ VVQSI +VI+ID+L 
Sbjct: 314 IPVNHYLVGLGKAPLFAFLIAVIGCLEGFKASGSAQSVGERTTSSVVQSIFMVILIDALA 373

Query: 365 AIFYFAIG 372
           A+F   +G
Sbjct: 374 ALFLMEMG 381


>gi|238796784|ref|ZP_04640289.1| ABC transporter, permease protein [Yersinia mollaretii ATCC 43969]
 gi|238719272|gb|EEQ11083.1| ABC transporter, permease protein [Yersinia mollaretii ATCC 43969]
          Length = 381

 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 109/286 (38%), Positives = 166/286 (58%), Gaps = 3/286 (1%)

Query: 88  THRKKIKNQKPQRSFFYNSF-KNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASS 146
           T  + + +  P+ S     F   L  +IG+ +V    D  S    +GL +          
Sbjct: 97  TVSRVLPDLSPEPSTKAPPFWLELLSNIGRSMVNLWEDIKSLLGFIGLTLEALLGTLFRP 156

Query: 147 YKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSIL 206
            +++  + SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+   
Sbjct: 157 ARWR--MTSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFS 214

Query: 207 QLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
            LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+IS
Sbjct: 215 FLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLIS 274

Query: 267 LPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
           LP+LT +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I
Sbjct: 275 LPMLTFIGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAI 334

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           +   EGF V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 335 IGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|238754554|ref|ZP_04615908.1| ABC transporter, permease protein [Yersinia ruckeri ATCC 29473]
 gi|238707185|gb|EEP99548.1| ABC transporter, permease protein [Yersinia ruckeri ATCC 29473]
          Length = 343

 Score =  176 bits (446), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 184/340 (54%), Gaps = 22/340 (6%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR-------KKIKN 95
           DLS +  +DT GA L+   +    G  ++    +H+ +L  L+    R       + + N
Sbjct: 15  DLSQLGRLDTAGATLLATLL----GGERI----SHLRELAPLLPDERRILLETVSQVLPN 66

Query: 96  QKPQRSFFYNSFK-NLHYHIGKKIVKFINDSCSQAHILGLVISNT--GEFCASSYKFKGF 152
              Q +     F   L   IG+ +     D  S     GL +       F  S ++    
Sbjct: 67  LASQPTVKPPPFWIGLLVPIGQSVDNLWQDFKSLLGFTGLTLEALFGTVFRPSRWRMT-- 124

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  
Sbjct: 125 --SLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFA 182

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT 
Sbjct: 183 VLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTF 242

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I G  +V     +I   +F S   ++  L +   G+ KAP  A  I I+   EG
Sbjct: 243 IGMVCGIFGGMVVCALALNISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEG 302

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 303 FKVSGSAESVGIHTTTSVVHSIFVVILLDAVAALFFMEMG 342


>gi|153209306|ref|ZP_01947341.1| ABC transporter, permease protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212219048|ref|YP_002305835.1| ABC transporter permease protein [Coxiella burnetii CbuK_Q154]
 gi|120575422|gb|EAX32046.1| ABC transporter, permease protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212013310|gb|ACJ20690.1| ABC transporter permease protein [Coxiella burnetii CbuK_Q154]
          Length = 377

 Score =  176 bits (445), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 116/368 (31%), Positives = 188/368 (51%), Gaps = 21/368 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME--KYHGK-I 69
           G+W    +S + D + +   K   S+  I+    I ++D+ GA L    +   K  GK I
Sbjct: 24  GDWTVSHLSPLEDQLPLYAEK--LSEKVIIHADKIIKMDSAGALLFYTLINHLKSLGKAI 81

Query: 70  KLQGVSTHIEQLFSLI----SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           ++ G+S + + L  LI     F  +    ++ P   +    +    + +    + F+ + 
Sbjct: 82  EITGLSENAQSLLKLIGNESKFLRQPLPSSKTPGVVYLLGEWAVTKWRVLIDFLTFVGEV 141

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            + A          G       +++  L    R +   G   +P+V L+SF+ G V+  Q
Sbjct: 142 ATTA--------GQGILKPQRIQWRAIL----RAIEETGYQALPIVALLSFLVGVVLTYQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  + A+IF +D+     LRE G L+TA++ AGR+ +A  A+IG+MK+NEEIDA+ 
Sbjct: 190 IALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMKVNEEIDALN 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG+  +  L+ P+I ALIISL LLT+ A+     G+ I+     DI +  F  RFH   
Sbjct: 250 TMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLAFLDRFHHAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GLIKAP     I  V   +GF VG  ++S+G+K T   VQSI ++II D++F+
Sbjct: 310 AVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFLIIIADAIFS 369

Query: 366 IFYFAIGI 373
           + +   GI
Sbjct: 370 VIFSLRGI 377


>gi|327478710|gb|AEA82020.1| ABC transporter permease [Pseudomonas stutzeri DSM 4166]
          Length = 385

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 118/367 (32%), Positives = 193/367 (52%), Gaps = 13/367 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G+W     + +  +V   +   I   S I +LS +  +DT GA L++  +    G  
Sbjct: 27  RIVGDWTLAHYAALRREV-QRLRARIDERSQI-ELSGLGALDTAGAGLLVELL----GPE 80

Query: 70  KLQGVSTHIEQL----FSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           ++  +     QL     +L+  T    +       S     F  +  HIG+ +       
Sbjct: 81  RIAAIEAWAPQLPAERLALLR-TVATALDQPDAAESPRGYEFGYVLAHIGRTVAAVWKQQ 139

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +    +GL +           +++  L SL   +   G+  VP+V L++F+ GAV+A  
Sbjct: 140 RALLGFIGLTLQTLLLTLPRPRRWR--LTSLAVHIEQTGLDAVPIVALLTFLVGAVVAFL 197

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA  L+ FGA I++++L+    LRE GVLL A+++AGRS SA  A+IGSMK NEE+DAIR
Sbjct: 198 GATVLADFGATIYTVNLVGFSFLREFGVLLAAILLAGRSASAFAAQIGSMKSNEEVDAIR 257

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GL  + +L+ PR+ A++I+LP+LT +   S I G  +V     DI   +FF+      
Sbjct: 258 TLGLSPIELLVLPRVLAMLITLPILTFVGMLSGIAGGLVVCVLALDISPTMFFNIMARDI 317

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +++   GL KAP  A  I ++   EGF V   + S+G+  T+ VVQ+I +VI++D++ A
Sbjct: 318 AVSHFLVGLGKAPVFAFVIAVIGCLEGFKVSGSAQSVGEHTTSSVVQAIFMVILLDAIAA 377

Query: 366 IFYFAIG 372
           +F+  +G
Sbjct: 378 LFFMEMG 384


>gi|167031179|ref|YP_001666410.1| hypothetical protein PputGB1_0158 [Pseudomonas putida GB-1]
 gi|166857667|gb|ABY96074.1| protein of unknown function DUF140 [Pseudomonas putida GB-1]
          Length = 377

 Score =  175 bits (444), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 198/369 (53%), Gaps = 17/369 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +    +     +D+ + DLS +  +DT GA L+   +    G 
Sbjct: 20  LRITGDWTLAHYANLKRESEQ-LRTQYAADT-VADLSQLGRLDTAGASLLAELL----GS 73

Query: 69  IKLQGVSTHIEQ-----LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
            +L   +  + +     L ++        I  ++P+R    N    L   IG+ +     
Sbjct: 74  ERLSRCTQDLPEASRALLKNVYCSVQDYCIPVKEPER----NVLLMLLERIGRAVGTLWQ 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           DS      +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A
Sbjct: 130 DSMQLLGFVGVILETLLRRALQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA  L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDA
Sbjct: 188 FLGATVLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           IRT+GL+ + +L+ PR+ AL+ISLPLLT +A    +IG ++V     DI  A+F S   S
Sbjct: 248 IRTLGLNPMELLVVPRVLALLISLPLLTFVAMICGMIGGAVVCALTLDISPAMFLSLLQS 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++
Sbjct: 308 DIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAV 367

Query: 364 FAIFYFAIG 372
            A+F+  +G
Sbjct: 368 AALFFMEMG 376


>gi|146280488|ref|YP_001170641.1| ABC transporter permease [Pseudomonas stutzeri A1501]
 gi|145568693|gb|ABP77799.1| probable permease of ABC transporter [Pseudomonas stutzeri A1501]
          Length = 362

 Score =  175 bits (444), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 119/367 (32%), Positives = 192/367 (52%), Gaps = 13/367 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G+W     + +  +V   +   I   S I +LS +  +DT GA L+   +    G  
Sbjct: 4   RIVGDWTLAHYAALRREV-QRLRARIDERSQI-ELSGLGALDTAGAGLLAELL----GPE 57

Query: 70  KLQGVSTHIEQL----FSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           ++  +     QL     +L+  T    +       S     F  +  HIG+ +       
Sbjct: 58  RIAAIEAWAPQLPAERLALLR-TVATALDQPDAAESPRGYEFGYVLAHIGRTVAAVWKQQ 116

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +    +GL +           +++  L SL   +   G+  VP+V L++F+ GAV+A  
Sbjct: 117 RALLGFIGLTLQTLLLTLPRPRRWR--LTSLAVHIEQTGLDAVPIVALLTFLVGAVVAFL 174

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA  L+ FGA I++++L+    LRE GVLL A+++AGRS SA  A+IGSMK NEEIDAIR
Sbjct: 175 GATVLADFGATIYTVNLVGFSFLREFGVLLAAILLAGRSASAFAAQIGSMKSNEEIDAIR 234

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GL  + +L+ PR+ A++I+LP+LT +   S I G  +V     DI   +FF+      
Sbjct: 235 TLGLSPIELLVLPRVLAMLITLPILTFVGMLSGIAGGLVVCVLALDISPTMFFNIMARDI 294

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +++   GL KAP  A  I ++   EGF V   + S+G+  T+ VVQ+I +VI++D++ A
Sbjct: 295 AVSHFLVGLGKAPVFAFVIAVIGCLEGFKVTGSAQSVGEHTTSSVVQAIFMVILLDAIAA 354

Query: 366 IFYFAIG 372
           +F+  +G
Sbjct: 355 LFFMEMG 361


>gi|300917987|ref|ZP_07134613.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300414813|gb|EFJ98123.1| conserved hypothetical protein [Escherichia coli MS 115-1]
          Length = 381

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 11/280 (3%)

Query: 95  NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNT--GEFCASSYKFKGF 152
           ++KP R F+     N     G+ +     D  S    +GL +       F  S ++    
Sbjct: 110 SEKPTR-FWLEMLAN----TGRSVDNLWQDIKSLLGFIGLALETLLGTLFRPSRWRIT-- 162

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  
Sbjct: 163 --SLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFA 220

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT 
Sbjct: 221 VLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTF 280

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   EG
Sbjct: 281 IGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEG 340

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 341 FKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|119945392|ref|YP_943072.1| hypothetical protein Ping_1681 [Psychromonas ingrahamii 37]
 gi|119863996|gb|ABM03473.1| hypothetical protein DUF140 [Psychromonas ingrahamii 37]
          Length = 383

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 200/384 (52%), Gaps = 28/384 (7%)

Query: 2   SENGITVFRFAGNWKSPEISEI----ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAEL 57
           + +G  +FR  G+W +  +  +      +  +  N S+Q D     +S + ++D+ G  L
Sbjct: 16  NNSGSILFRCQGDWTAKALQNVLRYLEKEAGILFNMSVQWD-----VSGVGKVDSAGIML 70

Query: 58  IMYF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHI 114
            +++   ++  H  ++L G  +  + L+ L+    R  +  Q   +    +       +I
Sbjct: 71  YIHYHDLLKLQHCTVELTGARSEYQNLYQLL----RSHVSQQAVSKPGLLSRLLLPFTNI 126

Query: 115 GK---KIVKFINDSCS--QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVP 169
           GK    + + IND  +    H   L+ S       SS ++     S+++ +   GV  +P
Sbjct: 127 GKSTENLWRDINDFLTFIGEHSAALLTSLRH---PSSIRYA----SIVKNIEEAGVRALP 179

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           +V L S + G VI  Q A QL +FGA IF +D++ I   RE+  L+TA+++AGR+GS+  
Sbjct: 180 IVALTSCLIGVVITYQSALQLQKFGANIFIVDMIGISVTRELAPLITAIVVAGRTGSSYT 239

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A++G+M I EEI A+RTMG +  R L+ PRI AL+I +PLL + A+   I G  IV   +
Sbjct: 240 AQLGAMTITEEISAMRTMGFEPHRFLVLPRIIALMIVMPLLILFADVIGIAGGMIVSNIH 299

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            +I +A F  R      + +++ GL K PF A  I I     GF V  ++ SLG+  T  
Sbjct: 300 LNISYAEFIHRLQHVLDIKHLWIGLFKGPFFAWLIAITGCFRGFQVASNTESLGRYTTIS 359

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV +I +VI  D+LF++ +  +G+
Sbjct: 360 VVNAIFLVIACDALFSVIFTELGL 383


>gi|325273982|ref|ZP_08140141.1| hypothetical protein G1E_12667 [Pseudomonas sp. TJI-51]
 gi|324100871|gb|EGB98558.1| hypothetical protein G1E_12667 [Pseudomonas sp. TJI-51]
          Length = 374

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 198/372 (53%), Gaps = 25/372 (6%)

Query: 16  KSPEISEIADDVVMAINKSIQSDS----------AIVDLSAITEIDTIGAELIMYFMEKY 65
           + P    IA D  +A   S++ DS           + DLS +  +DT GA L+   +   
Sbjct: 12  RQPACLRIAGDWTLAHYASLKRDSERLRAQYTPDTVADLSQLGRLDTAGASLLAELL--- 68

Query: 66  HGKIKLQGVSTHIEQ-----LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
            G  +L   +  + +     L ++        I  ++P+R    N    L   IG  +  
Sbjct: 69  -GTERLSRCTHDLPEASRALLKNVYQSVQDYCIPVKEPER----NVLLLLLERIGCAVGT 123

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              DS      +G+++          ++++  +  ++  +   G+   P+V L++F+ GA
Sbjct: 124 LWQDSMQLLGFIGVILETLLRRALQPHRWR--ITPVVAHIEQTGLDAAPIVALLTFLVGA 181

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A  GA  L+ FGA +F++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEE
Sbjct: 182 VVAFLGATVLADFGATVFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEE 241

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRT+GL+ + +L+ PR+ AL+I+LPLLT +A    I+G ++V      I  A+F S 
Sbjct: 242 IDAIRTLGLNPMELLVVPRVLALLITLPLLTFVAMLCGIVGGAVVCALSLGISPAMFLSL 301

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             S   + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++
Sbjct: 302 LQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVL 361

Query: 361 DSLFAIFYFAIG 372
           D++ A+F+  +G
Sbjct: 362 DAVAALFFMEMG 373


>gi|238791990|ref|ZP_04635626.1| ABC transporter, permease protein [Yersinia intermedia ATCC 29909]
 gi|238728621|gb|EEQ20139.1| ABC transporter, permease protein [Yersinia intermedia ATCC 29909]
          Length = 381

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 109/280 (38%), Positives = 162/280 (57%), Gaps = 11/280 (3%)

Query: 95  NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNT--GEFCASSYKFKGF 152
           ++KP R F+     N     G+ +     D  S    +GL +       F  S ++    
Sbjct: 110 SEKPAR-FWLEMLAN----TGRSVDNLWQDIKSLLGFIGLALETLLGTLFRPSRWRIT-- 162

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  
Sbjct: 163 --SLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFA 220

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT 
Sbjct: 221 VLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTF 280

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   EG
Sbjct: 281 IGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEG 340

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 341 FKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|313496513|gb|ADR57879.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 374

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 198/369 (53%), Gaps = 17/369 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +    +     +D+ + DLS +  +DT GA L+   +    G 
Sbjct: 17  LRITGDWTLAHYASLKRES-ERLRSQCPADT-VADLSQLGRLDTAGASLLAELL----GS 70

Query: 69  IKLQGVSTHIEQ-----LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
            +L   +  + +     L ++        I  ++P+R    N    L   IG+ +     
Sbjct: 71  ERLSRCTHALPEASQALLKNVYCSVQDYCIPVKEPER----NVLLLLLERIGRAVGTLWQ 126

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           DS      +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A
Sbjct: 127 DSMQLLGFVGVILETLLRRAFQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVA 184

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA  L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDA
Sbjct: 185 FLGATVLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDA 244

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           IRT+GL+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S
Sbjct: 245 IRTLGLNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAMFLSLLQS 304

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++
Sbjct: 305 DIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAV 364

Query: 364 FAIFYFAIG 372
            A+F+  +G
Sbjct: 365 AALFFMEMG 373


>gi|238751983|ref|ZP_04613468.1| ABC transporter, permease protein [Yersinia rohdei ATCC 43380]
 gi|238709817|gb|EEQ02050.1| ABC transporter, permease protein [Yersinia rohdei ATCC 43380]
          Length = 381

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/218 (44%), Positives = 143/218 (65%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  VL
Sbjct: 163 SLIANVQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFAVL 222

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT + 
Sbjct: 223 LTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTFIG 282

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I G  +V     +I   +F S   ++  L +   G+ KAP  A  I I+   EGF 
Sbjct: 283 MVCGIFGGMVVCALELNISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEGFK 342

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G+  TT VVQSI +VI++D++ A+F+  +G
Sbjct: 343 VTGSAESVGEHTTTSVVQSIFVVILLDAIAALFFMEMG 380


>gi|26986887|ref|NP_742312.1| hypothetical protein PP_0142 [Pseudomonas putida KT2440]
 gi|24981490|gb|AAN65776.1|AE016203_9 ABC transporter, permease protein, putative [Pseudomonas putida
           KT2440]
          Length = 377

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 122/369 (33%), Positives = 198/369 (53%), Gaps = 17/369 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +    +     +D+ + DLS +  +DT GA L+   +    G 
Sbjct: 20  LRITGDWTLAHYANLKRES-ERLRSHCPADT-VADLSQLGRLDTAGASLLAELL----GS 73

Query: 69  IKLQGVSTHIEQ-----LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
            +L   +  + +     L ++        I  ++P+R    N    L   IG+ +     
Sbjct: 74  ERLSHCTHALPEASQALLKNVYCSVQDYCIPVKEPER----NVLLLLLERIGRAVGTLWQ 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           DS      +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A
Sbjct: 130 DSMQLLGFVGVILETLLRRAFQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA  L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDA
Sbjct: 188 FLGATVLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           IRT+GL+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S
Sbjct: 248 IRTLGLNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAMFLSLLQS 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++
Sbjct: 308 DIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAV 367

Query: 364 FAIFYFAIG 372
            A+F+  +G
Sbjct: 368 AALFFMEMG 376


>gi|123441584|ref|YP_001005570.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088545|emb|CAL11339.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 381

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 164/281 (58%), Gaps = 11/281 (3%)

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISN--TGEFCASSYKFKG 151
            ++KP  SF+     N     G+ +     D  S    +GL +    +  F  S ++   
Sbjct: 109 SSEKPP-SFWLEFLAN----TGRSVDNLWQDIKSLLGFVGLTLEALFSTIFRPSRWR--- 160

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
            + SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE 
Sbjct: 161 -MTSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREF 219

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
            VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT
Sbjct: 220 AVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLT 279

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
            +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   E
Sbjct: 280 FIGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLE 339

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           GF V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 340 GFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|330861182|emb|CBX71439.1| hypothetical protein YEW_CA08640 [Yersinia enterocolitica W22703]
          Length = 381

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 164/281 (58%), Gaps = 11/281 (3%)

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISN--TGEFCASSYKFKG 151
            ++KP  SF+     N     G+ +     D  S    +GL +    +  F  S ++   
Sbjct: 109 SSEKPP-SFWLEFLAN----TGRSVDNLWQDIKSLLGFVGLTLEALFSTIFRPSRWR--- 160

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
            + SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE 
Sbjct: 161 -MTSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREF 219

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
            VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT
Sbjct: 220 AVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLT 279

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
            +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   E
Sbjct: 280 FIGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLE 339

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           GF V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 340 GFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|332162490|ref|YP_004299067.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666720|gb|ADZ43364.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 354

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 163/281 (58%), Gaps = 11/281 (3%)

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISN--TGEFCASSYKFKG 151
            ++KP  SF+     N     G+ +     D  S    +GL +    +  F  S ++   
Sbjct: 82  SSEKPP-SFWLEFLAN----TGRSVDNLWQDIKSLLGFVGLTLEALFSTIFRPSRWRMT- 135

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
              SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE 
Sbjct: 136 ---SLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREF 192

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
            VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT
Sbjct: 193 AVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLT 252

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
            +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   E
Sbjct: 253 FIGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLE 312

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           GF V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 313 GFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 353


>gi|223040212|ref|ZP_03610491.1| ABC transport system permease [Campylobacter rectus RM3267]
 gi|222878573|gb|EEF13675.1| ABC transport system permease [Campylobacter rectus RM3267]
          Length = 378

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 111/345 (32%), Positives = 182/345 (52%), Gaps = 26/345 (7%)

Query: 38  DSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIK--- 94
           D  +++   + E+D   A  +   +       +L  ++ H +++F+ I+     KIK   
Sbjct: 51  DKIVLNFKDVKELDYAAALFLKNTLLNARKNYELVNLTPHAQRIFASINSEVNPKIKQII 110

Query: 95  NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLL 154
           N KP         +N    IGK +        +        ++ TGEF     K   F+L
Sbjct: 111 NAKPH--------ENPLSQIGKNLA-------AFFAGFCAFLNFTGEFLVKFSKI--FML 153

Query: 155 SLIR----QMYY--VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL 208
             IR      Y+   G+  V +V L SF+ G V+A QG+  L +FGA I  +++M +L L
Sbjct: 154 KNIRVKEILAYFEDAGIKSVFIVCLTSFLIGIVLAYQGSNLLERFGATIIIVEMMGLLTL 213

Query: 209 REIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLP 268
           REI  L+ A+++AGR  S+  A+IG MKI EEIDA++TMG D  + L+ PR+ ALI+++P
Sbjct: 214 REIAPLIAAIIVAGRLASSFTAQIGVMKITEEIDAMKTMGFDPFKFLVLPRVIALIVAMP 273

Query: 269 LLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVA 328
           L+  LA+ + I G  +V+  Y +I F  + +RF     + +++ GL KAPF    I  + 
Sbjct: 274 LIVFLADVAGIFGEMVVMENYLNIGFDSYLARFEQEVEIKHLYVGLFKAPFFGVVIAFIG 333

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              GF +  ++ S+G   T  VV +I  VI++D+LF++ +  +GI
Sbjct: 334 CMRGFQISGNTQSVGTYTTVSVVNAIFGVIMVDALFSVIFTHLGI 378


>gi|139001578|dbj|BAF51698.1| putative innermembrane component of ABC transporter system
           [Sphingobium japonicum]
          Length = 316

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 141/218 (64%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           +++++   VGVS + ++ L+SF+ G VIAQQG+ QL QFG E+ +I+L+  L  RE+GVL
Sbjct: 97  AVVQRFEVVGVSALGIIGLMSFLIGIVIAQQGSVQLRQFGMEMLTINLVGRLTFRELGVL 156

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           +TA+M+AGRSGSA  A++G+MK+ EE+DA+RT+G+  +  L+ PR  A+++ +PLL   +
Sbjct: 157 MTAIMVAGRSGSAFAAQLGTMKLTEEVDAMRTIGVSPMEALVLPRTLAVVVMMPLLGFYS 216

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           +  AIIG   +     DIP   F  R      + +++ GLIKAP     I +    +G  
Sbjct: 217 SIVAIIGGGFLCAVSLDIPPITFVQRLREVVPIHDLWVGLIKAPVFGVIIALAGCFQGMQ 276

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V  ++  +G + T  VVQ+I +VI+ID+ FA+F+  +G
Sbjct: 277 VKANAEEVGLRTTAAVVQAIFLVIVIDAFFAVFFTWVG 314


>gi|318606570|emb|CBY28068.1| ABC-type transport system involved in resistance to organic
           solvents, permease component USSDB6A [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 354

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/281 (38%), Positives = 163/281 (58%), Gaps = 11/281 (3%)

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISN--TGEFCASSYKFKG 151
            ++KP  SF+     N     G+ +     D  S    +GL +    +  F  S ++   
Sbjct: 82  SSEKPP-SFWLEFLAN----TGRSVDNLWQDIKSLLGFVGLTLEVLFSTIFRPSRWRMT- 135

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
              SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE 
Sbjct: 136 ---SLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREF 192

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
            VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT
Sbjct: 193 AVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLT 252

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
            +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   E
Sbjct: 253 FIGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLE 312

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           GF V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 313 GFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 353


>gi|148545417|ref|YP_001265519.1| hypothetical protein Pput_0160 [Pseudomonas putida F1]
 gi|148509475|gb|ABQ76335.1| protein of unknown function DUF140 [Pseudomonas putida F1]
          Length = 377

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 123/372 (33%), Positives = 199/372 (53%), Gaps = 23/372 (6%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSA---IVDLSAITEIDTIGAELIMYFMEKY 65
            R  G+W     + +  +     ++ +++  A   I DLS +  +DT GA L+   +   
Sbjct: 20  LRITGDWTLAHYANLKRE-----SERLRTQCAANTIADLSQLGRLDTAGASLLAELL--- 71

Query: 66  HGKIKLQGVSTHIEQ-----LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
            G  +L   +  + +     L ++        I  ++P+R    N    L   IG  +  
Sbjct: 72  -GSERLSRCTHALPEASQALLKNVYCSVQDYCIPVKEPER----NVLLLLLERIGCAVGT 126

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              DS      +G+++          ++++     ++  +   G+   P+V L++F+ GA
Sbjct: 127 LWQDSMQLLGFVGVILETLLRRAFQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGA 184

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A  GA  L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEE
Sbjct: 185 VVAFLGATVLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEE 244

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRT+GL+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S 
Sbjct: 245 IDAIRTLGLNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAMFLSL 304

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             S   + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++
Sbjct: 305 LQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVL 364

Query: 361 DSLFAIFYFAIG 372
           D++ A+F+  +G
Sbjct: 365 DAVAALFFMEMG 376


>gi|121998618|ref|YP_001003405.1| hypothetical protein Hhal_1839 [Halorhodospira halophila SL1]
 gi|121590023|gb|ABM62603.1| protein of unknown function DUF140 [Halorhodospira halophila SL1]
          Length = 376

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 182/338 (53%), Gaps = 16/338 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKN--QKPQ 99
           VDLSA+  +DT GA L+   +    G  +++ ++    +L    S   RK ++      +
Sbjct: 47  VDLSALGRLDTAGATLLARLL----GAARVEALARSTPEL----SAERRKLLQAVAAASE 98

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTG----EFCASSYK-FKGFLL 154
           R+      +   Y +G+  +          H L   I  TG     F A   + ++  L 
Sbjct: 99  RARTAPEPRGDPYFLGQLTIGLGAQMTHAGHQLARAIGFTGLVIAAFAAGLLRPWRWRLA 158

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           ++ RQ+ +  +  +P+V L++F  GAVIA  G   L +FGA IF++DL++   LRE GV+
Sbjct: 159 AVSRQLQHTALEALPIVALLTFAVGAVIAVLGVTVLGRFGAGIFTVDLVAYAFLREFGVV 218

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGRS SA  A+IGSMK NEE+DA+R  G   + +L+ PR+ AL+I++PLL+ +A
Sbjct: 219 LTAILLAGRSASAFTAQIGSMKANEELDAMRAQGFSPIEMLVIPRVVALLIAVPLLSFVA 278

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               + G  +V     D+P     +  +S  ++++   GL KAP  A  I I+   EG  
Sbjct: 279 VVCGLAGGGLVTLLNVDVPAGRIIA-LYSDISVSHYLAGLAKAPIFAFVIAIIGCLEGIK 337

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               + S+G   T+ VVQSI  VII++++ A+ Y  +G
Sbjct: 338 CSASAQSVGTHTTSAVVQSIFWVIILNAVAALIYVELG 375


>gi|238764189|ref|ZP_04625142.1| ABC transporter, permease protein [Yersinia kristensenii ATCC
           33638]
 gi|238697602|gb|EEP90366.1| ABC transporter, permease protein [Yersinia kristensenii ATCC
           33638]
          Length = 381

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/218 (44%), Positives = 141/218 (64%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  VL
Sbjct: 163 SLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFAVL 222

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL++SLP+LT + 
Sbjct: 223 LTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLVSLPMLTFIG 282

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   EGF 
Sbjct: 283 MVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEGFK 342

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 343 VTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|104779408|ref|YP_605906.1| ABC transporter permease [Pseudomonas entomophila L48]
 gi|95108395|emb|CAK13089.1| putative ABC transporter, permease protein [Pseudomonas entomophila
           L48]
          Length = 374

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/374 (33%), Positives = 200/374 (53%), Gaps = 13/374 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++   T    AG+W     + +  +       S   D   VDLS +  +DT GA L+   
Sbjct: 10  TQQQPTRLHIAGDWTLAHYASLKRECERL--GSQYGDDTQVDLSQLGRLDTAGASLLAEL 67

Query: 62  M--EKY-HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           +  E+  H    L   S  +  L ++        I  ++P++         L   IG+ +
Sbjct: 68  LGSERLSHCTDDLPDASRAL--LKNVYCSVQDYCIPVKQPEQPVLLL----LLARIGRAV 121

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
            +   D+      +GL++          ++++  +  ++  +   G+   P+V L++F+ 
Sbjct: 122 DQLWQDTRQVLGFIGLILETLLLRLFQPHRWR--VTPVVAHLEQTGLDAAPIVALLTFLV 179

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GAV+A  GA  L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK N
Sbjct: 180 GAVVAFLGATVLAAFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKAN 239

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDAIRT+GL+ + +L+ PR+ AL+I+LPLLT LA    ++G ++V     DI  A+F 
Sbjct: 240 EEIDAIRTLGLNPIELLVVPRVLALLIALPLLTFLAMLCGLVGGAVVCALTLDISPAMFL 299

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           S   S   + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI
Sbjct: 300 SLLQSDIGVQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVI 359

Query: 359 IIDSLFAIFYFAIG 372
           ++D++ A+F+  +G
Sbjct: 360 VLDAVAALFFMEMG 373


>gi|238789963|ref|ZP_04633742.1| ABC transporter, permease protein [Yersinia frederiksenii ATCC
           33641]
 gi|238721911|gb|EEQ13572.1| ABC transporter, permease protein [Yersinia frederiksenii ATCC
           33641]
          Length = 381

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 112/306 (36%), Positives = 173/306 (56%), Gaps = 7/306 (2%)

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSF-KNLHYHIGKKIVKFINDSCSQ 128
           KL+ ++  + Q   ++  T    +   +P+ S    SF   L  + G+ +     D  S 
Sbjct: 79  KLRELAPKLPQERRVLLETVSHVLPGLEPESSEKPPSFWLELLANTGRSMDNLWQDIKSL 138

Query: 129 AHILGLVISNT--GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
              +GL +       F  S ++      SLI  +  +G++ VP+++L++F+ GAVIA  G
Sbjct: 139 LGFVGLTLEALFGTVFRPSRWRVT----SLIANVQQIGLNAVPIIMLLTFLVGAVIAFLG 194

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T
Sbjct: 195 ATVLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQT 254

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ V +L+ PR+ AL+ISLP+LT +     I G  +V     +I   +F S   ++  
Sbjct: 255 LGLNPVELLVLPRVLALLISLPMLTFIGMVCGIFGGMVVCALTLNISPTMFLSIMQNSNG 314

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+
Sbjct: 315 LQHFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAAL 374

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 375 FFMEMG 380


>gi|116051201|ref|YP_789968.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218890596|ref|YP_002439460.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
 gi|254236173|ref|ZP_04929496.1| hypothetical protein PACG_02138 [Pseudomonas aeruginosa C3719]
 gi|254241899|ref|ZP_04935221.1| hypothetical protein PA2G_02620 [Pseudomonas aeruginosa 2192]
 gi|115586422|gb|ABJ12437.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168104|gb|EAZ53615.1| hypothetical protein PACG_02138 [Pseudomonas aeruginosa C3719]
 gi|126195277|gb|EAZ59340.1| hypothetical protein PA2G_02620 [Pseudomonas aeruginosa 2192]
 gi|218770819|emb|CAW26584.1| probable permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
          Length = 381

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  VL
Sbjct: 163 PLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFAVL 222

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT + 
Sbjct: 223 LTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTFVG 282

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EGF 
Sbjct: 283 MLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEGFK 342

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 343 VSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 380


>gi|313108528|ref|ZP_07794529.1| putative permease of ABC transporter [Pseudomonas aeruginosa 39016]
 gi|310881031|gb|EFQ39625.1| putative permease of ABC transporter [Pseudomonas aeruginosa 39016]
          Length = 343

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  VL
Sbjct: 125 PLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFAVL 184

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT + 
Sbjct: 185 LTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTFVG 244

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EGF 
Sbjct: 245 MLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEGFK 304

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 305 VSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 342


>gi|152984282|ref|YP_001347296.1| ABC transporter permease [Pseudomonas aeruginosa PA7]
 gi|150959440|gb|ABR81465.1| probable permease of ABC transporter [Pseudomonas aeruginosa PA7]
          Length = 381

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  VL
Sbjct: 163 PLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFAVL 222

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT + 
Sbjct: 223 LTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTFVG 282

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EGF 
Sbjct: 283 MLCGIVGGMTVCAWSLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEGFK 342

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 343 VSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 380


>gi|107102741|ref|ZP_01366659.1| hypothetical protein PaerPA_01003808 [Pseudomonas aeruginosa PACS2]
          Length = 372

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  VL
Sbjct: 154 PLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFAVL 213

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT + 
Sbjct: 214 LTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTFVG 273

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EGF 
Sbjct: 274 MLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEGFK 333

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 334 VSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 371


>gi|222823161|ref|YP_002574734.1| ABC transporter permease (DUF140 domain protein) [Campylobacter
           lari RM2100]
 gi|222538382|gb|ACM63483.1| putative ABC transporter, permease protein (DUF140 domain protein)
           [Campylobacter lari RM2100]
          Length = 370

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 196/377 (51%), Gaps = 34/377 (9%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +N   +F   G W    + ++ + +     K+I     I D + +  IDT G   I YF+
Sbjct: 10  KNHECIFSVFGIWDKTSVGKL-EKLDFPTQKNI-----IFDFTNLDFIDTAG---IRYFL 60

Query: 63  EKYHGKIKLQG-------VSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIG 115
                ++K +G       + +   +LF L    H K   +    +    + F+NL    G
Sbjct: 61  A-LENELKQKGFELSRVNLKSEHAKLFELCQ-KHYKSFCDSYEDKKTIKDFFENL----G 114

Query: 116 KKIVKFINDSCSQAHILGLVISNTGE--FCASSYKFKGFLLSLIRQMYYV---GVSGVPV 170
           KK+V+         + +GL+I+      F     +F+ FL       Y+V    ++ +P+
Sbjct: 115 KKVVESFTLLVQFLNFIGLIIATCFNTLFHLKKLRFRAFL-------YHVENSAINALPI 167

Query: 171 VILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVA 230
           ++L S + G V+A Q A+QL+QFGA I+ +DLM I   RE+  L++A++IAGRS S+  A
Sbjct: 168 IMLTSLLVGVVLAYQAAYQLAQFGANIYIVDLMGISATRELAPLISAIVIAGRSASSYTA 227

Query: 231 EIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYY 290
           +IG MK+ +EIDA++TMG      +I PR+ AL +++PL+ I+A+  +IIG  IV W   
Sbjct: 228 QIGVMKLTDEIDAMKTMGFKESEFIILPRVLALALAMPLVVIVADILSIIGGIIVAWFSL 287

Query: 291 DIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCV 350
           +I  + F SRF     L +I  GLIKAP     I  +A   GF V   + S+G   T  V
Sbjct: 288 EISASEFMSRFKEAVELKHIIIGLIKAPIFGFLIASIACFRGFFVQKTTESIGVYTTKSV 347

Query: 351 VQSISIVIIIDSLFAIF 367
           V +I  VI  D++F++F
Sbjct: 348 VNAIFWVIAFDAIFSVF 364


>gi|296388302|ref|ZP_06877777.1| ABC transporter permease [Pseudomonas aeruginosa PAb1]
          Length = 343

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 138/218 (63%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  VL
Sbjct: 125 PLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFAVL 184

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT + 
Sbjct: 185 LTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTFVG 244

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EGF 
Sbjct: 245 MLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEGFK 304

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 305 VSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 342


>gi|224371971|ref|YP_002606137.1| ABC-type transporter, permease protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223694690|gb|ACN17973.1| ABC-type transporter, permease protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 373

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 119/342 (34%), Positives = 182/342 (53%), Gaps = 22/342 (6%)

Query: 41  IVDLSAITEIDTIGAELIMY----FMEKYHGKIKLQGVSTHIEQLFSL---ISFTHRKKI 93
           ++DL  +  +D+ GA L+ +    + ++  GKI + G+    +Q+  L   I  T   + 
Sbjct: 45  VIDLKRVDHMDSAGAALVWFIKTTWKQRTGGKISVLGLKPAFKQVMDLTETIPDTRDGEK 104

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFIN--DSCSQAHILGLVISNTGEFCASSYKFKG 151
           K +K   SF     KN    + +K   FI      ++A I          F   S ++K 
Sbjct: 105 KPKKKPPSFVETRGKNFADQM-EKATSFIALVGQITRALIHAF-------FHPLSVRWKD 156

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
            LL+  R     GV+ +P+V LISF+ G V+A Q A  +  FGAEI+  +L+ I  +RE+
Sbjct: 157 ALLTAERS----GVNALPIVALISFIVGLVMAFQAAMPMKMFGAEIYVANLIGIAMVREL 212

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
           G L+TA+++AGRSGSA  AEIG+MKINEEIDA+ TMGLD VR L+ PRI A +   PLLT
Sbjct: 213 GPLMTAIILAGRSGSAFAAEIGTMKINEEIDALSTMGLDPVRFLMVPRILAAVFITPLLT 272

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
           I +NF  I+G SIV+      P   ++S+  S  T  +   GL+K       I       
Sbjct: 273 IFSNFVGIMGGSIVLLS-MGYPAITYYSQVISFVTWIDFTGGLVKCFVFGILISAAGCIR 331

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G        ++G   T+ VV  I+++ + D +F++ ++ +GI
Sbjct: 332 GIETQSGPGAVGASTTSAVVTGITLIAVFDGIFSVLFYCLGI 373


>gi|28974221|gb|AAO64222.1| putative ABC transport system permease protein Cf0016
           [Campylobacter fetus]
          Length = 367

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/343 (32%), Positives = 181/343 (52%), Gaps = 19/343 (5%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           +S++ D+  +DL  +  ID   A     F  K++   KL   +   +++F+L+S  +   
Sbjct: 42  RSLKVDT--LDLKNLIRIDYSAAT----FFAKHYNCPKLINSNDKFDKIFALVSDKYILN 95

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSY--KFK 150
           ++  K ++S       NL   IGK I+   N+  S    LG  + N  +   + +  +FK
Sbjct: 96  LQIIKFKKS-------NLIEQIGKNIINLKNELVSFCIFLGEFLFNLTKSLLNPFTVRFK 148

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
                L    Y  G+S V +V L SF+ G V+A QGA  L  FGA I+ +D+M I+ LRE
Sbjct: 149 ----ELSNHFYSAGISAVFIVCLTSFLIGIVLAYQGATMLENFGASIYVVDIMGIMTLRE 204

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G L+ A+++AGRS S+  A+IG MKI +E++A++TMG +  R ++ P  +         
Sbjct: 205 VGPLIAAIVVAGRSASSYTAQIGVMKITDELEAMKTMGFEPFRFIVMPACFGSYFGYAFY 264

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
           +I +      G  +V   Y D+ F+ +  RF S+  L + + GL KAPF    I ++  K
Sbjct: 265 SIFSKRGKYFGQMMVCNWYLDLSFSDYLERFRSSIALRHFWVGLFKAPFFGAVIALIGCK 324

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            GF V   +NS+G+  T  VV +I  +I +D++F+I Y  + I
Sbjct: 325 RGFEVSGSTNSVGELTTRSVVNAIFWIIALDAIFSIIYTELKI 367


>gi|218658451|ref|ZP_03514381.1| probable ABC transporter, permease protein [Rhizobium etli IE4771]
          Length = 184

 Score =  169 bits (429), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 117/155 (75%)

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           ++MIAGRSGSAI AEIGSMK+ EEIDA++ MGL+ + +LI PR+ AL I+LPLLT+LANF
Sbjct: 28  SIMIAGRSGSAITAEIGSMKMREEIDALKVMGLNPIGVLIFPRLVALTIALPLLTVLANF 87

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           +++ GA+ V W Y  I FA F +R H   TL+ + +G+IKAPFMA  IGIVA  EG  VG
Sbjct: 88  ASLAGAAAVAWGYSGITFANFLARLHEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVG 147

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
             + SLG+ VT  VV++I +VI++D LFA+FY AI
Sbjct: 148 GSAESLGQHVTASVVKAIFVVILMDGLFAMFYAAI 182


>gi|311694463|gb|ADP97336.1| ABC transporter, permease protein [marine bacterium HP15]
          Length = 388

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 101/331 (30%), Positives = 181/331 (54%), Gaps = 3/331 (0%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           ++LS +T IDT GA  +   +      ++     + + +  S +     + +KNQ     
Sbjct: 60  INLSGLTRIDTAGASQLASLIGPER-LLEAASADSELPRETSALIAAVCEAMKNQPEADR 118

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
              +   +     G+K+             +G  +          ++++  +   +  ++
Sbjct: 119 RSPSLVWSFVTGTGQKVESIFRLLWILVGFIGQTLGTLAWNLPRPWRWR--MTPFVAAVH 176

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
             G++ +P+V L++F+ GAV+A  GA  L  FGA I++++L++   LRE GVLL A+++A
Sbjct: 177 DTGLNALPIVALLTFLVGAVVAFLGATVLDDFGATIYTVNLVAFSFLREFGVLLAAILLA 236

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GR+ SA  A IG+MK+NEE+DAIRT+GL+ + +L+ PR+ A+++SLP+LT +   S ++G
Sbjct: 237 GRTASAFTAHIGAMKVNEELDAIRTLGLNPIELLVLPRVMAMMVSLPILTFVGMISGMVG 296

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
            ++V     DI    F +       L +   G++KAP  A  I ++   EGF V   + S
Sbjct: 297 GAMVCALVLDITPTQFMAIVERDIALQHFVVGIVKAPIFAFLIAVIGCLEGFKVAGSAQS 356

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           +G+  T+ VVQSI +VI++DS+ A+F+  +G
Sbjct: 357 VGEHTTSSVVQSIFMVILLDSIAALFFMEMG 387


>gi|157736379|ref|YP_001489062.1| ABC transporter, permease protein [Arcobacter butzleri RM4018]
 gi|157698233|gb|ABV66393.1| ABC transporter, permease protein [Arcobacter butzleri RM4018]
          Length = 370

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 109/333 (32%), Positives = 180/333 (54%), Gaps = 12/333 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGK-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQR 100
           +D + + E D+     ++ F+  +  K I +     H E++F      ++ K+  ++ ++
Sbjct: 49  IDFANLKECDSSAIIYLISFLNTFEEKNITILNNKNH-EKIFDFYKKHYQTKVL-EEEKK 106

Query: 101 SFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQM 160
           + F+       Y I K+  +FI       +     I     F  S  +FK    ++++ +
Sbjct: 107 NLFFEDLGKKSYDIYKESKEFIGFIGKVFYFFIYAI-----FNPSKIRFK----AMLKYI 157

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
                  + +V + SF+ G VIA QG+ QL +FGA IF ++++SI   REI  L+TA++I
Sbjct: 158 ETSAFDALLIVAVTSFLVGVVIAYQGSVQLEKFGANIFIVEMISITIFREIAPLVTAIVI 217

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRS S+  AEIG+MKI EEIDA++TM  +    L  PRI+AL ISLPLL   A+   + 
Sbjct: 218 AGRSASSYTAEIGAMKITEEIDAMKTMNFEPTLFLTLPRIFALCISLPLLVFFADIIGVF 277

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  ++     D+ F  F +R H+   L ++  G+ KA F   AI I+    GF V  ++ 
Sbjct: 278 GGMVIASSSLDVTFIEFINRLHNEVPLKHLILGVFKALFFGFAIAIIGCYRGFQVQNNTT 337

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S+GK  T  VV +I +VI+ID++F++ +  +GI
Sbjct: 338 SIGKFTTMSVVNAIFVVILIDAVFSVIFTQMGI 370


>gi|329890329|ref|ZP_08268672.1| hypothetical protein BDIM_20300 [Brevundimonas diminuta ATCC 11568]
 gi|328845630|gb|EGF95194.1| hypothetical protein BDIM_20300 [Brevundimonas diminuta ATCC 11568]
          Length = 372

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/378 (29%), Positives = 201/378 (53%), Gaps = 22/378 (5%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAIN-KSIQSDSAIVDLSAITEIDTIGAELIMY 60
           S++G T  R AG+W +  +  + D +   ++ +S+ +    +DL  +   DT GA  +  
Sbjct: 11  SQDGQTRLRLAGDWSTVAVGRMGDRLKAELDGRSVTA----LDLDDLGRFDTAGALAVAQ 66

Query: 61  FMEKYHGKIKLQGVSTHIE--QLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            M +    I     S   E  +L+ +++      +  + P+RS            +G+ +
Sbjct: 67  AMSR---PIPESAWSVRPEAGRLYRMVA--KLDCMTAEPPRRS---APMTRGFAKVGRGV 118

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFL--LSLIRQMYYVGVSGVPVVILISF 176
             F  ++      LG +++       ++ K  G +   +   Q    G+  +P+V++ +F
Sbjct: 119 YDFGAEAMLSLAFLGRLMAA----VLTTLKHPGRIRWAAWFSQAERTGLDAIPIVVVTNF 174

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
             GAV+A  G   L+QFGA +F++ L+ +   RE  V++TAV++AGRS S+  AEIGSM+
Sbjct: 175 FIGAVVAFIGVDLLTQFGAGVFTVQLIGVAVFREFAVVITAVLLAGRSASSFAAEIGSMR 234

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + +E+DA++ MG+D  + L+ PR+ AL++ LPLLT LA    ++G  +V W   ++  A 
Sbjct: 235 MTQEVDAMKVMGVDPFQALVIPRLAALLVMLPLLTFLAMVGGLLGGVLVAWSQLNLGPAF 294

Query: 297 FFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
           FF R      +  ++  GLIKAP  A  +  +  ++G +V     SLG++VT  VVQ+I 
Sbjct: 295 FFQRLVEDGYMPTHMMVGLIKAPVFALVVAAIGCRQGMSVAGDVESLGRRVTAAVVQAIF 354

Query: 356 IVIIIDSLFAIFYFAIGI 373
            +I++D++FA+ +  + I
Sbjct: 355 AIILLDAVFALIFIELKI 372


>gi|220934666|ref|YP_002513565.1| protein of unknown function DUF140 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995976|gb|ACL72578.1| protein of unknown function DUF140 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 375

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 111/379 (29%), Positives = 197/379 (51%), Gaps = 23/379 (6%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMY 60
           S  G+ V R AG      +S +  + +  +   ++S   + VD S +   D  G  L++ 
Sbjct: 13  SPKGV-VLRLAGRLDVHTVSTVWGEALAGLK--VRSGRPVRVDTSGVDYCDGAGVALVVD 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFS-LISFTHRK-KIKNQKPQRSF-FYNSFKNLHYHIGKK 117
            + +        G+    E++   L+ F  R    +   PQR         N  + +G+ 
Sbjct: 70  LLRQPRDPGAEVGLGETPEEVRRMLVPFDVRDFSGEAVPPQRGPGLKQHLANGMHDLGRY 129

Query: 118 I---VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
           +   V F+ ++ +              F A+ +  +      +      G + +P+V+LI
Sbjct: 130 LYLQVAFVGEATAAM------------FHAARHPRQVRWRDALNLAQEAGANALPIVMLI 177

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           +F+ G ++A Q A  + QFGAEIF  +L+++  LRE+  L+TA+++AGRSG+A  AEIG+
Sbjct: 178 AFLMGVILAFQSAVAMRQFGAEIFVANLVALSLLRELAPLMTAILLAGRSGAAFAAEIGT 237

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MK+NEEI+A+ TMGLD VR L+  R+ A +  +PLLT++AN   ++G ++V+ K +DIPF
Sbjct: 238 MKVNEEINALTTMGLDPVRFLVVTRVLAAVAVMPLLTLVANLVGLVGGAVVM-KGFDIPF 296

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             +F++  S  TL+++  GL KA      +  V    G      + ++G   T  VV +I
Sbjct: 297 VTYFNQVTSAVTLSDLLGGLFKATVFGLLVAGVGCLRGLETRSGAAAVGISTTRAVVSAI 356

Query: 355 SIVIIIDSLFAIFYFAIGI 373
            ++++ D +FA+ ++ + I
Sbjct: 357 ILIVVADGVFAVVFYHLDI 375


>gi|256828281|ref|YP_003157009.1| protein of unknown function DUF140 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577457|gb|ACU88593.1| protein of unknown function DUF140 [Desulfomicrobium baculatum DSM
           4028]
          Length = 380

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/353 (29%), Positives = 185/353 (52%), Gaps = 17/353 (4%)

Query: 17  SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM---EKYHGKIKLQG 73
           +PEI +    + + + + I++D     LS +T +D  GA +I+      EK    +K+ G
Sbjct: 35  TPEIMDRLAQLPLPLPRRIRAD-----LSGVTRMDDCGALVILQLRRMAEKNGCDLKMHG 89

Query: 74  VSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILG 133
              H+++L   +         +  PQ      +  +     G K +   N + +    +G
Sbjct: 90  TPGHVQELLDFLRL-------DDPPQSVGIKRAKPDFMTRFGIKTLDVTNQAVTHVSFVG 142

Query: 134 LVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQF 193
            V+           + +  L   +  M  VGV  +P+V LISF+ G ++A   A QL QF
Sbjct: 143 EVVVTLLSLLRHPDRLR--LGDTVLYMQRVGVDALPIVGLISFLLGLIMAFMSAVQLQQF 200

Query: 194 GAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVR 253
           GA I+   L+++  +RE+G ++TA+++AGRSGSA  AEIG+MK++EE+DA+ TMG     
Sbjct: 201 GANIYVASLVALAMVRELGPIMTAILVAGRSGSAFAAEIGTMKVSEEVDALVTMGFKPAM 260

Query: 254 ILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTG 313
            L++P+I A ++ +PLL + +N  AI G  ++     D+    + ++  +T ++ +I  G
Sbjct: 261 FLVAPKIIASVLVVPLLAMYSNLFAIAGGLLIGVTTLDLTVNAYMAQTMNTLSIFDINWG 320

Query: 314 LIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L K+   A  I  V   +G+ V   + S+G+  T+ VV  I +VI++DS+ A+
Sbjct: 321 LFKSAIFAVLIATVGCFKGYQVRGGAASVGQATTSAVVTGIFLVILVDSILAV 373


>gi|254417869|ref|ZP_05031593.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196184046|gb|EDX79022.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 372

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/374 (28%), Positives = 197/374 (52%), Gaps = 18/374 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAIN-KSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G    R  G+W +  +  +   +   ++ + I+S    VD   +   DT GA   +  +
Sbjct: 13  DGTAKLRLVGDWTTTALGRLPQRLGKDLDGRKIES----VDTRDLGRFDTAGA---LALV 65

Query: 63  EKYHGKIKLQGVSTHIE--QLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
           +  H  +     +   E  +++++I    RK     K Q   F ++F      IG+ +  
Sbjct: 66  QASHCGVPKSAWTERPEAGRIYTMIEALERKSSPPPK-QPGAFTSAFAK----IGRGVYD 120

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F  ++      LG ++    E   +    +    + + Q    G+  +P+V++ +F  GA
Sbjct: 121 FGAEAMLSLAFLGRLMEAVVEAAKNPGGIR--WPAWVSQAERAGLDAIPIVMVTNFFIGA 178

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A  G   L+ FGA++F++ L+ +   RE  V++ +V++AGRS SA  AEIGSM++N+E
Sbjct: 179 VVAFIGVDLLTDFGAQVFAVQLIGVAMFREFAVVIASVLLAGRSASAFAAEIGSMRMNQE 238

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA++ MG++  + L+ PR+ AL++ LPLLT +     ++G  IV W   ++  A FF R
Sbjct: 239 VDAMQVMGVNPFQALVVPRLAALVLMLPLLTFMGMIGGLLGGLIVCWSSLNLGPAFFFQR 298

Query: 301 FHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                ++A ++  GL+KAP  A  I  +  ++G +V     SLG++VT  VVQ+I  +I+
Sbjct: 299 LVEDGSMAQHMMVGLVKAPVFALVIAAIGCRQGMSVAGDVESLGRRVTAAVVQAIFAIIL 358

Query: 360 IDSLFAIFYFAIGI 373
           +D++FA+ +  + I
Sbjct: 359 LDAVFALMFLELDI 372


>gi|327399071|ref|YP_004339940.1| hypothetical protein Hipma_0911 [Hippea maritima DSM 10411]
 gi|327181700|gb|AEA33881.1| protein of unknown function DUF140 [Hippea maritima DSM 10411]
          Length = 349

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 110/343 (32%), Positives = 185/343 (53%), Gaps = 18/343 (5%)

Query: 31  INKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR 90
           I K  +   AI+D+   +++DT  + L+      Y   + ++ +    +Q    I   H 
Sbjct: 25  ITKINECKPAIIDVRGASKLDT--SSLV------YLASLNIKLLLNKNDQSLLNIVLQHI 76

Query: 91  KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK 150
            + K +K  R F Y+        +G   V+ + +       LG V      F  +  +F+
Sbjct: 77  PEKKKKKDSRGFLYS--------LGYAFVERLKELYVFMSFLGEVFVGFIGFILNPKRFR 128

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
             L S ++ +  +G + +P++  ISF+ GAVIA  G+ +L QFGA IF +DL+SI  LRE
Sbjct: 129 --LKSTLKDVELMGFNAIPILTTISFLIGAVIAYHGSVRLKQFGANIFVVDLVSISVLRE 186

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G L+ A+++AGRS S+  A+IG MK+ EE+D I+TMG++   IL+ P+I ++++ +PLL
Sbjct: 187 LGPLIVAILLAGRSSSSYTAQIGIMKVTEEVDVIKTMGVNPYDILVFPKIVSMLVCVPLL 246

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
            +LA+   ++G  +V     +I    F  R H    +    +G++KAP  A  I  +   
Sbjct: 247 IVLADVMGVLGGMVVAHLSLNITVRDFILRLHQAIGIKTFVSGILKAPAFAFLIATIGAF 306

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           +GF    +  S+GK VT  VV SI  VII D++F++ +  +GI
Sbjct: 307 KGFQTKKNVESIGKSVTVSVVDSIFGVIIADAIFSVLFRWMGI 349


>gi|302039183|ref|YP_003799505.1| putative ABC transporter permease [Candidatus Nitrospira defluvii]
 gi|300607247|emb|CBK43580.1| putative ABC-type transport system, permease component [Candidatus
           Nitrospira defluvii]
          Length = 373

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 125/368 (33%), Positives = 200/368 (54%), Gaps = 27/368 (7%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINK-SIQSDSAIV-DLSAITEIDTIGAELIMY--FME- 63
            R  G W  P+++ +      A+ + +  + SA+V + S I   DT GA +++Y   ME 
Sbjct: 18  LRCRGAWTMPDVAPVER----ALRRMTWPARSALVFEASGIEAFDTGGA-VVLYRALMEA 72

Query: 64  KYHG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS---FFYNSFKNLHYHIGKKIV 119
           +  G ++ +QG+     QL SL+S      +    P+++    F  S +N     G   +
Sbjct: 73  RRQGCEVSIQGLRPDYAQLMSLVSSHWAAMVAEVAPRQNGSERFRASIRN-RVAQGAGAL 131

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +F+ +S +      LV        AS  + +    S +  +   GV  +P+  L++F+ G
Sbjct: 132 EFLGESAT-----ALV-----RLVASPRRLR--WRSCLNSLRLDGVHALPITGLLTFLIG 179

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            VIA QGA QL +FG  IF +DL+ I  LREI  L+ A++IAGRSGSA  A+IG+MK+ E
Sbjct: 180 VVIAYQGAEQLRKFGTNIFIVDLVGISLLREIAPLIAAILIAGRSGSAYAAQIGTMKVTE 239

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA++T GL  + +L+ PR+ AL+++LPLLT  A+   + G  ++     ++ F  F S
Sbjct: 240 ELDALQTFGLSPIELLVLPRVLALVVALPLLTAYADVLGVFGGMLIASNQLNVSFTAFLS 299

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           RF     L ++  GL KAPF A  I +V   +GF +    + +G+  T  VVQSI +VII
Sbjct: 300 RFEEAVALRHMLIGLGKAPFFAVIIALVGCYQGFQIRGGVDDVGRHTTISVVQSIFLVII 359

Query: 360 IDSLFAIF 367
            D++ +I 
Sbjct: 360 FDAICSIL 367


>gi|94498322|ref|ZP_01304881.1| ABC transporter, permease protein, putative [Sphingomonas sp.
           SKA58]
 gi|94422202|gb|EAT07244.1| ABC transporter, permease protein, putative [Sphingomonas sp.
           SKA58]
          Length = 303

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 150/259 (57%), Gaps = 2/259 (0%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVI 172
             G++++    D+       G +I   G    +  + +  +  L+  M   G++G+P+V 
Sbjct: 45  RFGRQVIGTAGDAYQMLVFTGQLIIALGRTLGNPRRLR--MTPLVAFMQDAGINGLPIVF 102

Query: 173 LISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEI 232
           +++F  GAVIA  G   L+  G E+F+I L+ +  LRE GV++TA++++GRS S+  A+I
Sbjct: 103 IMTFFIGAVIALVGTNLLTTLGVEVFTIQLVGVAILREFGVVITAILLSGRSASSFAAQI 162

Query: 233 GSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDI 292
           GSM++N+E DA++ MG+D    L+ PRI A ++ +PL+T  A+   + G  +V W   DI
Sbjct: 163 GSMRMNQETDAMQVMGVDRFDALVIPRILAALLMMPLMTFCADIGGLAGGLLVSWVTIDI 222

Query: 293 PFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQ 352
               F  R   T  + + + G+ KAPF+A  I     + G  VG    SLG+ VT+ VVQ
Sbjct: 223 SPVFFIQRTLETVDIKHFWIGMCKAPFLALIIAAAGCRHGLMVGGDVQSLGQNVTSAVVQ 282

Query: 353 SISIVIIIDSLFAIFYFAI 371
           SI +VI+ D++FA+ + A+
Sbjct: 283 SIFMVIMFDAIFAVIFMAL 301


>gi|261855956|ref|YP_003263239.1| hypothetical protein Hneap_1358 [Halothiobacillus neapolitanus c2]
 gi|261836425|gb|ACX96192.1| protein of unknown function DUF140 [Halothiobacillus neapolitanus
           c2]
          Length = 413

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 193/376 (51%), Gaps = 18/376 (4%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSD-SAIVDLSAITEIDTIGAELIMYF 61
           +  +TV   +G W    +  +     ++   + ++D   IV  S ++  D  GA ++  +
Sbjct: 49  DRQVTVLVLSGTWTIHSLQHVPTLDTLSGAPTKKADKPCIVLRSEMSAFDGAGALVLARW 108

Query: 62  MEKYHG---KIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
           +  +     ++ L         L  L+       +    +KP+       F    +H  +
Sbjct: 109 IRTWRADGFEVDLGEFPPRETSLLQLLDDRLVDTEPAPVKKPKMIARIGQFTVEQWHETR 168

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             + F          LG ++        + ++ +    ++I ++   GV  + +V L+SF
Sbjct: 169 SFLAF----------LGELVWRGAPLLLTFWRIR--WRAVISEIDAAGVRALGIVGLLSF 216

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+A QG   L  +GA +  +DL+ I+ LRE+G LL A+++AGR+GS+  A++G+M+
Sbjct: 217 MIGMVMAYQGGATLQNYGANVLIVDLVGIITLREMGPLLAAIIVAGRTGSSYTAQLGTMR 276

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           I EEIDA+R +G+    ILI P++ ALII+LPLL+I ++   ++G ++V    + + F+V
Sbjct: 277 ITEEIDALRAIGVPPFEILIFPKVLALIITLPLLSIFSDLMGLLGGAVVANYGFGVSFSV 336

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +F R     +L  ++ GL+K P  A  I ++   +G  V   +  +G   T  VVQ+I +
Sbjct: 337 YFDRMPEAVSLTTLWLGLLKTPVFAIVIALIGCMQGLRVRGSAAEVGHATTVSVVQAIFM 396

Query: 357 VIIIDSLFAIFYFAIG 372
           VI+ID+LF++ Y  +G
Sbjct: 397 VIVIDALFSVLYNVMG 412


>gi|322378616|ref|ZP_08053052.1| hypothetical protein HSUHS1_0274 [Helicobacter suis HS1]
 gi|322380555|ref|ZP_08054721.1| hypothetical integral membrane protein [Helicobacter suis HS5]
 gi|321147017|gb|EFX41751.1| hypothetical integral membrane protein [Helicobacter suis HS5]
 gi|321148923|gb|EFX43387.1| hypothetical protein HSUHS1_0274 [Helicobacter suis HS1]
          Length = 368

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 109/311 (35%), Positives = 168/311 (54%), Gaps = 30/311 (9%)

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           Y+ K+ L+ V T I    S++   H  ++         F N  + L    G+ +V F N 
Sbjct: 76  YNAKV-LEVVETWIRANPSILKQEHVSRV---------FINPLEKL----GRGVVSFYNT 121

Query: 125 SCSQAHILGLVISNTG-------EFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
             +  +  G++I   G         C +          LI  ++  G   +PV IL  FV
Sbjct: 122 LLNTFNFCGMIIYYVGLAFIRPKSVCWTP---------LIHHIHESGFKVLPVSILTVFV 172

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G  IA +GA QL + G  + SI++ + L LRE+G  + A+++AGRS S+  A+IG+MKI
Sbjct: 173 VGFAIALEGAVQLQELGFPMMSIEMTAKLALREMGPFILALVVAGRSASSFTAQIGAMKI 232

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+ TMGL+    L+ PR+ AL+I++PLL  LA+  A++GA I I     I FA +
Sbjct: 233 TEELDAMETMGLNPFAFLVLPRVVALVIAMPLLVFLADAFALLGAMIAIKYQLGIGFAHY 292

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +R H    L++ F GLIKAPF   AI +V    GF V  ++ S+G+  T  VV S+  +
Sbjct: 293 VARLHENVGLSHFFIGLIKAPFWGFAIALVGCMRGFEVKGNTESIGQLTTISVVNSLFWI 352

Query: 358 IIIDSLFAIFY 368
           I +D+LF++ +
Sbjct: 353 IFLDALFSVIF 363


>gi|205355658|ref|ZP_03222428.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|205346435|gb|EDZ33068.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 337

 Score =  166 bits (419), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 112/341 (32%), Positives = 174/341 (51%), Gaps = 24/341 (7%)

Query: 7   TVFRFAGN-------WKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           T F+F  N       W    I ++     +A+   IQS   I D   +  IDT G    +
Sbjct: 3   TNFKFQNNTLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFL 59

Query: 60  YF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF--FYNSFKNLHYHI 114
                ++  + KI  +G+++  + LF L    +++  K +K  ++F  ++     L   +
Sbjct: 60  ALENDLKDKNIKIAKEGLNSRFQTLFELCEKNYQRLSKTKKSHKNFSEYFIDLGKLSLEL 119

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            K + KFIN + +    L L + N   F     +F  FL  +    +      +P+VIL 
Sbjct: 120 LKILRKFINFTGAFFTSLFLCLKNPKNF-----RFIAFLYHIENSAF----KALPIVILT 170

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 171 ALLVGVVLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGV 230

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      +I PR+ AL+I++PL+  +++  +IIG  +V     DI F
Sbjct: 231 MKITDEIAAMNTMGFRSFEFIIIPRVMALVIAMPLIVAISDAISIIGGMMVAKLNLDISF 290

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           A F   F     + +IF GL KAP     IG++A   GF V
Sbjct: 291 AEFLRHFREAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEV 331


>gi|313682999|ref|YP_004060737.1| hypothetical protein Sulku_1877 [Sulfuricurvum kujiense DSM 16994]
 gi|313155859|gb|ADR34537.1| protein of unknown function DUF140 [Sulfuricurvum kujiense DSM
           16994]
          Length = 373

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 115/364 (31%), Positives = 184/364 (50%), Gaps = 30/364 (8%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY----FMEKYHG 67
           +G+W    +S+ A ++   I  S+ +     D+S ITEID+ G  L       F E+ H 
Sbjct: 24  SGSWTIEHLSDAARELEALIPLSLVT----WDMSGITEIDSSGIALWQLTNRTFEERGH- 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +       + +LF L+           KP R     +  +  Y +GK+  +       
Sbjct: 79  TCETVNEREDLSRLFRLL---------YSKPFRDVPIPAVPSSLYRLGKETYEIFRG--- 126

Query: 128 QAHILGLVISNTGE-FCASSYKFKGFLLSLIR----QMYYVGVSGVPVVILISFVTGAVI 182
               +G  ++  GE F    Y  +   L   R     +   G   +P++ L +F+ G V+
Sbjct: 127 ----IGTFLAFLGEAFILFFYTLRHPRLIRYRSIGVHILETGARALPIIALSAFLIGVVV 182

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A Q   QL +FGA+IF +D++ I   RE+  L+TA+++AGRSGSA  A+IG+MK+ +EID
Sbjct: 183 AYQSVVQLQKFGADIFIVDMIGISLTRELAPLITAIVVAGRSGSAFTAQIGTMKMTQEID 242

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMG D    L+ PR+ AL+I +PLL   A+   I G  ++   +  + F+ F  R  
Sbjct: 243 AMRTMGFDPFTFLVWPRVIALMIIMPLLIFFADMVGIFGGMVIAQVHSHLSFSEFIHRLQ 302

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L +   GLIK PF A  I  V+   GF V +++ S+G+  T  VV +I +VI  D+
Sbjct: 303 GALALKHYLIGLIKGPFFAFLIAFVSTYRGFQVSMNTESIGQYTTKSVVNAIFLVIACDA 362

Query: 363 LFAI 366
           +F++
Sbjct: 363 IFSV 366


>gi|114320361|ref|YP_742044.1| hypothetical protein Mlg_1205 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226755|gb|ABI56554.1| protein of unknown function DUF140 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 377

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 108/367 (29%), Positives = 195/367 (53%), Gaps = 18/367 (4%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
           +G+W    ++ +A   +  +    ++    +D SA+  +D  GA  +    E+    ++ 
Sbjct: 24  SGDWTRTGLTRLAGQDLRTLPPP-RTGGWTLDASAMGRLDLTGARQLHRLQER----LRE 78

Query: 72  QGVSTHI-----EQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           +G S  +     E +  L++FT R        +R         L   +G++ V  +    
Sbjct: 79  RGDSVRLGEERPEHMDGLLAFTERAV-----SERRPPPPPPGPLE-RLGRQTVIRLGHFW 132

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +G +           +  +   LS   ++   GV  +P++ L++F+TG VIA QG
Sbjct: 133 AFLAFIGEIALEALPRLLRPWTIRWKQLSA--EIQKAGVQALPIIGLLAFLTGLVIAYQG 190

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
              L ++GA IF ++L+S+  LRE+  +LTA+++AGR+GS+  A++G+MKI EEIDA+RT
Sbjct: 191 GDTLERYGANIFLVELVSVTMLREMAPMLTAIVVAGRTGSSWAAQLGTMKITEEIDALRT 250

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +G+    +LI PR+ AL++ LPLLTI A+   I+G  +V    + +    F +R      
Sbjct: 251 LGISPFDMLILPRLMALMVVLPLLTIYADVLGILGGMLVADLMFGVAMHDFINRLPEAIA 310

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            ++++ GL+KAP  A  I  +A  +G  V   + S+G+  T  VVQ+I +VI+ D++F+I
Sbjct: 311 TSHLWVGLVKAPVFALIIVGIACFQGMRVKGSAESVGRATTITVVQAIFLVIVTDAVFSI 370

Query: 367 FYFAIGI 373
            +  +G+
Sbjct: 371 LFNLVGL 377


>gi|289208500|ref|YP_003460566.1| hypothetical protein TK90_1322 [Thioalkalivibrio sp. K90mix]
 gi|288944131|gb|ADC71830.1| protein of unknown function DUF140 [Thioalkalivibrio sp. K90mix]
          Length = 382

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/335 (29%), Positives = 183/335 (54%), Gaps = 14/335 (4%)

Query: 42  VDLSAITEIDTIGAELIMYF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKP 98
           +D+  +   D  GA L+      +E+   +++L GV   +E+       T  ++++  +P
Sbjct: 59  LDVGGLEYCDGAGAALLHALERDIERAGRQVELVGVQGLVEE-----QLTPYRELETVEP 113

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
            R   + +   L     + + +    + SQ   +G +    G    +  + +       R
Sbjct: 114 AR---HETRGGLLAQSFEAVSRVGQAAYSQFGFIGELTRALGSALLNPRQVR--WGDTFR 168

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
                G   +P+V LI+F+ G ++A Q A  + QFG EIF  +L+++   RE+G L+ A+
Sbjct: 169 VAEAAGFQALPIVSLIAFLLGVILAFQSAIAMRQFGGEIFVANLVAVSLFRELGPLMMAI 228

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSG+A  AEIG+MK+NEE++A++TMGLD VR L+ P++ A I+  PLL + AN   
Sbjct: 229 LLAGRSGAAFAAEIGTMKVNEEVNALKTMGLDPVRFLVLPKVLAGILVAPLLALYANMIG 288

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++GA++V+ + + IP+  FF++     +L+++F+GL KA      I  V    G      
Sbjct: 289 LLGAAVVM-QGFGIPWTAFFNQVTVALSLSDLFSGLFKAVIFGLLIAGVGCLRGLQTASG 347

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + ++G   T+ VV SI ++++ D LFA+ ++ +G+
Sbjct: 348 AAAVGISTTSAVVTSIILIVVFDGLFAVLFYHMGV 382


>gi|301057238|ref|ZP_07198367.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300448689|gb|EFK12325.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 352

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 105/329 (31%), Positives = 178/329 (54%), Gaps = 13/329 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFME---KYHGKIKLQGVSTHIEQLFSLISFTHR-KKIKNQK 97
           VDL  +T +D  G  +++   +   K HG   L+     I ++   ++F    +K+  +K
Sbjct: 27  VDLENVTYLDDFGTLVLVELRKLAAKEHGAFNLENTGKKIREMLMFLNFDSLFQKVSFEK 86

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
            +R       + +   +G+K    I D       +G +  + G   A     +      +
Sbjct: 87  KRR-------QGIFVRLGEKTFDIILDLKYAISFIGAITLSLGYHLAHPRALRKD--DTL 137

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
             M   GV G+P+V LISF+ G ++A   + QL QFGA I+   L+S+   RE+G ++TA
Sbjct: 138 DYMQKTGVDGLPIVALISFLMGLIMAFMSSVQLEQFGANIYVASLVSLAMTRELGPIMTA 197

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +++AGRSGSA  AEIG+MKI+EE+DA+ TMG D V  L+ P++ A +I +P+LT+ ++  
Sbjct: 198 IIVAGRSGSAFAAEIGTMKISEEVDALYTMGFDPVGFLVIPKLIAALIMVPILTLFSDIF 257

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           AI G  +V     D+    + ++  +T  L ++F G++K+   A  I  V    GF V  
Sbjct: 258 AIAGGLLVGVFMLDLTVGAYVAQTINTLALFDVFWGVLKSGVFALLITWVGCLRGFQVSG 317

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            + S+G+  T+ VV SI ++I+ DS+F++
Sbjct: 318 GAASVGQATTSAVVSSIFLIILFDSVFSV 346


>gi|34558310|ref|NP_908125.1| toluene ABC transporter permease [Wolinella succinogenes DSM 1740]
 gi|34484029|emb|CAE11025.1| conserved hypothetical protein-ABC-type toluene export system,
           permease component [Wolinella succinogenes]
          Length = 366

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 191/364 (52%), Gaps = 26/364 (7%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLS--AITEIDTIGAELIMYF---MEKYHG 67
           G W      E+  +++  +  + + DS  V +S   ++ +D   A L++     +++  G
Sbjct: 16  GQWDY----ELPKELISRLFLACKRDSVRVSVSLLGVSSLDYSAATLLLELSMAVKRRGG 71

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +   +GV   I  +  ++     K+ K   P      +S   L    G+KI + +     
Sbjct: 72  EWAWEGVPPAIAPILGIV-----KESKRDLPAPPPSLSSLLRL----GEKIKESLKGLGR 122

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYV---GVSGVPVVILISFVTGAVIAQ 184
            A  LG  +   G     S      L+ L   +Y++   G+  VP++ L SF+ G V+A 
Sbjct: 123 FASFLGETLFAMGRSLKESR-----LIRLKATLYHIEESGIKAVPIIALTSFLVGIVMAY 177

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QGA QL +FGA I  +++  +L LRE+G ++ A+++AGRS S+  A+IG MKI EEIDA+
Sbjct: 178 QGAIQLEKFGASIIVVEMTGMLTLRELGPVIAAIVVAGRSASSYAAQIGVMKITEEIDAM 237

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +TM  +    L+ PR+ AL++ +PL+  L+N + ++G  ++I  Y  I +  +  RF+  
Sbjct: 238 KTMNFNPYAFLVIPRVIALVVVMPLVIFLSNVAGLLGEMLIIKSYLGIGYLQYIERFYEM 297

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +++ GLIKAPF    I ++    GF +   + S+G+  T  VV +I  VI ++++F
Sbjct: 298 VEIRHLWVGLIKAPFYGAIIALIGCFRGFQITGSTESVGRYTTISVVNAIFWVIALNAMF 357

Query: 365 AIFY 368
           +I +
Sbjct: 358 SIIF 361


>gi|78777725|ref|YP_394040.1| hypothetical protein Suden_1528 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498265|gb|ABB44805.1| conserved hypothetical protein [Sulfurimonas denitrificans DSM
           1251]
          Length = 373

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 135/215 (62%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           +M    +  + ++ L SF+ G V+A Q A+QL  +GA IF +D++ +  LRE+  L+TA+
Sbjct: 159 EMNECAIKALGIISLTSFLIGVVVAYQSAYQLKLYGANIFIVDMLGLSILRELSPLITAI 218

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           +IAGRSGSA  A+IG+MKI +E+DA++TMG D  R L+ P+I AL+I++PLL  +++  A
Sbjct: 219 VIAGRSGSAFTAQIGAMKITQELDAMQTMGFDPYRFLVVPKIIALMITMPLLIFVSDIMA 278

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           IIG  IV     +I   +F  RF+    + +   G+ K PF A  I  +A+ +G  V   
Sbjct: 279 IIGGMIVANLDLNITVDMFLDRFNEVINIKHFIVGISKGPFFAFLIATIAIYQGLLVKDD 338

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + S+G   T  VV+SI  VII D++F+I +  +GI
Sbjct: 339 TQSIGLNTTKSVVESIFAVIICDAIFSIAFTNLGI 373


>gi|217033903|ref|ZP_03439327.1| hypothetical protein HP9810_870g35 [Helicobacter pylori 98-10]
 gi|216943666|gb|EEC23111.1| hypothetical protein HP9810_870g35 [Helicobacter pylori 98-10]
          Length = 377

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 152/271 (56%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IVK  N   +  +  G+++     F  S++  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVKTYNTFLNAFNFCGMILFY---FIKSAFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|15646075|ref|NP_208257.1| hypothetical protein HP1466 [Helicobacter pylori 26695]
 gi|2314643|gb|AAD08507.1| conserved hypothetical integral membrane protein [Helicobacter
           pylori 26695]
          Length = 377

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 152/271 (56%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  RFH T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAIFSIIFSKLNI 377


>gi|108563874|ref|YP_628190.1| hypothetical protein HPAG1_1449 [Helicobacter pylori HPAG1]
 gi|107837647|gb|ABF85516.1| ABC transport system permease [Helicobacter pylori HPAG1]
          Length = 377

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 152/271 (56%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADSFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  RFH T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAVFSIVFSKLNI 377


>gi|307638119|gb|ADN80569.1| organic solvent resistant ABC transporter [Helicobacter pylori 908]
 gi|325996719|gb|ADZ52124.1| putative ABC transport system, permease protein [Helicobacter
           pylori 2018]
          Length = 377

 Score =  162 bits (410), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 150/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK +V+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSLVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  RFH T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSILFSKLNI 377


>gi|325998313|gb|ADZ50521.1| hypothetical protein hp2017_1400 [Helicobacter pylori 2017]
          Length = 377

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 150/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK +V+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSLVETYNTFLNAFNFCGMILF---YFIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  RFH T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSILFSKLNI 377


>gi|308062730|gb|ADO04618.1| putative ABC transport system permease protein [Helicobacter pylori
           Cuz20]
          Length = 377

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 104/337 (30%), Positives = 178/337 (52%), Gaps = 15/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQ 99
           VD S   +ID +    +   +++    I+L  VS +      ++       + ++++K  
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVKERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAS 110

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           + +     + +   +GK IVK  N   +  +  G+++     F  S +  K F ++ +  
Sbjct: 111 KRY-----ELMITKLGKSIVKTYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL-- 160

Query: 160 MYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +Y++  SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  + 
Sbjct: 161 LYHINESGFKVLPVSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFIL 220

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+ 
Sbjct: 221 TLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADA 280

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V 
Sbjct: 281 FAILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVK 340

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 341 GDTESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|317011599|gb|ADU85346.1| putative ABC transport system permease protein [Helicobacter pylori
           SouthAfrica7]
          Length = 377

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 150/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  RFH T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSIVFSKLNI 377


>gi|308185234|ref|YP_003929367.1| putative ABC transport system permease protein [Helicobacter pylori
           SJM180]
 gi|308061154|gb|ADO03050.1| putative ABC transport system permease protein [Helicobacter pylori
           SJM180]
          Length = 377

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 175/335 (52%), Gaps = 11/335 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           VD S   +ID +    +   + +    I+L  VS +      ++     K+   +  + S
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVRERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAS 110

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
                ++ L   +GK +V+  N   +  +  G+++     F  S +  K F ++ +  +Y
Sbjct: 111 ---KQYELLITKLGKSLVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LY 162

Query: 162 YVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           ++  SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +
Sbjct: 163 HINESGFKVLPVSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTL 222

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  A
Sbjct: 223 VVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFA 282

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V   
Sbjct: 283 ILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGD 342

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 343 TESIGRLTTISVVNALFWIIFLDAIFSILFSKLNI 377


>gi|296134762|ref|YP_003642004.1| protein of unknown function DUF140 [Thiomonas intermedia K12]
 gi|295794884|gb|ADG29674.1| protein of unknown function DUF140 [Thiomonas intermedia K12]
          Length = 380

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 103/364 (28%), Positives = 192/364 (52%), Gaps = 20/364 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH- 66
           V R  G W +  ++   +  + A  + +  D++       T +DT GA L++  M ++  
Sbjct: 29  VCRLQGAWNAQGLAREPNTHLPAGTRHVTLDASA------TTLDTPGALLLVRSMAQWQS 82

Query: 67  --GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               + + G+S   +QL  L+    R++     P           L   IG+  +  +++
Sbjct: 83  AGATVDVSGLSPPQQQLLDLV----RQRALALPPAARRL-----GLLGDIGRATLIALDE 133

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             +    +G ++          ++ +     +I ++   G+  + ++ L+SF+ G V+A 
Sbjct: 134 LRALLAFVGELVWRGAPLLLQPWRVRWR--EVIHEIDAAGLRAIGIIGLLSFLIGMVMAY 191

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q    L+ +GA I  ++L+SI+ LRE+G LLTA+++AGR+GS+  A+IG+M+I EE+DA+
Sbjct: 192 QAGATLATYGANILIVNLVSIITLRELGPLLTAILVAGRTGSSYTAQIGTMRITEEVDAL 251

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R +GL    +L+ P++ AL+I+LPLL + A+   + G  +V    Y +P + + +R    
Sbjct: 252 RALGLSPFEMLVLPKVIALVITLPLLALFADVMGLAGGGVVAAVGYGVPLSEYVARIPQV 311

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L  +  GL+KAP  A  I +V   +G  V   + ++G+  T  VVQ+I +VI+ID+ F
Sbjct: 312 VGLKTLVLGLVKAPVFAVVIALVGCMQGLRVAGSAAAVGRATTVSVVQAIFLVIVIDASF 371

Query: 365 AIFY 368
           ++ Y
Sbjct: 372 SVLY 375


>gi|317181149|dbj|BAJ58935.1| hypothetical protein HPF32_1353 [Helicobacter pylori F32]
          Length = 377

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 103/335 (30%), Positives = 175/335 (52%), Gaps = 11/335 (3%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           VD S   +ID +    +   + +    I+L  VS +      ++     K+   +  + S
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVRERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKES 110

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
                ++ +   +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y
Sbjct: 111 ---KKYELMITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LY 162

Query: 162 YVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           ++  SG   +P+ IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +
Sbjct: 163 HINESGFKVLPISILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTL 222

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  A
Sbjct: 223 VVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFA 282

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V   
Sbjct: 283 ILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGD 342

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 343 TESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|317179642|dbj|BAJ57430.1| hypothetical protein HPF30_1333 [Helicobacter pylori F30]
          Length = 377

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/337 (30%), Positives = 178/337 (52%), Gaps = 15/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQ 99
           VD S   +ID +    +   +++    I+L  VS +      ++       + ++++K  
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVKERSLDIELCNVSENNACALKVVKDWLEKEEDLESKKAG 110

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           + +     + L   +GK IV+  N   +  +  G+++     F  S +  K F ++ +  
Sbjct: 111 KHY-----ELLITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL-- 160

Query: 160 MYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +Y++  SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  + 
Sbjct: 161 LYHINESGFKVLPVSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFIL 220

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+ 
Sbjct: 221 TLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADA 280

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V 
Sbjct: 281 FAILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVK 340

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 341 GDTESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|157165030|ref|YP_001466748.1| MTA/SAH nucleosidase [Campylobacter concisus 13826]
 gi|112799982|gb|EAT97326.1| ABC transport system permease [Campylobacter concisus 13826]
          Length = 368

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/369 (31%), Positives = 194/369 (52%), Gaps = 22/369 (5%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           NG    +FAG +   +   +      +I K IQ     V     +E+ +I   +++    
Sbjct: 13  NGTATIKFAGEFSYKDAKNL-----QSIFKKIQKLKGNVKFD-FSELKSIDYAVLILLKN 66

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKI--KNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +GK K + + T+ E++ ++    + +KI  K   P  S       N    +G+KI + 
Sbjct: 67  TLNGK-KFE-IITNDEKIKAMSDLLNDEKIDFKYMPPHNSL------NFFSRLGEKICEG 118

Query: 122 INDSCSQAHILG--LVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             +       LG  L+ S    F  ++ +F+ F  + I+     GV+ V +V L +F+ G
Sbjct: 119 FVNLLEFGSFLGEFLIKSVRILFNPANLRFREFS-NYIKDG---GVNAVFIVSLTAFLIG 174

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A  G+  L+ FGA IF +++M +L LRE+  L+ A+++AGRS S+  A+IG+MK+ E
Sbjct: 175 VVLAYLGSAMLASFGASIFIVEIMGMLTLREVAPLIAAIVVAGRSASSFTAQIGAMKLTE 234

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA++TMG +    L+ PRI A+++ +P++  +A+  +I+G  I+     DI F+ + +
Sbjct: 235 EIDAMKTMGFEPFNFLVLPRIIAMVLCVPVIIFIADSISILGQMIICQTILDISFSDYLN 294

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           RF     L +   G+IKAPF    I I+    GF V  ++ SLG   T  VV +I  VI 
Sbjct: 295 RFREMVELRHFAVGMIKAPFFGAVIAIIGCMRGFGVSQNAQSLGAMTTVSVVNAIFWVIA 354

Query: 360 IDSLFAIFY 368
           +D+ FAI +
Sbjct: 355 LDAFFAIIF 363


>gi|208435334|ref|YP_002267000.1| ABC transport system permease [Helicobacter pylori G27]
 gi|208433263|gb|ACI28134.1| ABC transport system permease [Helicobacter pylori G27]
          Length = 377

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 149/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETCNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSILFSKLNI 377


>gi|308183565|ref|YP_003927692.1| putative ABC transport system permease protein [Helicobacter pylori
           PeCan4]
 gi|308065750|gb|ADO07642.1| putative ABC transport system permease protein [Helicobacter pylori
           PeCan4]
          Length = 377

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 149/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSILFSKLNI 377


>gi|254779978|ref|YP_003058085.1| ABC-type transport system, permease; putative membrane protein
           [Helicobacter pylori B38]
 gi|254001891|emb|CAX30141.1| ABC-type transport system, permease; putative membrane protein
           [Helicobacter pylori B38]
          Length = 377

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 151/271 (55%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QG  QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGTLQLQDMGAPLVSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  RFH T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAIFSIVFSKLNI 377


>gi|317010161|gb|ADU80741.1| putative ABC transport system permease protein [Helicobacter pylori
           India7]
          Length = 377

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 150/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL + GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQEMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAINYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAVFSIIFSKLNI 377


>gi|298735565|ref|YP_003728086.1| putative ABC transport system permease protein [Helicobacter pylori
           B8]
 gi|298354750|emb|CBI65622.1| putative ABC transport system permease protein [Helicobacter pylori
           B8]
          Length = 377

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 150/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QG  QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGVLQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F+ +  RFH T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFSSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAVFSIVFSKLNI 377


>gi|254524872|ref|ZP_05136927.1| ABC transporter permease [Stenotrophomonas sp. SKA14]
 gi|219722463|gb|EED40988.1| ABC transporter permease [Stenotrophomonas sp. SKA14]
          Length = 370

 Score =  160 bits (405), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 123/366 (33%), Positives = 204/366 (55%), Gaps = 21/366 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + R +G W + + +  A +V+  + + +      +D + I ++D+ G   ++  +   H 
Sbjct: 18  LIRLSGTW-TLKTALAAAEVLRGVPEKLTG----IDATGIEQMDSAG---VLQVLRVAH- 68

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQ-KPQRSF-FYNSFKNL--HYHIGKKIVKFIN 123
           +  L   + H  Q    +  T  +   ++ KP+R F    + + L    H     +K + 
Sbjct: 69  RADLGEDALHFRQDHQALVCTIEEVADDRPKPKRDFGVLAALERLGVSVHATGHNIKAL- 127

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
             CS    LG  +           +F+  L + + QM  VG+  VP+V L+S++ GAVIA
Sbjct: 128 --CS---FLGENLVKAARLVKEPRRFR--LTATVHQMEQVGLDAVPLVALLSYLVGAVIA 180

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G+  L  FGAEI+ ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDA
Sbjct: 181 FLGSTILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDA 240

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+GLD V +L+ PR+ AL+++LPLLT +A  + + G   V     DIP  ++ +R H 
Sbjct: 241 MRTLGLDPVDLLVLPRLLALLVTLPLLTFIAMVAGLAGGITVGAFDLDIPPQMYIARMHE 300

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           T  + ++  GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+ 
Sbjct: 301 TMEVRHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQSVGERTTSSVVQTISLVIIIDAF 360

Query: 364 FAIFYF 369
            A+++ 
Sbjct: 361 AALWFM 366


>gi|315639122|ref|ZP_07894289.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter upsaliensis JV21]
 gi|315480826|gb|EFU71463.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter upsaliensis JV21]
          Length = 368

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 186/372 (50%), Gaps = 30/372 (8%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM---YFMEKYHGKI 69
           G W     + IAD  +    K  Q+   I+D   +  ID  G    +   Y ++K     
Sbjct: 16  GIWDK---NSIADFKITDFIKKFQT-QCILDFHHLEFIDMAGVRFFLALEYELQKRGIVS 71

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
           +   +S   + LF L    +++ +K  K             H+   +    F+N      
Sbjct: 72  QRVHLSEKFDALFELCEKNYQRILKEPKK------------HFDTAEL---FVNLGVLSL 116

Query: 130 HILGLV---ISNTGEFCASSYKF--KGFLLSLIRQMYYV---GVSGVPVVILISFVTGAV 181
           ++LG++   I   GEF  + +++  K      I  +Y++    +  +P+VIL + + G V
Sbjct: 117 NLLGILKQFICFVGEFFTAFFQYFKKPKAFRFIAFLYHIENSALKALPIVILTALLVGVV 176

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q AFQL+QFGA IF +DL+ I   RE+  L+ A++IAGRS S+  A+IG MKI +EI
Sbjct: 177 LAYQAAFQLAQFGANIFIVDLVGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEI 236

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
            A+ TMG      +I PR+ AL++++PL+  +++F +I G  +V     DI F  F  RF
Sbjct: 237 AAMNTMGFSTFHFIIIPRVIALVVAMPLIVAVSDFVSIFGGMMVAHLNLDINFIEFLRRF 296

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L ++  GLIKAP     IG++A   G  V   + S+G   T  VV +I  VI  D
Sbjct: 297 KEAVDLKHVIIGLIKAPIFGFLIGLIACFRGLEVKHTTQSIGIYTTKSVVNAIFWVIAFD 356

Query: 362 SLFAIFYFAIGI 373
           +LF++    +GI
Sbjct: 357 ALFSVILTQMGI 368


>gi|294338723|emb|CAZ87055.1| putative ABC-type transport system, permease component [Thiomonas
           sp. 3As]
          Length = 380

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/364 (28%), Positives = 191/364 (52%), Gaps = 20/364 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH- 66
           V R  G W +  ++   +  + A  + +  D++       T +DT GA L++  M ++  
Sbjct: 29  VCRLQGAWNAQGLAREPNTHLPAGTRHVTLDASA------TTLDTPGALLLVRSMAQWQS 82

Query: 67  --GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
               +   G+S   +QL  L+    R++     P           L   IG+  +  +++
Sbjct: 83  AGATVDASGLSPPQQQLLDLV----RQRALALPPAARRL-----GLLGDIGRATLIALDE 133

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             +    +G ++          ++ +     +I ++   G+  + ++ L+SF+ G V+A 
Sbjct: 134 LRALLAFVGELVWRGAPLLLQPWRVRWR--EVIHEIDAAGLRAIGIIGLLSFLIGMVMAY 191

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q    L+ +GA I  ++L+SI+ LRE+G LLTA+++AGR+GS+  A+IG+M+I EE+DA+
Sbjct: 192 QAGATLATYGANILIVNLVSIITLRELGPLLTAILVAGRTGSSYTAQIGTMRITEEVDAL 251

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R +GL    +L+ P++ AL+I+LPLL + A+   + G  +V    Y +P + + +R    
Sbjct: 252 RALGLSPFEMLVLPKVIALVITLPLLALFADVMGLAGGGVVAAVGYGVPLSEYVARIPQV 311

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L  +  GL+KAP  A  I +V   +G  V   + ++G+  T  VVQ+I +VI+ID+ F
Sbjct: 312 VGLKTLVLGLVKAPVFAVVIALVGCMQGLRVAGSAAAVGRATTVSVVQAIFLVIVIDASF 371

Query: 365 AIFY 368
           ++ Y
Sbjct: 372 SVLY 375


>gi|154149262|ref|YP_001406165.1| ABC transport system permease [Campylobacter hominis ATCC BAA-381]
 gi|153805271|gb|ABS52278.1| ABC transport system permease [Campylobacter hominis ATCC BAA-381]
          Length = 367

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 124/205 (60%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           G+  V +V L +F+ G V+A  G+  L+QFGA I+ ID+M +L LREI  L+ A++IAGR
Sbjct: 158 GIDAVFIVSLTAFLVGIVLAYIGSDMLAQFGASIYIIDIMGMLTLREIAPLIAAIVIAGR 217

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           S S+  A+IG MKI EEIDA++TMG D    L  PRI A+II  P +  LA+  +I    
Sbjct: 218 SASSFTAQIGVMKITEEIDAMKTMGFDPFYFLCMPRILAMIIITPFVIFLADAVSIFSQM 277

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           IV   Y +I FA +  RF ST  + +   G++KAPF    I IV    GF V   + S+G
Sbjct: 278 IVCDAYLEISFADYLERFKSTIEIRHFLVGIVKAPFFGAIIAIVGCLRGFEVKNDTQSIG 337

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFY 368
           +  T  VV +I  VI +D+ FA+ +
Sbjct: 338 EYTTISVVNAIFWVIALDAFFAVMF 362


>gi|261838741|gb|ACX98507.1| ABC transport system permease [Helicobacter pylori 51]
          Length = 377

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 103/337 (30%), Positives = 177/337 (52%), Gaps = 15/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQ 99
           VD S   +ID +    +   + +    I+L  VS +      ++       + ++++K  
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVRERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAG 110

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           + +     + +   +GK IV+  N   +  +  G+++     F  S +  K F ++ +  
Sbjct: 111 KKY-----ELMITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL-- 160

Query: 160 MYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +Y++  SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  + 
Sbjct: 161 LYHINESGFKVLPVSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFIL 220

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+ 
Sbjct: 221 TLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADA 280

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V 
Sbjct: 281 FAILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVK 340

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 341 GDTESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|15612424|ref|NP_224077.1| hypothetical protein jhp1359 [Helicobacter pylori J99]
 gi|4155971|gb|AAD06935.1| putative [Helicobacter pylori J99]
          Length = 377

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 148/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK +V+  N   +  +  G+++     F  S +  K F   +I  +Y++  SG   +P
Sbjct: 119 KLGKSLVETYNTFLNAFNFCGMILFY---FIKSVFNPKRF--CIIPLLYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSILFSKLNI 377


>gi|210135633|ref|YP_002302072.1| ABC transporter permease protein [Helicobacter pylori P12]
 gi|210133601|gb|ACJ08592.1| ABC transporter permease protein [Helicobacter pylori P12]
          Length = 377

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 151/271 (55%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAVFSIVFSKLNI 377


>gi|257459529|ref|ZP_05624638.1| ABC transport system permease [Campylobacter gracilis RM3268]
 gi|257442954|gb|EEV18088.1| ABC transport system permease [Campylobacter gracilis RM3268]
          Length = 367

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 88/210 (41%), Positives = 130/210 (61%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           G+  + +V L +F+ G V+A  G+  LS+FGA I+ ID+M  L LRE+  L+ A++IAGR
Sbjct: 158 GIDALFIVSLTAFLIGIVLAYIGSDMLSKFGASIYIIDIMGALTLREVAPLIAAIVIAGR 217

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           S S+  A+IG MKI EEIDA+RTMG D    L  PRI A+++ +PL+  +A+  +I    
Sbjct: 218 SASSFTAQIGVMKITEEIDAMRTMGFDPFYFLAMPRIIAMVLIMPLVIFIADSVSIFAQM 277

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           IV   Y DI F+ +  RF ++  L +   G+IKAPF    I I+    GF V  ++ S+G
Sbjct: 278 IVCDAYLDIAFSDYLDRFKASVELRHFLVGMIKAPFFGAFIAIIGCMRGFEVKGNTQSIG 337

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           +  T  VV +I  VI ID++FA+ +  IG+
Sbjct: 338 EYTTISVVNAIFWVIAIDAVFAVLFSEIGL 367


>gi|217031805|ref|ZP_03437308.1| hypothetical protein HPB128_199g13 [Helicobacter pylori B128]
 gi|216946457|gb|EEC25059.1| hypothetical protein HPB128_199g13 [Helicobacter pylori B128]
          Length = 367

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 150/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 109 KLGKSIVETYNTFLNAFNFCGMILF---YFIKSVFNPKRFCITPL--LYHINESGFKVLP 163

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QG  QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 164 VSILTVFIVGFAVALQGVLQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 223

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 224 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 283

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F+ +  RFH T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 284 LDLGFSSYIDRFHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 343

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 344 VVNALFWIIFLDAVFSIVFSKLNI 367


>gi|207091861|ref|ZP_03239648.1| hypothetical protein HpylHP_01931 [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 377

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 151/271 (55%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAVFSIVFSKLNI 377


>gi|154173911|ref|YP_001408228.1| stas domain-containing protein [Campylobacter curvus 525.92]
 gi|112802195|gb|EAT99539.1| stas domain protein [Campylobacter curvus 525.92]
          Length = 368

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 84/205 (40%), Positives = 130/205 (63%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           GV+ V +V L +F+ G V+A  G+  L+ FGA IF +++M +L LRE+  L+ A+++AGR
Sbjct: 159 GVNAVFIVSLTAFLIGVVLAYLGSAMLANFGASIFIVEIMGMLTLREVAPLIAAIVVAGR 218

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           S S+  A+IG+MK+ EEIDA++TMG +    L+ PRI A+++SLP++  +A+  +I+G  
Sbjct: 219 SASSFTAQIGAMKLTEEIDAMKTMGFEPFNFLVLPRIIAMVLSLPIIIFIADAISILGQM 278

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           ++     DI FA + SRF     L +   G+IKAPF    I I+    GF V  ++ SLG
Sbjct: 279 LICQGVLDISFADYLSRFKDMVELRHFAVGMIKAPFFGAIIAIIGCMRGFDVNSNAQSLG 338

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFY 368
           +  T  VV +I  VI +D+ FAI +
Sbjct: 339 EMTTISVVNAIFWVIALDAFFAIIF 363


>gi|317178170|dbj|BAJ55959.1| hypothetical protein HPF16_1362 [Helicobacter pylori F16]
          Length = 377

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 178/337 (52%), Gaps = 15/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQ 99
           VD S   +ID +    +   +++    I+L  VS +      ++       + ++++K  
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVKERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKEG 110

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           + +     + +   +GK IV+  N   +  +  G+++     F  S +  K F ++ +  
Sbjct: 111 KKY-----ELMITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL-- 160

Query: 160 MYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +Y++  SG   +P+ IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  + 
Sbjct: 161 LYHINESGFKVLPISILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFIL 220

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+ 
Sbjct: 221 TLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADA 280

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V 
Sbjct: 281 FAILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVK 340

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 341 GDTESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|297380678|gb|ADI35565.1| conserved hypothetical protein [Helicobacter pylori v225d]
          Length = 377

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 149/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAVFSIIFSKLNI 377


>gi|301060039|ref|ZP_07200913.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300445918|gb|EFK09809.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 376

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 103/384 (26%), Positives = 187/384 (48%), Gaps = 28/384 (7%)

Query: 1   MSENGITVFRFAGNWKS----PEISEIADDVVMAIN-KSIQSDSAIVDLSAITEIDTIGA 55
           ++E+        GNW+     P    + D +    + K I+ D+        TE+ +  +
Sbjct: 10  LTESETLTVHLQGNWQMESGVPSSGALLDQLDQHSSIKRIEFDA--------TELGSWDS 61

Query: 56  ELIMYFME------KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKN 109
            L ++F E      +   K++  G+   + QL  L +   +K+   Q   R+ F+     
Sbjct: 62  SLPIFFFEISKLAVEKKTKVQKDGLPAGVRQLIDLATAVPKKEDARQTVSRAGFFG---- 117

Query: 110 LHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVP 169
              H+G +++ F   +      +G              +F+   L +  Q    G   VP
Sbjct: 118 ---HVGSEVIDFTKSAGELITFIGAAFEAFVRMITGRARFRATDLGIFLQ--EAGAQAVP 172

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           +V LISF+ G ++A  G  QLS FGA+++  DL+ I  +RE+G ++T +++AGR+G+A  
Sbjct: 173 IVSLISFLVGLILAFVGILQLSMFGAQVYVADLVGIAMVREMGAIMTGIIMAGRTGAAYA 232

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A++G+M++NEEIDA+ T+ +  +  L+ PR+ AL + +PLL + A+   I+G ++V    
Sbjct: 233 AQLGTMQVNEEIDALETLAIPPMEFLVLPRMVALAVMMPLLVLYADLMGILGGALVAVGM 292

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
           Y I   V+ SR  S  TL+++F GL         + +     G   G  ++++G   T+ 
Sbjct: 293 YKIDIIVYLSRTKSAVTLSDLFIGLFMGAVFGVLVALSGCLRGIQCGRSASAVGDATTSA 352

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV  I  +II  ++  +    +GI
Sbjct: 353 VVTGIVAIIIATAVITVLCSILGI 376


>gi|261840140|gb|ACX99905.1| hypothetical protein HPKB_1368 [Helicobacter pylori 52]
          Length = 377

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 178/337 (52%), Gaps = 15/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQ 99
           VD S   +ID +    +   +++    I+L  VS +      ++       + ++++K  
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVKERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAG 110

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           + +     + +   +GK IV+  N   +  +  G+++     F  S +  K F ++ +  
Sbjct: 111 KKY-----ELMITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL-- 160

Query: 160 MYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +Y++  SG   +P+ IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  + 
Sbjct: 161 LYHINESGFKVLPISILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFIL 220

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+ 
Sbjct: 221 TLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADA 280

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V 
Sbjct: 281 FAILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVK 340

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 341 GDTESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|317014880|gb|ADU82316.1| hypothetical protein HPGAM_07715 [Helicobacter pylori Gambia94/24]
          Length = 377

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/264 (34%), Positives = 149/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK +V+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSLVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAIFSILFSKLNI 377


>gi|188528238|ref|YP_001910925.1| hypothetical protein HPSH_07510 [Helicobacter pylori Shi470]
 gi|188144478|gb|ACD48895.1| hypothetical protein HPSH_07510 [Helicobacter pylori Shi470]
 gi|308064225|gb|ADO06112.1| putative ABC transport system permease protein [Helicobacter pylori
           Sat464]
          Length = 377

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 149/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAVFSIIFSKLNI 377


>gi|317182671|dbj|BAJ60455.1| hypothetical protein HPF57_1381 [Helicobacter pylori F57]
          Length = 377

 Score =  159 bits (403), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 178/337 (52%), Gaps = 15/337 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLIS--FTHRKKIKNQKPQ 99
           VD S   +ID +    +   +++    I+L  VS +      ++       + ++++K  
Sbjct: 51  VDFSGCQKIDFVFGMFLFDLVKERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAG 110

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           + +     + +   +GK IV+  N   +  +  G+++     F  S +  K F ++ +  
Sbjct: 111 KKY-----ELMITKLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL-- 160

Query: 160 MYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +Y++  SG   +P+ IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  + 
Sbjct: 161 LYHINESGFKVLPISILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFIL 220

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGRS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+ 
Sbjct: 221 TLVVAGRSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADA 280

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI+G    I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V 
Sbjct: 281 FAILGGMFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVK 340

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + S+G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 341 GDTESIGRLTTISVVNALFWIIFLDAVFSIIFSKLNI 377


>gi|315453380|ref|YP_004073650.1| ABC transport system permease protein (pseudogene) [Helicobacter
           felis ATCC 49179]
 gi|315132432|emb|CBY83060.1| putative ABC transport system permease protein (pseudogene)
           [Helicobacter felis ATCC 49179]
          Length = 369

 Score =  159 bits (402), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 117/376 (31%), Positives = 188/376 (50%), Gaps = 38/376 (10%)

Query: 13  GNW--KSPEISEIADDVVMAINKSIQSDSAI--VDLSAITEIDTIGAELIMYFMEK---- 64
           GNW  K+P         ++ + K +++   I  VD   +  +D +   L+   + +    
Sbjct: 17  GNWDFKTPA------QTLLRLEKLLKNAPPIRAVDFREVERLDFVFLMLLYDLLGRKKPA 70

Query: 65  ------YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                 Y+  + L+ V   +++  S++S  H K  K          N    L    G+ I
Sbjct: 71  ILNANAYNAHV-LEVVQHWVKEDPSILSREHSKPPK---------INPLNKL----GQSI 116

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS-LIRQMYYVGVSGVPVVILISFV 177
           V F N   +  +  G+V+   G    +  K K   L+ LI  ++  G   +PV IL  FV
Sbjct: 117 VDFFNTMLNTFNFCGMVLYFLGR---AIIKPKTLCLTPLIHHIHESGFKVLPVSILTVFV 173

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G  IA QGA QL Q G  + SI++ + L LRE+G  +  +++AGRS S+  A+IG MKI
Sbjct: 174 VGFAIALQGAIQLQQLGFPLMSIEMTAKLALREMGPFILTLVVAGRSASSFTAQIGVMKI 233

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+ TMGL     L+ PR+ AL+I +PL+  +A+  A++G  + I     + F  +
Sbjct: 234 TEELDAMHTMGLSPFAWLVLPRVLALVIVMPLMVFIADAFALLGTMVAIKYQLGVTFNHY 293

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +R H    L++ F GLIKAPF   AI IV    GF V   + S+G   T  VV ++  +
Sbjct: 294 IARLHENVGLSHFFVGLIKAPFWGFAIAIVGCMRGFEVKGDTESIGTLTTISVVNALFWI 353

Query: 358 IIIDSLFAIFYFAIGI 373
           I +++LF++ +  + I
Sbjct: 354 IFLNALFSVIFSKLNI 369


>gi|315585855|gb|ADU40236.1| ABC superfamily ATP binding cassette transporter permease protein
           [Helicobacter pylori 35A]
          Length = 377

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 92/264 (34%), Positives = 149/264 (56%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F  S +  K F ++ +  +Y++  SG   +P
Sbjct: 119 KLGKSIVETYNTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           + IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 ISILTVFIVGFAVALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +D++F+I +  + I
Sbjct: 354 VVNALFWIIFLDAVFSIIFSKLNI 377


>gi|54294946|ref|YP_127361.1| hypothetical protein lpl2025 [Legionella pneumophila str. Lens]
 gi|53754778|emb|CAH16265.1| hypothetical protein lpl2025 [Legionella pneumophila str. Lens]
          Length = 374

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 176/317 (55%), Gaps = 18/317 (5%)

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           ++K + +I+L   S   +Q+  LI  + ++ +  Q P  S      + + Y IGK     
Sbjct: 71  LKKRNNQIELVNFSDSQQQMLELIE-SKQEILSYQLPAVSK-----EGVLYQIGK----- 119

Query: 122 INDSCSQAH-ILGLVIS----NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             +S ++ H + GL+I     +T  F A +Y  +  L S++  +   G+  +P++ L+SF
Sbjct: 120 --ESENKLHQVDGLIILIGDLSTRLFEAFAYWRRFHLPSIVSVIDSAGLKALPIIGLLSF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMK
Sbjct: 178 LIGVVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMK 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           INEE+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  
Sbjct: 238 INEEVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFED 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F SR   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ +
Sbjct: 298 FLSRLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFL 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           +II D+ F+I Y  +G+
Sbjct: 358 IIIADAAFSIAYSWMGL 374


>gi|190572714|ref|YP_001970559.1| putative ABC transporter permease [Stenotrophomonas maltophilia
           K279a]
 gi|190010636|emb|CAQ44245.1| putative permease component of ABC transporter protein
           [Stenotrophomonas maltophilia K279a]
          Length = 373

 Score =  159 bits (402), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 121/366 (33%), Positives = 201/366 (54%), Gaps = 21/366 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH- 66
           + R +G W + + +  A +V+  +  ++      +D + I ++D+ G   ++    +   
Sbjct: 21  LIRLSGTW-TLKTALAAAEVLRGVPDTLTG----IDATGIEKMDSAGVLQVLRVAHRADL 75

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF-FYNSFKNL--HYHIGKKIVKFIN 123
           G+  LQ    H     +L+           +P+R F    + + L    H     +K + 
Sbjct: 76  GEDALQFRPDH----QALVCTIEEVADDRPRPKRDFGVLAALERLGVSVHATGHNIKAL- 130

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
             CS    LG  +           +F+  L + + QM  VG+  VP+V L+S++ GAVIA
Sbjct: 131 --CS---FLGENLVKAARLVKEPRRFR--LTATVHQMEQVGLDAVPLVALLSYLVGAVIA 183

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G+  L  FGAEI+ ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDA
Sbjct: 184 FLGSTILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDA 243

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+GLD + +L+ PR+ AL+++LPLLT +A  + + G   V     DIP  ++ +R H 
Sbjct: 244 MRTLGLDPIDLLVLPRLLALLVTLPLLTFIAMIAGLAGGITVGAFDLDIPPQMYIARMHE 303

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           T  + ++  GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+ 
Sbjct: 304 TMEVRHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQSVGERTTSSVVQTISLVIIIDAF 363

Query: 364 FAIFYF 369
            A+++ 
Sbjct: 364 AALWFM 369


>gi|109948194|ref|YP_665422.1| putative ABC transport system permease protein [Helicobacter
           acinonychis str. Sheeba]
 gi|109715415|emb|CAK00423.1| putative ABC transport system permease protein [Helicobacter
           acinonychis str. Sheeba]
          Length = 377

 Score =  159 bits (401), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 151/264 (57%), Gaps = 8/264 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG---VP 169
            +GK IV+  N   +  +  G+++     F    +  K F  + +  +Y++  SG   +P
Sbjct: 119 KMGKSIVETYNTFLNALNFCGMILFY---FIKGVFNPKRFCFTPL--VYHINESGFKVLP 173

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           V IL  F+ G  I  QGA QL   G  + ++++ + L LREIG  +  +++AGRS S+  
Sbjct: 174 VSILTVFIVGFAITLQGALQLQDMGVPLTTVEMTAKLALREIGPFILTLVVAGRSASSFT 233

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A+IG MKI EE+DA++TMG +    L+ PR+ ALII LPL+  +A+  AI+G+   +   
Sbjct: 234 AQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALIIVLPLMVFIADAIAILGSMCAVKYQ 293

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+ F+ +  RFHST T  + + G+IKAPF   AI +V    GF V   + S+G+  T  
Sbjct: 294 LDLTFSSYVDRFHSTVTWNHFWVGIIKAPFWGFAIAVVGCMRGFEVRGDTESVGRLTTIS 353

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV ++  +I +++ F+I +  +GI
Sbjct: 354 VVNALFWIIFLNATFSIVFSRLGI 377


>gi|307610778|emb|CBX00391.1| hypothetical protein LPW_21111 [Legionella pneumophila 130b]
          Length = 374

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 175/317 (55%), Gaps = 18/317 (5%)

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           ++K + +I+L   S   +Q+  LI  + +  +  Q P  S      + + Y IGK     
Sbjct: 71  LKKRNNQIELVNFSDSQQQMLELIE-SKQDILSYQLPAVSK-----EGVLYQIGK----- 119

Query: 122 INDSCSQAH-ILGLVIS----NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             +S ++ H + GL+I     +T  F A +Y  +  L S++  +   G+  +P++ L+SF
Sbjct: 120 --ESENKLHQVDGLIILIGDLSTRLFEAFAYWRRFHLPSIVSVIDSAGLKALPIIGLLSF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMK
Sbjct: 178 LIGVVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMK 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           INEE+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  
Sbjct: 238 INEEVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFED 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F SR   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ +
Sbjct: 298 FLSRLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFL 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           +II D+ F+I Y  +G+
Sbjct: 358 IIIADAAFSIAYSWMGL 374


>gi|315498539|ref|YP_004087343.1| hypothetical protein Astex_1526 [Asticcacaulis excentricus CB 48]
 gi|315416551|gb|ADU13192.1| protein of unknown function DUF140 [Asticcacaulis excentricus CB
           48]
          Length = 377

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 110/365 (30%), Positives = 182/365 (49%), Gaps = 14/365 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMYFMEKYH 66
           V    G+W +  + +  +     +  +++S SA+ V+   +   DT GA    Y +    
Sbjct: 18  VVSLTGDWTAIGLRDAGER----LKSALKSASAVRVETDDLKGFDTAGA----YALRTAL 69

Query: 67  GKIKLQGVSTHIEQL---FSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           G +    + +H  +L   + LI     + ++ QK       +        +G+      N
Sbjct: 70  GALGDDALFSHDPRLSAVYELIRDIQPQVVEAQKKTAQQKAHPIIAELAQLGRNTEDVFN 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D       +G +I        +  + +     L+ QM   G   + VV + +F  GAVIA
Sbjct: 130 DLRDLNVFIGQLIVTAFMSLVTPGRIR--WTPLVAQMQQAGFGALMVVCVTNFFVGAVIA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G  QL QFGA +F+++L+ I  LRE G ++ AV+IAGRS S+  AEIG+MK+N+EI A
Sbjct: 188 FLGILQLQQFGAAVFAVELIGISVLREFGPVIAAVLIAGRSASSFTAEIGAMKMNQEISA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG++    LI PR+ AL++++PL+T   + + ++G  +V+W         F  R   
Sbjct: 248 MRVMGINPFDALIFPRLAALVLTMPLITFAGSMAGLLGGFVVVWAQLGYGPHFFSIRMTE 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                N F G+IK P  A AI I+  + G  V     SLG++VT  VVQ+I  +I+ID++
Sbjct: 308 YVPFVNFFVGMIKVPLFAIAITIIGCRLGMNVTEDVISLGRQVTRAVVQAIFTIILIDAI 367

Query: 364 FAIFY 368
            A+ +
Sbjct: 368 VAMMF 372


>gi|15598407|ref|NP_251901.1| permease of ABC transporter [Pseudomonas aeruginosa PAO1]
 gi|9949331|gb|AAG06599.1|AE004744_14 probable permease of ABC transporter [Pseudomonas aeruginosa PAO1]
          Length = 381

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/204 (42%), Positives = 127/204 (62%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  VL
Sbjct: 163 PLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFAVL 222

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT + 
Sbjct: 223 LTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTFVG 282

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EGF 
Sbjct: 283 MLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEGFK 342

Query: 335 VGVHSNSLGKKVTTCVVQSISIVI 358
           V   + S+G+  TT VV SI +VI
Sbjct: 343 VSGSAQSVGEHTTTSVVHSIFVVI 366


>gi|52842264|ref|YP_096063.1| ABC transporter, permease [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629375|gb|AAU28116.1| ABC transporter, permease [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 374

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 109/317 (34%), Positives = 175/317 (55%), Gaps = 18/317 (5%)

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           ++K + +I+L   S   +Q+  LI  + +  +  Q P  S      + + Y IGK     
Sbjct: 71  LKKRNNQIELVNFSDSQQQMLELIE-SKQDILSYQLPAVSK-----EGVLYQIGK----- 119

Query: 122 INDSCSQAH-ILGLVIS----NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             +S ++ H + GL+I     +T  F A +Y  +  L S++  +   G+  +P++ L+SF
Sbjct: 120 --ESENKLHQVDGLIILIGDLSTRLFEAFAYWRRFHLPSIVSVIDSAGLKALPIIGLLSF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMK
Sbjct: 178 LIGVVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMK 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           INEE+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  
Sbjct: 238 INEEVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFED 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F SR   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ +
Sbjct: 298 FLSRLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFL 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           +II D+ F+I Y  +G+
Sbjct: 358 IIIADAAFSIAYSWMGL 374


>gi|307720548|ref|YP_003891688.1| hypothetical protein Saut_0627 [Sulfurimonas autotrophica DSM
           16294]
 gi|306978641|gb|ADN08676.1| protein of unknown function DUF140 [Sulfurimonas autotrophica DSM
           16294]
          Length = 368

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 129/210 (61%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
            V  + +V L SF+ G V A Q A+QL ++G  IF +D+M I   RE+  L+TA++IAGR
Sbjct: 159 AVRALGIVALTSFLIGLVTAYQAAYQLQRYGGNIFIVDMMGISVFRELAPLITAIVIAGR 218

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           SGSA  A+IG+MKI +EIDA+RTMG D    L+ PRI ALII LP+L  +++  A++G  
Sbjct: 219 SGSAYTAQIGAMKITQEIDAMRTMGFDPYTFLVLPRIIALIIMLPILIFVSDMMAMLGGI 278

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           IV     D+  ++F +R      + + + GL+K PF A  I  + +  G  V   + S+G
Sbjct: 279 IVADLSLDLIPSLFINRLSEVVAIKHFYVGLVKGPFFAFLIASIGIYRGLMVKDDTQSIG 338

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              T  VV+S+  VI+ D++F+I +  +GI
Sbjct: 339 FNTTKSVVESLFAVIVCDAIFSIAFTNLGI 368


>gi|57505618|ref|ZP_00371545.1| conserved hypothetical integral membrane protein [Campylobacter
           upsaliensis RM3195]
 gi|57016165|gb|EAL52952.1| conserved hypothetical integral membrane protein [Campylobacter
           upsaliensis RM3195]
          Length = 377

 Score =  158 bits (399), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/379 (31%), Positives = 187/379 (49%), Gaps = 44/379 (11%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM---YFMEKYHGKI 69
           G W     + IAD  +    K+ Q+   I+D   +  ID  G    +   Y ++K     
Sbjct: 25  GIWDK---NSIADFKITDFIKNFQT-QCILDFHHLEFIDMAGVRFFLALEYELQKRGITS 80

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
           +   +S   + LF L    +++ +K  K             H+   +    F+N      
Sbjct: 81  QRVHLSEKFDALFELCEKNYQRILKEPKK------------HFDTAEL---FVNLGVLSL 125

Query: 130 HILGLV---ISNTGEF------C---ASSYKFKGFLLSLIRQMYYV---GVSGVPVVILI 174
           ++LG++   I   GEF      C     +++F  FL       Y++    +  +P+VIL 
Sbjct: 126 NLLGILKQFICFVGEFFTAFFQCFKKPKTFRFVAFL-------YHIENSALKALPIVILT 178

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           + + G V+A Q AFQL+QFGA IF +DL+ I   RE+  L+ A++IAGRS S+  A+IG 
Sbjct: 179 ALLVGVVLAYQTAFQLAQFGANIFIVDLVGISATRELAPLIAAIVIAGRSASSYTAQIGV 238

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKI +EI A+ TMG      +I PR+ AL++++PL+  +++F +I G  +V     DI F
Sbjct: 239 MKITDEIAAMNTMGFSTFHFIIIPRVVALVVAMPLIVAVSDFVSIFGGMMVAHLNLDINF 298

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F  RF     L ++  GLIKAP     IG++A   G  V   + S+G   T  VV +I
Sbjct: 299 IEFLRRFKEAVDLKHVIIGLIKAPIFGFLIGLIACFRGLEVKHTTQSIGIYTTKSVVNAI 358

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             VI  D+LF++    +GI
Sbjct: 359 FWVIAFDALFSVILTQMGI 377


>gi|254458263|ref|ZP_05071689.1| stas domain protein [Campylobacterales bacterium GD 1]
 gi|207085099|gb|EDZ62385.1| stas domain protein [Campylobacterales bacterium GD 1]
          Length = 357

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 86/210 (40%), Positives = 129/210 (61%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
            +  + ++ L SF+ G V+A Q A+QL  +GA IF +D++ I  LRE+  L+TA++IAGR
Sbjct: 148 AIKALGIISLTSFLIGLVVAYQSAYQLKIYGANIFIVDMLGISMLRELAPLMTAIVIAGR 207

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           SGSA  A+IG+MKI EE+DA+RTMG D    L+ PRI AL+I++P+L  +A+  ++ G  
Sbjct: 208 SGSAFTAQIGAMKITEELDAMRTMGFDPYIFLVLPRIIALMIAMPILIFVADIMSVFGGL 267

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           +V     DI   +F  RF+      + F G+ K PF A  I  + +  G  V   + S+G
Sbjct: 268 LVAVIDLDISPQLFIDRFNDVVAAKHFFIGIGKGPFFAFIIASIGVYRGLEVKDDTQSIG 327

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              T  VV+SI  VII D++F+I +  +GI
Sbjct: 328 FNTTKSVVESIFAVIICDAIFSILFTNLGI 357


>gi|54297975|ref|YP_124344.1| hypothetical protein lpp2030 [Legionella pneumophila str. Paris]
 gi|53751760|emb|CAH13182.1| hypothetical protein lpp2030 [Legionella pneumophila str. Paris]
          Length = 374

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 107/317 (33%), Positives = 176/317 (55%), Gaps = 18/317 (5%)

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           ++K + +++L   S   +Q+  LI  + ++ +  Q P  S      + + Y IGK     
Sbjct: 71  LKKRNNQVELVNFSDSQQQMLELIE-SKQEILSYQLPAVSK-----EGVLYQIGK----- 119

Query: 122 INDSCSQAH-ILGLVIS----NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             +S ++ H + GL+I     +T  F A +Y  +  L S++  +   G+  +P++ L+SF
Sbjct: 120 --ESENKLHQVDGLIILIGDLSTRLFEAFAYWRRFHLPSIVSVIDSAGLKALPIIGLLSF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMK
Sbjct: 178 LIGVVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMK 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           INEE+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  
Sbjct: 238 INEEVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFED 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F +R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ +
Sbjct: 298 FLTRLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFL 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           +II D+ F+I Y  +G+
Sbjct: 358 IIIADAAFSIAYSWMGL 374


>gi|317013234|gb|ADU83842.1| putative ABC transport system permease protein [Helicobacter pylori
           Lithuania75]
          Length = 377

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 151/271 (55%), Gaps = 13/271 (4%)

Query: 111 HYHI-----GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           HY +     GK IV+  +   +  +  G+++     F  S +  K F ++ +  +Y++  
Sbjct: 112 HYELLITKLGKSIVETYSTFLNAFNFCGMILFY---FIKSVFNPKRFCITPL--LYHINE 166

Query: 166 SG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           SG   +PV IL  F+ G  +A QGA QL   GA + S+++ + L LREIG  +  +++AG
Sbjct: 167 SGFKVLPVSILTVFIVGFAVALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAG 226

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RS S+  A+IG MKI EE+DA++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G 
Sbjct: 227 RSASSFTAQIGVMKITEELDAMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGG 286

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
              I    D+ F  +  R H T    +   G++KAPF   AI +V    GF V   + S+
Sbjct: 287 MFAIKYQLDLGFPSYIDRLHDTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESI 346

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV ++  +I +D++F+I +  + I
Sbjct: 347 GRLTTISVVNALFWIIFLDAVFSIVFSKLNI 377


>gi|152980330|ref|YP_001354931.1| ABC transport system permease protein [Janthinobacterium sp.
           Marseille]
 gi|151280407|gb|ABR88817.1| ABC transport system permease protein [Janthinobacterium sp.
           Marseille]
          Length = 374

 Score =  157 bits (396), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 106/363 (29%), Positives = 182/363 (50%), Gaps = 13/363 (3%)

Query: 12  AGNWK-SPEISEIADDVVMAINKSIQS-DSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           AG+W+    I   A D + A  + ++  D    DLS I  +D IGA+L+     K     
Sbjct: 22  AGSWQVRALIDPGAMDKLTATLRGVRKVDETRWDLSGIEALDYIGAQLLWNAWGKKRPP- 80

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
           +L     H E  F  +  T   ++K     R + ++++      +   ++ FI       
Sbjct: 81  QLTLAPQH-ESFFQRLEQTGTLQVKRPPQHRWYTFSAYLQFKLRMADHMLGFIT------ 133

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
            ++G ++ + G F     +  G    +   +++ G   + +  L+ F+ G V++   A Q
Sbjct: 134 -LIGQLVMDMGRFIRQPQR--GPWKEISANIFHTGYQALGITALVGFLIGVVLSYLSAQQ 190

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L QFG +IF ++++ +  +RE+G LL A+++AGRSGS+I A++G M++ EE+DA+  MGL
Sbjct: 191 LHQFGGDIFLVNILGMSVIRELGPLLAAILVAGRSGSSITAQLGVMRVTEELDAMLVMGL 250

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                LI P++ AL IS+PLL +  +  A+IG          + F  F         LAN
Sbjct: 251 PHGYRLIMPKVIALAISMPLLVVWTDAMALIGGMAAANVELGLSFKYFLRELPDAVPLAN 310

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
            + GL K       I +VA   G  +  ++ SLG+  T  VV +I++VI+ D++FAI + 
Sbjct: 311 YWIGLGKGVVFGSLIALVACHFGLRIKPNTESLGEGTTISVVTAITVVILADAVFAIVFS 370

Query: 370 AIG 372
            +G
Sbjct: 371 GVG 373


>gi|148359621|ref|YP_001250828.1| ABC transporter permease [Legionella pneumophila str. Corby]
 gi|296107663|ref|YP_003619364.1| putative ABC transport system permease protein [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281394|gb|ABQ55482.1| ABC transporter, permease [Legionella pneumophila str. Corby]
 gi|295649565|gb|ADG25412.1| putative ABC transport system permease protein [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 374

 Score =  156 bits (395), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 107/317 (33%), Positives = 175/317 (55%), Gaps = 18/317 (5%)

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           ++K + +++L   S   +Q+  LI  + +  +  Q P       S + + Y IGK     
Sbjct: 71  LKKRNNQVELVNFSDSQQQMLELIE-SKQDILSYQLP-----IVSKEGVLYQIGK----- 119

Query: 122 INDSCSQAH-ILGLVIS----NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             +S ++ H + GL+I     +T  F A +Y  +  L S++  +   G+  +P++ L+SF
Sbjct: 120 --ESENKLHQVDGLIILIGDLSTRLFEAFAYWRRFHLPSIVSVIDSAGLKALPIIGLLSF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMK
Sbjct: 178 LIGVVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMK 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           INEE+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  
Sbjct: 238 INEEVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFED 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F +R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ +
Sbjct: 298 FLTRLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFL 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           +II D+ F+I Y  +G+
Sbjct: 358 IIIADAAFSIAYSWMGL 374


>gi|223936767|ref|ZP_03628677.1| protein of unknown function DUF140 [bacterium Ellin514]
 gi|223894618|gb|EEF61069.1| protein of unknown function DUF140 [bacterium Ellin514]
          Length = 384

 Score =  155 bits (393), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 107/373 (28%), Positives = 198/373 (53%), Gaps = 28/373 (7%)

Query: 12  AGNWKS----PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME-KYH 66
           +G+WKS    P++  +++   + +++SI++ S   D+S +T   +    L+M   E    
Sbjct: 29  SGDWKSGEVFPDVGGVSNK--LDVDESIRALS--FDVSKVTSWSSGLIGLVMRCRELAME 84

Query: 67  GKIKLQ--GVSTHIEQLFSL-ISFTHRKKIKNQKPQRSFFYN---SFKNLHYHIGKKIVK 120
            KI     G+   +++L  L ++   +K  ++ + +   F         L    G++ +K
Sbjct: 85  RKIAFDQSGLPQSVQRLIVLALAVPEKKDARSLQTRPGIFEKIGLGVLGLRRS-GEETLK 143

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           FI D C+ A +                +++   + LI  M   G   +P+V LI+F+ GA
Sbjct: 144 FIGD-CTIAFL---------ALAKRKARYRWTEVWLI--MQQCGPDALPIVALINFLVGA 191

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++A  GA QLS+FGA I+  DL+ I  +RE+GV++ AV++ GR+G+A  A++G+MK+N+E
Sbjct: 192 ILAFVGAVQLSKFGAAIYVADLVGIATMREMGVIMMAVIMCGRTGAAFAAQLGTMKVNQE 251

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA +T+G+  +  L+ PRI  L +  P+L I A+  AI+G  +V     +  FA ++  
Sbjct: 252 IDAYKTLGISPIEFLVMPRIMCLWLMFPVLCIFADLMAIVGGGVVALAMLNFSFAEYWQE 311

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +  TL + F G++K+      + + +   G   G  + ++G   T+ VV  I++++I 
Sbjct: 312 TVAAVTLTHFFIGIVKSFVFGVLVAMTSCLRGIQCGNDAAAVGLATTSAVVTGITVIVIA 371

Query: 361 DSLFAIFYFAIGI 373
           D++FA+     GI
Sbjct: 372 DAIFAVILNVFGI 384


>gi|134096148|ref|YP_001101223.1| putative transmembrane protein [Herminiimonas arsenicoxydans]
 gi|133740051|emb|CAL63102.1| Conserved hypothetical protein, putative ABC transporter
           [Herminiimonas arsenicoxydans]
          Length = 374

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 189/367 (51%), Gaps = 21/367 (5%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQS----DSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           AG+W+   ++  A + + AI   +Q+    ++   DLS IT +D IGA+L+        G
Sbjct: 22  AGSWQVRALA--APETMAAITAVLQTAGKAETVHWDLSQITALDYIGAQLLW----NAWG 75

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYN--SFKNLHYHIGKKIVKFINDS 125
           K +   ++   +     +       ++ +KP + ++Y+  S   L ++I   ++ FI+  
Sbjct: 76  KKRPAQLTLAPQHADFFLRLEQTGPLEWKKPPQKYWYSLTSLLQLKHNILDHLLGFIS-- 133

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                ++G +  + G F     +  G    +   +++ G   + +  L+ F+ G V++  
Sbjct: 134 -----LIGQLTMDIGRFAREPQR--GPWKEISANIFHAGYQALGITALVGFLIGVVLSYL 186

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL QFG ++F ++++ +  +RE+G LL A+++AGRSGS+I A++G M++ EE+DA+ 
Sbjct: 187 SAQQLHQFGGDVFLVNILGMSVIRELGPLLAAILVAGRSGSSITAQLGVMRVTEELDAML 246

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MGL     L+ P++ AL I++PLL +  +  A+IG          + +  F        
Sbjct: 247 VMGLPHGYRLVMPKVIALAIAMPLLVVWTDAMALIGGMAAANLELGLSYKYFIRELPDAV 306

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            LAN + GL K       I +VA   G  +  ++ SLG   T  VV +I+IVI+ D+LFA
Sbjct: 307 PLANYWIGLGKGVVFGALIALVACHFGLRIKPNTESLGAGTTISVVSAITIVILADALFA 366

Query: 366 IFYFAIG 372
           I +  +G
Sbjct: 367 IIFSKVG 373


>gi|237751540|ref|ZP_04582020.1| ABC transport system permease [Helicobacter bilis ATCC 43879]
 gi|229372906|gb|EEO23297.1| ABC transport system permease [Helicobacter bilis ATCC 43879]
          Length = 387

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 92/273 (33%), Positives = 148/273 (54%), Gaps = 6/273 (2%)

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVIS--NTGEFCASSYKFKGFLLS 155
           P R    N F +    IG+  V F   + S  + +G+ +     G    S+++FK    S
Sbjct: 114 PYRPKRLNIFSSFFSFIGQWCVSFYQTALSFFNFMGMFLHFFMLGCLKPSNFRFK----S 169

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI  +Y  G   +PV ++ S + G  I  QGA+QL+  G  I S+D  + L LRE+G  +
Sbjct: 170 LIYHIYEQGFKALPVGLMTSLIIGYAITLQGAYQLNSMGVPIMSVDTTAKLALREMGPFI 229

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++IAGRS S+  A++GSM++ EE+ A++ M L+    LI PRI ALII +PL+   A+
Sbjct: 230 LALVIAGRSASSFTAQLGSMRLTEELSAMKAMNLNIFYFLIIPRILALIIVMPLMVFAAD 289

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
             A+ G  + I    +I F  +  RF+ T ++ + + G++KAP     IGIV    G   
Sbjct: 290 AIALFGGMVAIKTSINIGFETYLERFYETVSITHFWIGVVKAPVFGAIIGIVGCFRGLEC 349

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
              + S+GK  T  VV +I  +I+ +++F+  +
Sbjct: 350 RGDTQSIGKMTTMSVVNAIFWIIMANAIFSFIF 382


>gi|208779915|ref|ZP_03247259.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|254374661|ref|ZP_04990142.1| hypothetical protein FTDG_00836 [Francisella novicida GA99-3548]
 gi|151572380|gb|EDN38034.1| hypothetical protein FTDG_00836 [Francisella novicida GA99-3548]
 gi|208744370|gb|EDZ90670.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 366

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/335 (33%), Positives = 177/335 (52%), Gaps = 24/335 (7%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK-----IKNQ 96
           +D++ I  +DT GA    YF+ K    ++L    T  + +F      H+ K     + N 
Sbjct: 40  IDITKIQALDTAGA----YFILKVLKDLEL----TKEDLVFD----NHKDKNLIELVANN 87

Query: 97  KPQRSFFYNSFK-NLH----YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG 151
            P R    NS K N+     Y +GK     + +  +    LG ++   G        ++ 
Sbjct: 88  FPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEVKASIGFLGAIL--LGYLTLIRKPYRS 145

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
           F   ++   Y   +  + +V+L+S + G V+       + Q+G +IF +D++ I   RE 
Sbjct: 146 FFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPLNLMMQYGTQIFVVDMLGISSFREF 205

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
             L TA++IAGRSGSA  +EIG MK+NEEIDA++T+G D ++ L+ PRI ALIISLP+LT
Sbjct: 206 APLFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLT 265

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
           ++A  + IIG  I+      I    F  R  S   + + + GL+K PF A  I  +   +
Sbjct: 266 VIAMIANIIGGIIIADVIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQ 325

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           G AV   S S+GK  TT VV SI ++I++D++FA+
Sbjct: 326 GLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAV 360


>gi|332184385|gb|AEE26639.1| ABC-type transport system permease protein [Francisella cf.
           novicida 3523]
          Length = 366

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 173/327 (52%), Gaps = 8/327 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYH-GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQR 100
           +D++ I  +DT GA  I+  ++     K  L   S   + L  L++     KI  +   +
Sbjct: 40  IDITKIQSLDTAGAYFILRVLKDLGLTKKDLILNSDKDKNLIELVANNFPTKIDKEYSHK 99

Query: 101 S-FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           S   + S     Y +GK     + +  +    LG ++   G        +K F   ++  
Sbjct: 100 SNIVFTSI----YTLGKNTNNLLQEIKASIGFLGAIL--LGYLTLIRKPYKSFFSIVLNI 153

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
            Y   +  + +V+L+S + G V+       + Q+G +IF +D++ I   RE   L TA++
Sbjct: 154 AYDSTIKALSIVMLLSLIIGLVLTYLPLNLMMQYGTQIFVVDMLGISSFREFAPLFTAII 213

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           IAGRSGSA  +EIG MK+NEEIDA++T+G D ++ L+ PRI ALIISLP+LT++A  + I
Sbjct: 214 IAGRSGSAFTSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLTVIAMIANI 273

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           IG  I+      I    F  R  S   + + + GL+K PF A  I  +   +G AV   S
Sbjct: 274 IGGIIIADIIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQGLAVRRDS 333

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAI 366
            S+GK  TT VV SI ++I++D++FA+
Sbjct: 334 QSVGKATTTSVVYSIFLIIVVDAIFAV 360


>gi|118497851|ref|YP_898901.1| ABC transporter membrane protein [Francisella tularensis subsp.
           novicida U112]
 gi|194323824|ref|ZP_03057600.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|254373206|ref|ZP_04988695.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. novicida GA99-3549]
 gi|118423757|gb|ABK90147.1| ABC-type transport system permease protein [Francisella novicida
           U112]
 gi|151570933|gb|EDN36587.1| ABC superfamily ATP binding cassette transporter [Francisella
           novicida GA99-3549]
 gi|194322188|gb|EDX19670.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
          Length = 366

 Score =  153 bits (387), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 105/327 (32%), Positives = 173/327 (52%), Gaps = 8/327 (2%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQ-LFSLISFTHRKKIKNQKPQR 100
           +D++ I  +DT GA  I+  ++      +      H ++ L  L++     K+  +   +
Sbjct: 40  IDITKIQALDTAGAYFILKVLKDLELTKEDLVFDNHKDKNLIELVANNFPTKVDKENSHK 99

Query: 101 S-FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
           S   + S     Y +GK     + +  +    LG ++   G        ++ F   ++  
Sbjct: 100 SNIVFTSI----YTLGKNTNNLLQEVKASIGFLGAIL--LGYLTLIRKPYRSFFSIVLNI 153

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
            Y   +  + +V+L+S + G V+       + Q+G +IF +D++ I   RE   L TA++
Sbjct: 154 AYDSTIKALSIVMLLSLIIGLVLTYLPLNLMMQYGTQIFVVDMLGISSFREFAPLFTAII 213

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           IAGRSGSA  +EIG MK+NEEIDA++T+G D ++ L+ PRI ALIISLP+LT++A  + I
Sbjct: 214 IAGRSGSAFTSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLTVIAMIANI 273

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           IG  I+      I    F  R  S   + + + GL+K PF A  I  +   +G AV   S
Sbjct: 274 IGGIIIADVIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQGLAVRRDS 333

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAI 366
            S+GK  TT VV SI ++I++D++FA+
Sbjct: 334 QSVGKATTTSVVYSIFLIIVVDAIFAV 360


>gi|241668212|ref|ZP_04755790.1| ABC-type transport system permease protein [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254876747|ref|ZP_05249457.1| ABC transporter, permease protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842768|gb|EET21182.1| ABC transporter, permease protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 365

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 108/333 (32%), Positives = 175/333 (52%), Gaps = 8/333 (2%)

Query: 36  QSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL--QGVSTHIEQLFSLISFTHRKKI 93
           + D   +DL+ +T +DT GA    Y + K    ++L  + +    E+  +L+    +   
Sbjct: 34  KDDIKQIDLTKVTLLDTAGA----YIIIKTAKNLRLSKENIIFANEKDKNLVDIVFKNFP 89

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFL 153
              + + S   N   N  Y +GK     +++  +    LG +    G        +K F 
Sbjct: 90  STAEEELSNKSNVVFNSIYTLGKNTNNLLSEVKTSISFLGAIF--LGYITLIRRPYKAFF 147

Query: 154 LSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGV 213
             ++   Y   +  + +VIL+S + G V+       L Q+G +IF +D++ I   RE   
Sbjct: 148 SIVLNICYDSTIRALSIVILLSLIIGLVLTYLPLNLLMQYGTQIFVVDMLGISSFREFAP 207

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           L TA++IAGRSGSA  +EIG MK+NEEIDA++T+G D ++ L+ PRI AL+ISLP+LT++
Sbjct: 208 LFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTIGEDPMQRLVLPRITALVISLPVLTVI 267

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           A  + I G  I+      I    F  R  S   + + + GL+K PF A  I  +   +G 
Sbjct: 268 AMIANIAGGIIIADLIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQGL 327

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           +V   S S+GK  TT VV SI ++I++D++FA+
Sbjct: 328 SVKRDSQSVGKATTTSVVYSIFLIILVDAIFAV 360


>gi|56479165|ref|YP_160754.1| ABC transporter permease [Aromatoleum aromaticum EbN1]
 gi|56315208|emb|CAI09853.1| Possible ABC transport permease [Aromatoleum aromaticum EbN1]
          Length = 374

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 188/370 (50%), Gaps = 24/370 (6%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY-FMEKYHGK 68
           R  G+W    ++  AD+    + ++    +A   L  +T +D+ GA L+ + + E++   
Sbjct: 21  RLEGDWTLRALAPRADEFRRLLARA--GPAASWKLDGVTRLDSFGATLLWHAWREQWP-- 76

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              Q +S   ++L ++I        +     R+F   +  +    +G  ++ F N     
Sbjct: 77  ---QDLSAD-DELRAVIGRIEATAAEPLPEARAF---TLTDAIVVLGAGLLGFANH---- 125

Query: 129 AHILGLVISNTGEFCAS-SYKFKGFLLSLIRQ----MYYVGVSGVPVVILISFVTGAVIA 183
              L   +   G+ C   +Y  +      +R+    +Y VG    PV  L+ F+ G V++
Sbjct: 126 ---LAAFVQLAGQLCLDIAYLLRHPRDWPLREISANLYKVGARATPVAALVGFLIGVVLS 182

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA+I+ ++++ +  +RE+G +L +V++AGRSGSA+ A++G M++ +E+DA
Sbjct: 183 YLSALQLQAFGADIYIVNILGLGIVRELGPVLVSVLVAGRSGSAMTAQLGVMRVTDELDA 242

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MG+     L+ P++ AL +++PLL +  +  A+ G  +  W   D+ F  F      
Sbjct: 243 LSAMGISRTVRLVLPKVVALTVAMPLLVLWTSAVALFGGMVSAWVQLDLGFGFFLDTLPR 302

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K      +I +VA   G  V  ++ SL    T  VV +I++VI+ID++
Sbjct: 303 VVPVANLYIGLAKGAVFGLSIALVACHFGLRVRPNTESLSANTTASVVSAITVVILIDAV 362

Query: 364 FAIFYFAIGI 373
           FAI   +IG+
Sbjct: 363 FAIATRSIGV 372


>gi|270159818|ref|ZP_06188474.1| putative ABC transporter permease [Legionella longbeachae D-4968]
 gi|289165424|ref|YP_003455562.1| ABC transporter permease protein [Legionella longbeachae NSW150]
 gi|269988157|gb|EEZ94412.1| putative ABC transporter permease [Legionella longbeachae D-4968]
 gi|288858597|emb|CBJ12478.1| putative ABC transporter permease protein [Legionella longbeachae
           NSW150]
          Length = 375

 Score =  153 bits (386), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 167/311 (53%), Gaps = 15/311 (4%)

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSF--KNLHYHIGKKIV 119
           +E+   +++L   +   +QL  LI        K++K    +   S   +NL Y +GK+  
Sbjct: 71  LEQRENQVELTDFTETQQQLLELI--------KSKKDILDYHIPSAPKENLFYQLGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                      ++G + +   E   +  +F+  L S+I  +Y  GV+ +P++ L+SF+ G
Sbjct: 123 NKFRQVDGLLVLVGDLTTKIIEAFGNWRRFQ--LPSIISNIYTTGVTALPILALLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL  +GA  F   L  +   RE   L+TA+++AGR+ SA  A+IGSMK+NE
Sbjct: 181 VVLAYQMGLQLQTYGANSFIAYLSGMAIFREFAPLITAIIVAGRTSSAFTAQIGSMKLNE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+ TMGL    +L+ P++  L+I+ PLL   ++  +I+G+ I+      I F  F  
Sbjct: 241 EVDALLTMGLSPTELLVLPKVIGLLIAFPLLIFWSDLFSILGSMIMSNNMLGINFTDFLQ 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV--GVHSNSLGKKVTTCVVQSISIV 357
           R   T  L+ +  GL KAP  A  I +V   +GF V  G   N +G + T  VVQ++ ++
Sbjct: 301 RLRDTVGLSQLNLGLYKAPAFALLIALVGCFQGFKVEAGTEKN-IGSQTTKSVVQALFLI 359

Query: 358 IIIDSLFAIFY 368
           II D+++++ Y
Sbjct: 360 IIADAIYSVIY 370


>gi|260219765|emb|CBA26623.1| hypothetical protein Csp_H39530 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 387

 Score =  153 bits (386), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 98/367 (26%), Positives = 185/367 (50%), Gaps = 19/367 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQ------SDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
           G W +  +S  A  V   + K++Q      + +   DL     ID  GA+ +++      
Sbjct: 34  GRWTADALS--AKHVWQPLEKALQGVPGNGAPAVAWDLREAQRIDHTGAQ-VLWNAWGRQ 90

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
              KLQ        L  +  FT         P        +  L   +G+K+ +  +   
Sbjct: 91  WPAKLQAEPLQKALLDRVAKFT--------VPTPPVERLDWHALLVSLGRKLARVESHLG 142

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
               ++G ++ +  +     +  +G    +   +Y +G + +P+  L+ F+ G V+A   
Sbjct: 143 GMVRLIGQLMLDVLQLL--RHPLQGPWRDVSGHLYRIGATALPITALVGFLIGVVLAYLM 200

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           + QL Q+GA+ F ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+R 
Sbjct: 201 SKQLRQYGADSFIVNILGMSLIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELDAMRV 260

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG+     L+ PR  A+ I++PL+ +    +A++G  +       +  A FF+    T  
Sbjct: 261 MGIPKGFRLVMPRTLAMAIAMPLVAVWTTMAALLGGMLASDLSMGLTPAYFFTALPKTVE 320

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           ++N++  L+K+      I ++A   G  V   + SLG+  T  VV SI++VI++D+LFA+
Sbjct: 321 ISNLWLSLVKSCVFGVLISLLACHHGLRVKPDTQSLGEGTTASVVSSITMVILVDALFAV 380

Query: 367 FYFAIGI 373
            + ++G+
Sbjct: 381 IFKSVGL 387


>gi|254284160|ref|ZP_04959128.1| ABC transporter permease protein [gamma proteobacterium NOR51-B]
 gi|219680363|gb|EED36712.1| ABC transporter permease protein [gamma proteobacterium NOR51-B]
          Length = 377

 Score =  152 bits (384), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 108/375 (28%), Positives = 190/375 (50%), Gaps = 39/375 (10%)

Query: 13  GNWKS----PEISEI--ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
           G+W+S    PE+  +   DD V A+          VD   +   D+     ++  + K H
Sbjct: 28  GSWESSAVLPELGALFQPDDTVTALR---------VDALEVARWDS----RLISLLLKLH 74

Query: 67  GKIKLQGVSTHIE------QLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHY--HIGKKI 118
              + +G+S   E      QL +L +      +++   Q + + +S   L Y   +G ++
Sbjct: 75  RYCESRGISITTELPEGASQLLAL-AVAVPPAVESPS-QSAGWLHSLNPLPYLERLGARV 132

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
             F+N        +G ++S+TG       + +  +  L+   Y  G + +P++ L S + 
Sbjct: 133 TDFLN-------FVGSLVSSTGRVVTGRGRVR--VSDLLAFAYQTGPNALPIIGLTSLLV 183

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++   GA QL QFGA IF  DL++I  LRE+G L+TA++IAGR+G+A  A++G+M++N
Sbjct: 184 GMILGYLGAVQLQQFGAGIFVADLVTIGVLREMGALMTAIIIAGRTGAAYAAQLGTMRVN 243

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DAI  +G+  +  L+ PR+ A+ + +PLL++ A    I+G  IV       P   ++
Sbjct: 244 EEVDAIEILGISLMDFLVLPRVLAVTLMVPLLSLYAAIMGIVGGGIVSISLGITPLQ-YW 302

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  ++  L ++  GL KA      IGI   + G   G  S  +GK  TT VV ++  +I
Sbjct: 303 TQAQTSLGLDHLLVGLSKALLFGALIGIAGCRAGMQSGRSSEGVGKATTTAVVVALVYLI 362

Query: 359 IIDSLFAIFYFAIGI 373
           + D+   +    +GI
Sbjct: 363 LADAAVNLLCQLLGI 377


>gi|237752254|ref|ZP_04582734.1| toluene ABC transporter permease [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376496|gb|EEO26587.1| toluene ABC transporter permease [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 373

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/218 (37%), Positives = 129/218 (59%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           +L  Q+    +  VP++ L  F+ G VIA QG+ QL QFGA +  +++ ++L LRE+  +
Sbjct: 155 ALFFQIQEAVIKAVPIISLACFLIGIVIAYQGSLQLRQFGASVLIVEMSAMLTLREMAPI 214

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           + A+++AGRS SA  AEIG M+  +EIDA+R MG + V  LI PRI+AL+ +LPL+  +A
Sbjct: 215 IVAIIVAGRSASAFSAEIGMMRATQEIDAMRVMGFNPVTFLIFPRIFALLFALPLVVFVA 274

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           +   ++G  ++      I    F  RF  T  + + + G++KAPF    IG++    GFA
Sbjct: 275 DMFGLLGGMLISQLQLGISSEHFIERFLQTVEMRHFWIGMLKAPFFGLIIGLIGCYHGFA 334

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               + S+G   T  VV+SI  VI  D+L ++ +  IG
Sbjct: 335 TQKDTRSIGVHTTKSVVESIFCVIAFDALCSVLFTQIG 372


>gi|239813318|ref|YP_002942228.1| hypothetical protein Vapar_0299 [Variovorax paradoxus S110]
 gi|239799895|gb|ACS16962.1| protein of unknown function DUF140 [Variovorax paradoxus S110]
          Length = 388

 Score =  152 bits (383), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 108/385 (28%), Positives = 192/385 (49%), Gaps = 39/385 (10%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSI----QSDSAIVDLSAITEIDTIGAELI 58
           ++G +    +G W +  +S  +     A++K +     +D    DL  I ++D IGA+L+
Sbjct: 25  QDGRSWTVASGRWTTLAMS--SRSAWQALSKDLAGAPPADGRAWDLRPIEQLDHIGAQLL 82

Query: 59  M-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ------RSFFYNSFKNLH 111
             ++  ++   ++L     H   L  +  FT       + P       R F +   + L 
Sbjct: 83  WDHWRHRWPATLELS--PQHKAVLDQVAQFT--VGTPEEPPPTLAERLRHFSHTGARGLE 138

Query: 112 YHIGKKIVKFIN----DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG 167
             + +  V  I     D+C+      L   + G +      F G L       Y  G + 
Sbjct: 139 --VARDFVGLIGQLALDACTL-----LRAPHRGPW----RDFSGHL-------YQFGATA 180

Query: 168 VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSA 227
           + +  L+  + G V+A   + QL Q+GAE F ++++ +  +RE+G +L AV+IAGRSGSA
Sbjct: 181 LHITALVGLLIGVVLAYLISQQLRQYGAEAFVVNILGLSLIRELGPVLAAVLIAGRSGSA 240

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
           I A+IG M++ EE+DA+R MG+     L+ PR+ AL I++PL+++  + +A++G  +   
Sbjct: 241 ITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRVMALAIAMPLISLWTSMAALLGGMLAAD 300

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
              DI  A F S       ++N++  L K+      I ++    G  V  ++ SLG+  T
Sbjct: 301 AALDISPAYFLSALPRAVPISNLWLALAKSAVFGILIALIGCYFGMKVKPNTESLGRGTT 360

Query: 348 TCVVQSISIVIIIDSLFAIFYFAIG 372
           + VV SI+ VI++D+LFA+ +  +G
Sbjct: 361 SSVVTSITAVILVDALFAVLFKGVG 385


>gi|264676422|ref|YP_003276328.1| inner membrane ABC-transporter component [Comamonas testosteroni
           CNB-2]
 gi|299533747|ref|ZP_07047119.1| putative ABC transporter, permease protein [Comamonas testosteroni
           S44]
 gi|262206934|gb|ACY31032.1| putative inner membrane ABC-transporter component [Comamonas
           testosteroni CNB-2]
 gi|298718296|gb|EFI59281.1| putative ABC transporter, permease protein [Comamonas testosteroni
           S44]
          Length = 375

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 104/364 (28%), Positives = 183/364 (50%), Gaps = 16/364 (4%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
           AG W + E+ +      +A         A  DL  +   D IGA+L+    E++      
Sbjct: 24  AGRWSAAELGDRHIWRRLAPQIRAVPKGAAWDLQQMVWFDHIGAQLLW---EQWGKAWPA 80

Query: 72  QGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ-A 129
           Q ++T  ++  S++    R  ++   KP+ S +      L    G+ ++    D+C   +
Sbjct: 81  QLLTTKTQR--SMLERVARFSEVPESKPEPSGWMCEVNRL----GQMVI----DACGHFS 130

Query: 130 HILGLVISNTGEFCASSY-KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
           +++ LV     +         +G    +   +Y  G + +P+  L+ F+ G V+A   A 
Sbjct: 131 NLIQLVGQLLLDCLRLLRNPLRGPWRDISGHLYATGATALPITALVGFLIGVVLAYLMAL 190

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL QFGAE F ++++ I  +RE+G LL A+++AGRSGSAI A+IG M++ EE+DA++ MG
Sbjct: 191 QLRQFGAESFIVNILGISLIRELGPLLAAILVAGRSGSAITAQIGVMRVTEELDAMQVMG 250

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +     L+ PR  AL +S+PL+ +    +A+ G  +      DI  + F     +   + 
Sbjct: 251 ISQGYRLVLPRALALAVSMPLVALWTILAALAGGMVAADLTMDITPSYFVQSLPAAVKVG 310

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N+   + K+      I ++    G  V  ++ SLG+  T  VV SI++VII+D++FAI +
Sbjct: 311 NLVLAMGKSVVFGVLIALIGCHWGLKVEPNTQSLGRGTTAAVVSSITMVIIVDAIFAILF 370

Query: 369 FAIG 372
             +G
Sbjct: 371 RNVG 374


>gi|56708309|ref|YP_170205.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670780|ref|YP_667337.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134301737|ref|YP_001121705.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187931809|ref|YP_001891794.1| ABC-type transport system permease protein [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|224457429|ref|ZP_03665902.1| ABC-type transport system permease protein [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370792|ref|ZP_04986797.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254875129|ref|ZP_05247839.1| ABC transporter [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604801|emb|CAG45880.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110321113|emb|CAL09263.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049514|gb|ABO46585.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151569035|gb|EDN34689.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. tularensis FSC033]
 gi|187712718|gb|ACD31015.1| ABC-type transport system permease protein [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|254841128|gb|EET19564.1| ABC transporter [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159540|gb|ADA78931.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 366

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 111/335 (33%), Positives = 175/335 (52%), Gaps = 24/335 (7%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK-----IKNQ 96
           +D++ I  +DT GA    YF+ K    ++L    T  + +F      H+ K     + N 
Sbjct: 40  IDITKIQALDTAGA----YFILKVLKDLEL----TKEDLVFD----NHKDKNLIELVANN 87

Query: 97  KPQRSFFYNSFK-NLH----YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG 151
            P R    NS K N+     Y +GK     + +  +    LG ++   G        ++ 
Sbjct: 88  FPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEIKASIGFLGAIL--LGYLTLIRKPYRS 145

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
           F   ++   Y   +  + +V+L+S + G V+       + Q+G +IF +D++ I   RE 
Sbjct: 146 FFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPLNLMMQYGTQIFVVDMLGISSFREF 205

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
             L TA++IAGRS SA  +EIG MK+NEEIDA++T+G D ++ L+ PRI ALIISLP+LT
Sbjct: 206 APLFTAIIIAGRSSSAFTSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLT 265

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
           ++A  + II   I+      I    F  R  S   + + + GL+K PF A  I  +   +
Sbjct: 266 VIAMIANIISGIIIADVIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQ 325

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           G AV   S S+GK  TT VV SI ++I++D++FA+
Sbjct: 326 GLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAV 360


>gi|78067712|ref|YP_370481.1| ABC transporter, inner membrane subunit [Burkholderia sp. 383]
 gi|77968457|gb|ABB09837.1| ABC transporter, inner membrane subunit [Burkholderia sp. 383]
          Length = 374

 Score =  151 bits (381), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/376 (28%), Positives = 182/376 (48%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   +        +  DLS I  +D +G + +     +  G+ 
Sbjct: 21  RLYGQWTALALARNRGAVARRVASIASGRVSEWDLSGIERLDHVGGQALW----RVWGRK 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+  + Q  ++     R   + + P+R   ++    L    G+ I  F        
Sbjct: 77  LPPGVALSVTQ-RTIFERIERLDSEREAPERVVRFDPVTRL----GQAIFGFGEHLQGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            + GLVI +               LS++R+            +Y  G   +P+  L++F+
Sbjct: 132 AMFGLVILDA--------------LSVLRRPKTMPWKETSANIYSAGAQALPITALVAFL 177

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 178 IGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 237

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     LI PR+ AL I++PLL +  N  A+ G ++       I    F
Sbjct: 238 TEELDAMRVMGIPHGLRLILPRVLALGIAMPLLVMWTNIVALTGGALAAKLVLGIDVNYF 297

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 298 VRSLPGVVPIANLYIGVGKGIVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVV 357

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 358 ILADAVFAILFQNVGL 373


>gi|242278699|ref|YP_002990828.1| hypothetical protein Desal_1226 [Desulfovibrio salexigens DSM 2638]
 gi|242121593|gb|ACS79289.1| protein of unknown function DUF140 [Desulfovibrio salexigens DSM
           2638]
          Length = 371

 Score =  150 bits (380), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/358 (26%), Positives = 175/358 (48%), Gaps = 14/358 (3%)

Query: 21  SEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK---IKLQGVSTH 77
           +E A +V      ++ +   +V+ S I  +D  GA L M        +   + + G+   
Sbjct: 23  AEGAGEVWDKARAAVAAGCLVVECSGIEYLDGGGASLFMMMKAGCRDRGSSLVINGLRPE 82

Query: 78  IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILG--LV 135
                 L           Q  ++       +     +G+       D   Q    G  ++
Sbjct: 83  FASFLELFDLDKAAPPSGQVKRK----GGIRGWITSVGQSGQAVAADMREQIEFTGNCVL 138

Query: 136 ISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGA 195
            S +     +  ++  F L+  +    VG  G+P+++LI F+ G +++ Q A  L +FGA
Sbjct: 139 ASLSTATLKNKLRWPDFWLTCEK----VGADGLPIILLIGFLMGLIMSFQSAVSLMRFGA 194

Query: 196 EIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRIL 255
           EIF  +++ ++  RE+G ++TA+++AGR+GSA  AEIG+MK+NEE+DA+ TMGL+ V  L
Sbjct: 195 EIFVPNMLGLVMFRELGPMVTAILLAGRTGSAFAAEIGTMKVNEELDALNTMGLNPVSFL 254

Query: 256 ISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLI 315
           + PR+ A +   PLLT+  NF +++G ++V+      P A +  R        +   G+I
Sbjct: 255 VLPRVLATVCMTPLLTLFFNFMSLVGGALVMLS-MGYPLATYCGRVFENVQWMDFSGGMI 313

Query: 316 KAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           KA   +  +  +  + G      ++++G   T+ VV  I ++ + D +FA+ +F  GI
Sbjct: 314 KAVVFSFLVAGIGCQRGLVTKSGASAVGDSTTSAVVSGIILIAVFDGIFAVIFFLTGI 371


>gi|167627644|ref|YP_001678144.1| ABC-type transport system permease [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597645|gb|ABZ87643.1| ABC-type transport system permease protein [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 365

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 105/324 (32%), Positives = 171/324 (52%), Gaps = 4/324 (1%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF 102
           DL+ +T +DT GA +I+   +     +  + +    E+  +L+    +      + + S 
Sbjct: 41  DLTKVTLLDTAGAYIIIKTAKNLS--LSKENIIFANEKDKNLVDIVFKNFPSTAEEELSS 98

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYY 162
             N   N  Y +GK     +++  +    LG +    G        +K F   ++   Y 
Sbjct: 99  KSNVVFNSIYTLGKNTNNLLSEIKTSISFLGAIF--LGYITLIRRPYKAFFSIVLNICYD 156

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
             +  + +VIL+S + G V+       L Q+G +IF +D++ I   RE   L TA++IAG
Sbjct: 157 STIRALSIVILLSLIIGLVLTYLPLNLLMQYGTQIFVVDMLGISSFREFAPLFTAIIIAG 216

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSA  +EIG MK+NEEIDA++T+G D ++ L+ PRI AL+ISLP+LT++A  + I G 
Sbjct: 217 RSGSAFTSEIGIMKVNEEIDALQTIGEDPMQRLVLPRITALVISLPVLTVIAMIANIAGG 276

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
            I+      I    F  R  S   + + + GL+K PF A  I  +   +G +V   S S+
Sbjct: 277 IIIADLIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQGLSVKRDSQSV 336

Query: 343 GKKVTTCVVQSISIVIIIDSLFAI 366
           GK  TT VV SI ++I++D++FA+
Sbjct: 337 GKATTTSVVYSIFLIILVDAIFAV 360


>gi|300114239|ref|YP_003760814.1| hypothetical protein Nwat_1606 [Nitrosococcus watsonii C-113]
 gi|299540176|gb|ADJ28493.1| protein of unknown function DUF140 [Nitrosococcus watsonii C-113]
          Length = 376

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 204/375 (54%), Gaps = 17/375 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIAD--DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           NG+ V    G+W     +E+    DV  A  +   + +A V+LS +  +DT GA L++  
Sbjct: 12  NGLHVI---GDWTLEYYAELQSRIDVFKAQAEKNNTLNATVELSGLNRLDTAGAVLLVEL 68

Query: 62  M--EKYHGKIKL-QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           +  E+    +K   G++     L   +  T    +  Q+  RS        L    G++I
Sbjct: 69  LGAERLAAFVKEGSGLTPARRALLDAVVRTMSMPLAPQRQARS----PLVALLAGTGERI 124

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGF-LLSLIRQMYYVGVSGVPVVILISFV 177
             F      Q  +LG +    G   A+ ++   + L +L+ Q+   G++ + +V L++F+
Sbjct: 125 ELFWRQ---QLLLLGFIGLILGSLTATFWRPNRWRLTALVAQIQQTGLNAIGIVALLTFL 181

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            GAV+A  GA  L  FGA I+++DL++   LRE GVLL A+++AGR+ SA  A+IGSMK 
Sbjct: 182 VGAVVAFLGATVLQNFGATIYTVDLIAFSFLREFGVLLAAILLAGRTASAFTAQIGSMKA 241

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEEIDA+RT+GL    +L+ PR+ AL++SLP+LT +   S ++G  +V     DI  A+ 
Sbjct: 242 NEEIDALRTLGLSTAELLVLPRVLALLLSLPILTFIGMLSGMLGGGLVCLVVLDIS-ALQ 300

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           F       +L +   GL KAP  A  I  +   EGF V   + S+G+  T+ VVQSI +V
Sbjct: 301 FVTILQGISLKHFLVGLSKAPIFAFFIAAIGCLEGFKVSGSAQSVGEHTTSSVVQSIFMV 360

Query: 358 IIIDSLFAIFYFAIG 372
           I++D++ A+F+  +G
Sbjct: 361 ILLDAIAALFFMEMG 375


>gi|319956950|ref|YP_004168213.1| hypothetical protein Nitsa_1211 [Nitratifractor salsuginis DSM
           16511]
 gi|319419354|gb|ADV46464.1| protein of unknown function DUF140 [Nitratifractor salsuginis DSM
           16511]
          Length = 371

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 108/342 (31%), Positives = 170/342 (49%), Gaps = 18/342 (5%)

Query: 36  QSDSAIVDLSAITEIDTIG---AELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           ++    +D   +   D+ G      +   M+K     ++ G+    E++  LI    R  
Sbjct: 42  ETPRCRIDFGKVQRFDSAGILLLLELRERMKKAGKACEITGLDEKKEKMLHLI---ERGY 98

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILG-LVISNTGEFCASSYKFKG 151
            +   P+R       + L + IGK  V+ +       H LG L +S    F    +K   
Sbjct: 99  GEEPLPKRR------EGLLWRIGKATVEELKVVRDFFHFLGELSVS----FLRLLFKPSN 148

Query: 152 FLL-SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
           F +   +  + + GV+ + ++ L SF+ G VIA +   QL QFGA+I+ +D + I   RE
Sbjct: 149 FRMRETVYHIQHSGVNALFIIGLTSFLVGLVIAYESLVQLVQFGADIYVVDGIGIAITRE 208

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G ++TA++IAGRS S+  AEIG+MKI EEI A++T+G D    L+ PRI A++I+LPLL
Sbjct: 209 LGPMITAIVIAGRSASSYAAEIGTMKITEEIAAMQTLGFDPFYFLVIPRIVAMMIALPLL 268

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
              ++   I+G  I      D+ F  F  R        +   G++K PF A  I      
Sbjct: 269 IFFSDVIGILGGMIATKVQVDLSFTFFIERLQEVLAAKHYILGIVKGPFFALIIAATGCF 328

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            GF V   + S+G + T  VV +I  VI  D+LFA+ Y  +G
Sbjct: 329 HGFRVTGDTESIGIETTASVVHAIFFVIACDALFAVIYTQLG 370


>gi|186474974|ref|YP_001856444.1| hypothetical protein Bphy_0205 [Burkholderia phymatum STM815]
 gi|184191433|gb|ACC69398.1| protein of unknown function DUF140 [Burkholderia phymatum STM815]
          Length = 379

 Score =  150 bits (379), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 109/379 (28%), Positives = 186/379 (49%), Gaps = 32/379 (8%)

Query: 8   VFRFAGNWKS-------------PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIG 54
           + R +G W +             P + E+ D          ++  A  DLS +  +D +G
Sbjct: 19  IVRLSGQWTALALARDRLHGQALPRLRELVDS---------RAHVAQWDLSNVERMDHVG 69

Query: 55  AELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHI 114
            +  ++ +  Y     L  ++     +F  I+     + +N +P R F  + F  L    
Sbjct: 70  GQ-ALWRVWGYKLPRDLVALNDTQRDIFDRIALLDTVR-ENPEPVRRF--DPFTQL---- 121

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
           G  I  F+        + G VI +     A + K   +   +   +Y  G   +P+  L+
Sbjct: 122 GLGIFSFVEHVYGGVAMFGRVILDLLSI-ARNPKLAPWK-EISANVYSAGTQALPITALV 179

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           +F+ G V++   A QL  FGA  F ++++ +  LRE+G +L+A+++AGRSGSAI A+IG 
Sbjct: 180 AFLIGIVLSYLSAQQLRLFGANQFIVNILGMSVLRELGPVLSAILVAGRSGSAITAQIGV 239

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  +++G ++       I  
Sbjct: 240 MRVTEELDAMRVMGIPHGLRLILPRVIALSLAMPLLVMWTNIISLLGGALAAKLVLQIDV 299

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
           + F         +AN++ GL K       I I     GF +  +S SLG+  TT VV SI
Sbjct: 300 SYFVRALPGVVPVANLWIGLGKGMVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVSSI 359

Query: 355 SIVIIIDSLFAIFYFAIGI 373
           +IVI+ D++FAI +  +G+
Sbjct: 360 TIVILADAVFAILFQNVGL 378


>gi|206559095|ref|YP_002229855.1| hypothetical protein BCAL0697 [Burkholderia cenocepacia J2315]
 gi|198035132|emb|CAR51006.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 374

 Score =  150 bits (378), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 104/364 (28%), Positives = 175/364 (48%), Gaps = 11/364 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   +        +  DLS I  +D +G + +     +  G+ 
Sbjct: 21  RLTGQWTALALARNRGAVARRVASIATGRVSEWDLSGIERLDHVGGQALW----RVWGRK 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R    +    L    G+ I  F        
Sbjct: 77  LPAGVALSATQ-RTIFERIERLDSEREAPERVVRVDPVTRL----GQAIFSFGEHLQGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
            + GLVI +                S    +Y  G   +P+  L++F+ G V++   A Q
Sbjct: 132 AMFGLVILDALSVLRRPQTMPWRETSA--NIYSAGAQALPITALVAFLIGIVLSYLSAQQ 189

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R MG+
Sbjct: 190 LQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVMGI 249

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                L+ PR+ AL +++PLL +  N  A+ G +I       I    F         +AN
Sbjct: 250 PHGLRLVLPRVLALGVAMPLLVMWTNIIALTGGAIAAKFVLGIDVNYFVRSLPGVVPIAN 309

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           ++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI + 
Sbjct: 310 LYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAILFQ 369

Query: 370 AIGI 373
            +G+
Sbjct: 370 NVGL 373


>gi|15606674|ref|NP_214054.1| hypothetical protein aq_1530 [Aquifex aeolicus VF5]
 gi|2983906|gb|AAC07457.1| hypothetical protein aq_1530 [Aquifex aeolicus VF5]
          Length = 340

 Score =  149 bits (377), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 182/346 (52%), Gaps = 29/346 (8%)

Query: 29  MAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI-KLQGVSTHIEQLFSLISF 87
           + I K+I+     +DLS + ++DT GA  +   +++ +  + +++G   H+E L  L+  
Sbjct: 23  LKIPKNIEK----IDLSDLKKLDTFGATFLALLIKENNIPLERVEGGEKHVE-LIKLV-- 75

Query: 88  THRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSY 147
               K+  + P++   + S KNL                S    LGL + ++ ++    +
Sbjct: 76  LDNLKLPKEIPEKKVSF-SLKNLF---------------SFPEFLGLFLIHSFKYI-KQF 118

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           +F  F     +++   G+  V +++ +SF+ G VIA Q A QL  FGA IF +DL+ I  
Sbjct: 119 EFSAFF----KELQTSGLGSVLILVSLSFLIGVVIAYQSAVQLRAFGAGIFIVDLVGIST 174

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
            RE+  LLT +++AGR  S   A +G  KINEEIDA+R MGL  V +L+ PR+ A +I  
Sbjct: 175 FRELAPLLTGIILAGRVSSGYTANVGLRKINEEIDALRVMGLSPVVLLVLPRVLASLIYT 234

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIV 327
           PLLT L+  + ++G +I+   +  I    FF +        ++F G +K PF   AI + 
Sbjct: 235 PLLTSLSAVAMLLGGAIIAQVFLGIGVEEFFKKLPEAVAKEDLFAGYVKTPFFGVAIALN 294

Query: 328 AMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            +  GF       SLG  V   VV  IS++I++D++F+I +  +GI
Sbjct: 295 GVYYGFLTDPKPESLGYSVMRSVVTGISVIILLDAVFSIIFLRLGI 340


>gi|294054794|ref|YP_003548452.1| protein of unknown function DUF140 [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614127|gb|ADE54282.1| protein of unknown function DUF140 [Coraliomargarita akajimensis
           DSM 45221]
          Length = 366

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 76/210 (36%), Positives = 130/210 (61%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           GV  +P+V+L++ +TG +IA  G  QL +F A+IF  DL+ +   RE+G ++T V++AGR
Sbjct: 157 GVQALPIVMLLNCLTGLIIAFIGVIQLQKFAADIFVADLVGLATARELGAVITGVIMAGR 216

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           +G+A  A+IGSM++NEE+DA+ T G+  ++ L+ PR+ AL++ +PLL ++A+   I+G  
Sbjct: 217 TGAAFAAQIGSMQVNEEVDALTTFGISPMQFLVVPRVVALVLMMPLLGVVADIVGILGGL 276

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           I+     D+    +F++ H    L + F G+ K       IGI     G   G  ++S+G
Sbjct: 277 IIAVSISDVSVIQYFNQVHQAVGLNDFFIGIFKCAVFGLIIGIAGCYRGLNCGRDASSVG 336

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              T+ VV SI+ +++ D++FA+    +GI
Sbjct: 337 LATTSAVVTSITWLVVADAIFAVLCHLLGI 366


>gi|307825468|ref|ZP_07655686.1| protein of unknown function DUF140 [Methylobacter tundripaludum
           SV96]
 gi|307733354|gb|EFO04213.1| protein of unknown function DUF140 [Methylobacter tundripaludum
           SV96]
          Length = 379

 Score =  149 bits (376), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 129/214 (60%)

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           +Y  GV  + +  L+ F+ G V++   A QL  FGAEI+ ID++ +  +RE+G LL A++
Sbjct: 165 IYESGVRALGITALVGFLIGIVLSYLSALQLKIFGAEIYIIDILGLSVIRELGPLLAAIL 224

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           +AGRSGSA+ A+IG M++ EE+DA+  MG+     L  P++ AL I LPL+ +  +  A+
Sbjct: 225 VAGRSGSAMTAQIGIMRVTEELDALSAMGISHSLRLTLPKVMALTIVLPLIGVWTSALAL 284

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           IG  +      DI +  FF +      L N+F GL K+      I ++A   GF +  ++
Sbjct: 285 IGGMVSAQNTLDISYQQFFLKLPDVVPLTNVFIGLGKSAVFGLMIALIACHFGFRIKPNT 344

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            SLG + T  VV +I++VI++D++FAI +  +G+
Sbjct: 345 ESLGNETTNSVVAAITVVIMVDAVFAILFMNVGM 378


>gi|326405508|ref|YP_004285590.1| putative ABC transporter permease [Acidiphilium multivorum AIU301]
 gi|325052370|dbj|BAJ82708.1| putative ABC transporter permease protein [Acidiphilium multivorum
           AIU301]
          Length = 362

 Score =  149 bits (376), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 170/336 (50%), Gaps = 27/336 (8%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           +DLS    IDT GA L++     + G+ + QG++   E L +        +++   P+  
Sbjct: 48  LDLSRAARIDTSGAALLLALERGHDGETRWQGLTPAAEGLIA--------RLRAALPETG 99

Query: 102 FFYNSFKNLH-----YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
                 + +        +G +I  F  ++         +++ TG      +   G   + 
Sbjct: 100 APPPPPRTVRGPGPLRTLGVRI-AFFGET---------ILATTGLPARRRFLRGG---NF 146

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
            R     G   +P+VI++ F+ G ++A Q A  + QFGA+I+   L+S+   RE+G LL 
Sbjct: 147 FRIAERAGAQALPLVIMLGFLIGMILAFQSAIPMRQFGADIYVAALVSLSLFRELGPLLA 206

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           AV++AGR+GSA  AE+G+M +NEE+ A+ TMG+D   +L+ PR+ A ++ +P L +  + 
Sbjct: 207 AVILAGRTGSAFAAELGTMMVNEEVAALTTMGIDPGTMLVIPRMAAAMLVMPALALGIDV 266

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           S ++G   V+      P +   ++    A+  ++  GL+K+     A+G++  + G   G
Sbjct: 267 SGVLGMGFVM-GILGFPPSAIVAQMQMAASPHDVLLGLMKSVVFGAAVGLIGCRAGLTAG 325

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               ++G+  T+ VV  I   I+ID LFA+  + +G
Sbjct: 326 GGPRAVGEAATSAVVGGIVATILIDGLFAVVLYRLG 361


>gi|237747194|ref|ZP_04577674.1| ABC transport system permease [Oxalobacter formigenes HOxBLS]
 gi|229378545|gb|EEO28636.1| ABC transport system permease [Oxalobacter formigenes HOxBLS]
          Length = 374

 Score =  149 bits (375), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 103/368 (27%), Positives = 188/368 (51%), Gaps = 25/368 (6%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQS----DSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
           GNW+   ++  A  V+  I  +++S     S   DL+ I E+D IGA+L+     K   +
Sbjct: 23  GNWRVESLA--ASGVINRIRSTVRSFSKKGSVSWDLTQILELDYIGAQLLWDNWNKTRPR 80

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
             L  V++   +LFS +      ++  +KP            H+ +  +I KF   +   
Sbjct: 81  ELL--VTSEQNKLFSRLESAGNLQLPAEKPA-----------HWQLFGRIRKFPQAAAEH 127

Query: 129 -AHILGLV---ISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
            + I+GLV   + +   F  + ++  G    +   +Y+ G   + +  ++ F+ G V++ 
Sbjct: 128 FSGIVGLVGQLMIDLARFAKAPHR--GPWTEISANIYHAGAQALGITAIVGFLIGVVLSY 185

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FG ++F ++L+ +  +RE+G LL A+++AGRSGS++ A++G M++ EE+ A+
Sbjct: 186 LSAQQLHMFGGDVFLVNLLGMSVIRELGPLLAAILVAGRSGSSMTAQLGVMRVTEELSAM 245

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           + MG+     LI P++ AL I +PLL I  +  A++G  +       +    F S   + 
Sbjct: 246 QVMGMSHGFRLIMPKVIALSIVMPLLIIWTDIVALLGGMLAASFEIGLSIPYFLSALPNA 305

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +AN + G+ K       I ++A   G  +  ++ SLG+  T  VV SI+IVI+ D++F
Sbjct: 306 VPMANFWIGIGKGIVFGILIALIACYYGMKIKPNTESLGQGTTNSVVTSITIVILADAIF 365

Query: 365 AIFYFAIG 372
           A+    +G
Sbjct: 366 AVVLQGVG 373


>gi|221069470|ref|ZP_03545575.1| protein of unknown function DUF140 [Comamonas testosteroni KF-1]
 gi|220714493|gb|EED69861.1| protein of unknown function DUF140 [Comamonas testosteroni KF-1]
          Length = 375

 Score =  149 bits (375), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 99/332 (29%), Positives = 171/332 (51%), Gaps = 14/332 (4%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF 102
           DL  +  +D IGA+L+    E++ G+     + T   Q   L       ++   KP+ S 
Sbjct: 55  DLQQMVWLDHIGAQLLW---EQW-GRTWPARLLTTKNQRSMLERVARFSEVPEAKPEPSG 110

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQ-AHILGLVISNTGEFCASSY-KFKGFLLSLIRQM 160
           +      L    G+ ++    D+C   ++++ LV     +        F+G    +   +
Sbjct: 111 WMCEVNRL----GQMVI----DACGHFSNLIQLVGQLLLDCLRLLRNPFRGPWRDISGHL 162

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G + +P+  L+ F+ G V+A   A QL QFGAE F ++++ I  +RE+G LL A+++
Sbjct: 163 YATGATALPITALVGFLIGVVLAYLMALQLRQFGAESFIVNILGISLIRELGPLLAAILV 222

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRSGSAI A+IG M++ EE+DA++ MG+     L+ PR  AL +S+PL+ +    +A+ 
Sbjct: 223 AGRSGSAITAQIGVMRVTEELDAMQVMGISQGYRLVLPRALALAVSMPLVALWTILAALA 282

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  +      DI  + F     +   + N+   + K+      I ++    G  V  ++ 
Sbjct: 283 GGMVAADLTMDITPSYFIQSLPAAVKIGNLVLAMGKSVVFGVLIALIGCHWGLKVEPNTQ 342

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           SLG+  T  VV SI++VII+D++FAI +  +G
Sbjct: 343 SLGRGTTAAVVSSITMVIIVDAIFAILFRNVG 374


>gi|74316265|ref|YP_314005.1| ABC transporter permease [Thiobacillus denitrificans ATCC 25259]
 gi|74055760|gb|AAZ96200.1| ABC transport system permease protein [Thiobacillus denitrificans
           ATCC 25259]
          Length = 364

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 134/219 (61%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            L  Q+  V V  +P+V  + F+ G V A     Q  QFGA IF +D + +  LREI  +
Sbjct: 146 ELAAQVRDVFVGAIPIVSGMMFLLGVVFAYLLGDQARQFGANIFVVDGLLLAVLREISPV 205

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           + AV++AGR+G+AI A++G+MK+ EEIDAI T+GL  + +L+ PR+ ALI+++PLL  + 
Sbjct: 206 IVAVLVAGRTGAAITAQLGTMKVAEEIDAIATLGLSPLAVLVIPRVLALIVAMPLLVFIG 265

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           + + ++G  +V+ +   I   +F  R +    L  +  GL KAP  A  I +++ + G A
Sbjct: 266 DIAGLVGGMLVVQQQLAISPPIFLDRLYDVILLKTLMVGLGKAPVFALFIALISCRMGLA 325

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           V   + S+G   T+ VVQS+  VII++++FA+ +  +GI
Sbjct: 326 VSRDARSVGVNTTSTVVQSLVAVIILNAVFAVAFVRLGI 364


>gi|302342029|ref|YP_003806558.1| hypothetical protein Deba_0592 [Desulfarculus baarsii DSM 2075]
 gi|301638642|gb|ADK83964.1| protein of unknown function DUF140 [Desulfarculus baarsii DSM 2075]
          Length = 380

 Score =  148 bits (374), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 179/342 (52%), Gaps = 14/342 (4%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK--IKLQGVSTHIEQLFSLISFTH- 89
           K +   S ++DLS +  +DT GA  +  +         ++L+   +    + +LI     
Sbjct: 47  KELAPRSVLLDLSRLDYLDTSGAMAVKIWAAAPPQDLAVRLEAGQSRFRDMLALIDVDQV 106

Query: 90  RKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKF 149
           RK   N   + +            +G++I + +         + +V++            
Sbjct: 107 RKPAINPDKRDAGMLEGMGQSARRMGEQIGQLLAFVGQATKSVLMVVARPATLR------ 160

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
            G +L+ ++Q   VGV G+P+V LI  + G ++A   + QL  FGA+++   L+++  +R
Sbjct: 161 MGDVLAYMQQ---VGVDGLPIVSLIGLLLGMIMAFMSSLQLKSFGADVYVATLVAVAMVR 217

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA+++AGRSGS+  AEIG+MK+NEE+DA+  MG D V  L  P++ A ++ +PL
Sbjct: 218 ELGPIMTAILVAGRSGSSFAAEIGTMKVNEEVDALTVMGYDPVIFLALPKVIAAVLMVPL 277

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAM 329
           LT+ +  +AI+G  IV     D+    + +   S+    ++ T + KA      I ++  
Sbjct: 278 LTLFSIAAAIMGGLIVGVAGLDLTPYTYLNESISSFDAGDLMTSMFKAAVFGLLIAVIGC 337

Query: 330 KEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI--FYF 369
           ++GF V   +  +GK  T+ VV ++ ++I+ DS+FAI  +YF
Sbjct: 338 QKGFTVEGGAAGVGKATTSAVVAALFLIIVTDSVFAIIQYYF 379


>gi|160872209|ref|ZP_02062341.1| ABC transporter, permease [Rickettsiella grylli]
 gi|159121008|gb|EDP46346.1| ABC transporter, permease [Rickettsiella grylli]
          Length = 375

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 117/352 (33%), Positives = 194/352 (55%), Gaps = 14/352 (3%)

Query: 25  DDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ--GVSTHIEQLF 82
           D     +N+ I+S   I++ + IT++D+ GA  +  + ++   K K+   G+++  + LF
Sbjct: 35  DQSFQKLNRHIES-PLILNAAFITQMDSSGAWQLYQWKKQLAKKRKVHLIGLNSKHQALF 93

Query: 83  SLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGL-VISNTGE 141
            +I  T  ++IK    +++F     + L   +GKK ++  N+  S    +G   IS    
Sbjct: 94  GMIE-TAAEQIKPLPREKTF-----RGLGL-LGKKSIEQWNELKSYLAFIGKNFISACHA 146

Query: 142 FCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSID 201
           F          +L +I      G+  + ++ L+SF+ G V+  Q  FQL  FGA  F ID
Sbjct: 147 FLHPRQLRVRAILGIIEN---TGLDALGIIALLSFMIGIVLTYQMGFQLKNFGATRFIID 203

Query: 202 LMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIW 261
           L+ +  LRE   LLTA+M+AGRSGSA  A++G MKI EEIDA+ TMG+   ++LI PR+W
Sbjct: 204 LLGLAILREFSPLLTAIMVAGRSGSAFTAQLGMMKIKEEIDALNTMGVLPRQLLILPRLW 263

Query: 262 ALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMA 321
            L+++LPLLT+ A+   ++G   +     +I +  F  RF    +L+++  G+ KAP  A
Sbjct: 264 GLLLALPLLTVWADIFGLLGGMAMTHNMMNISYLDFLHRFPKVVSLSSLIIGVGKAPVFA 323

Query: 322 CAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             I   A  +G  V   ++S+G++ T  VVQ I  +I+ D+LF+I +  + I
Sbjct: 324 LIIASTACFQGLRVSGSADSVGRQTTRSVVQGIFFIIVADALFSILFSTLNI 375


>gi|183220168|ref|YP_001838164.1| ABC transporter permease [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189910288|ref|YP_001961843.1| ABC transporter membrane protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774964|gb|ABZ93265.1| Membrane protein of an ABC transporter complex [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167778590|gb|ABZ96888.1| ABC-type transport system, permease [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 374

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 97/294 (32%), Positives = 161/294 (54%), Gaps = 16/294 (5%)

Query: 87  FTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASS 146
           F +R  I N   ++   YN    +     ++I K   DS  +   L   I+ TGE   S 
Sbjct: 90  FQYRLNITNDDSKK---YNEQLAVSLRKSEQIGKLTIDSLLEFKYL---ITFTGELTVSF 143

Query: 147 YKFKGFL-------LSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFS 199
           ++   FL           R    +GV+  P++ +I F+ G +++ Q A  + +FGAEIF 
Sbjct: 144 WR--SFLHPSKIRWKDSFRVAESMGVNAFPIIAMIGFLLGLIMSFQSAIPMRRFGAEIFV 201

Query: 200 IDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPR 259
            +L+ +   RE+G L+TA +++GRSGS+  AE+G+MK++EEIDA+ TMGL  V+ LI PR
Sbjct: 202 ANLVGLSLFRELGPLMTAFILSGRSGSSFAAELGTMKVSEEIDALTTMGLPPVQFLIIPR 261

Query: 260 IWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPF 319
           + A +I  PLLTI+ N   +IG ++V+   +  P   F ++ +    L++I  GL+K+ F
Sbjct: 262 LVASLIVTPLLTIVFNLFGLIGGAVVLVS-FGFPLITFVNQVNIAVGLSDILGGLLKSYF 320

Query: 320 MACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
               I  +    G      + ++G+  T+ VV SI +V I+D +F++ +F + I
Sbjct: 321 FGMIIASIGCYRGLKTASGAGAVGESTTSAVVGSIILVSILDGIFSVLFFYLRI 374


>gi|192359616|ref|YP_001982090.1| ABC-type transport system, permease [Cellvibrio japonicus Ueda107]
 gi|190685781|gb|ACE83459.1| ABC-type transport system, permease component [Cellvibrio japonicus
           Ueda107]
          Length = 375

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 75/210 (35%), Positives = 131/210 (62%), Gaps = 1/210 (0%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           G   + +V LI+ + G ++A  G+ QL Q GA+++  DL+++  +RE+G L+TAV++AGR
Sbjct: 167 GPRALAIVTLIALLVGMILAYLGSVQLRQLGAQVYVADLVALGMVREMGALMTAVIMAGR 226

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           +G+A  A++G+M++NEEIDA++TMG+  +  L+ PR+ AL++ +PLL I AN   ++G +
Sbjct: 227 TGAAYAAQLGTMQVNEEIDALKTMGISSIEFLVLPRLLALVLVMPLLCIYANVIGMVGGA 286

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           +V     D+ F  +  +        +I TGL+K+ F    I I   + G   G +S+++G
Sbjct: 287 LVA-TSMDVNFIQYILQTQGAVGWVDISTGLVKSVFFGVLIAIAGCQAGIHCGRNSDAVG 345

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              T  VV++I  +++ D+ F I Y  +GI
Sbjct: 346 MAATNAVVRAIVYLVVADAAFNILYDKLGI 375


>gi|116690919|ref|YP_836542.1| hypothetical protein Bcen2424_2901 [Burkholderia cenocepacia
           HI2424]
 gi|116649008|gb|ABK09649.1| protein of unknown function DUF140 [Burkholderia cenocepacia
           HI2424]
          Length = 447

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/380 (28%), Positives = 183/380 (48%), Gaps = 43/380 (11%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   I        +  DLS I  +D +G + +     +  G+ 
Sbjct: 94  RLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALW----RVWGRK 149

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R                 IV+F  D  ++ 
Sbjct: 150 LPAGVALSATQ-RTIFERIERLDSEREAPER-----------------IVRF--DPVTR- 188

Query: 130 HILGLVISNTGEFCASSYKFKGFL----LSLIRQ------------MYYVGVSGVPVVIL 173
             LGL I   GE         G +    LS++R+            +Y  G   +P+  L
Sbjct: 189 --LGLAIFAFGEHLQGGITMFGRVILDALSVLRRPKTMPWKETSANIYSAGAQALPITAL 246

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG
Sbjct: 247 VAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIG 306

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I 
Sbjct: 307 VMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKLVLGID 366

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F         +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV S
Sbjct: 367 INYFVRSLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSS 426

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I++VI+ D++FAI +  +G+
Sbjct: 427 ITVVILADAVFAILFQNVGL 446


>gi|254247077|ref|ZP_04940398.1| hypothetical protein BCPG_01856 [Burkholderia cenocepacia PC184]
 gi|124871853|gb|EAY63569.1| hypothetical protein BCPG_01856 [Burkholderia cenocepacia PC184]
          Length = 425

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/380 (28%), Positives = 183/380 (48%), Gaps = 43/380 (11%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   I        +  DLS I  +D +G + +     +  G+ 
Sbjct: 72  RLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALW----RVWGRK 127

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R                 IV+F  D  ++ 
Sbjct: 128 LPAGVALSATQ-RTIFERIERLDSEREAPER-----------------IVRF--DPVTR- 166

Query: 130 HILGLVISNTGEFCASSYKFKGFL----LSLIRQ------------MYYVGVSGVPVVIL 173
             LGL I   GE         G +    LS++R+            +Y  G   +P+  L
Sbjct: 167 --LGLAIFAFGEHLQGGIAMFGRVILDALSVLRRPKTMPWKEISANIYSAGAQALPITAL 224

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG
Sbjct: 225 VAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIG 284

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I 
Sbjct: 285 VMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKLVLGID 344

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F         +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV S
Sbjct: 345 INYFVRSLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSS 404

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I++VI+ D++FAI +  +G+
Sbjct: 405 ITVVILADAVFAILFQNVGL 424


>gi|170734244|ref|YP_001766191.1| hypothetical protein Bcenmc03_2910 [Burkholderia cenocepacia MC0-3]
 gi|169817486|gb|ACA92069.1| protein of unknown function DUF140 [Burkholderia cenocepacia MC0-3]
          Length = 374

 Score =  148 bits (373), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 109/380 (28%), Positives = 183/380 (48%), Gaps = 43/380 (11%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   I        +  DLS I  +D +G + +     +  G+ 
Sbjct: 21  RLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALW----RVWGRK 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R                 IV+F  D  ++ 
Sbjct: 77  LPAGVALSATQ-RTIFERIERLDSEREAPER-----------------IVRF--DPVTR- 115

Query: 130 HILGLVISNTGEFCASSYKFKGFL----LSLIRQ------------MYYVGVSGVPVVIL 173
             LGL I   GE         G +    LS++R+            +Y  G   +P+  L
Sbjct: 116 --LGLAIFAFGEHLQGGIAMFGRVILDALSVLRRPKTMPWKETSANIYSAGAQALPITAL 173

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG
Sbjct: 174 VAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIG 233

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I 
Sbjct: 234 VMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKLVLGID 293

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F         +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV S
Sbjct: 294 INYFVRSLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSS 353

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I++VI+ D++FAI +  +G+
Sbjct: 354 ITVVILADAVFAILFQNVGL 373


>gi|27363501|ref|NP_759029.1| putative ABC transport system permease [Vibrio vulnificus CMCP6]
 gi|27359617|gb|AAO08556.1| Putative ABC transport system permease protein [Vibrio vulnificus
           CMCP6]
          Length = 357

 Score =  147 bits (371), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 81/204 (39%), Positives = 125/204 (61%), Gaps = 1/204 (0%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           G   VP+++LI F+ G +IA +      QFGA +F  D + I  LRE+G L+TA++ AGR
Sbjct: 153 GADAVPIIMLIGFLMGVIIAFEIGLVAEQFGAVLFVADGIGISMLRELGPLMTAIVFAGR 212

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           +G+A  AEIG+ K+NEEI+A+RT G+  V  L+ PRI+A I+ LPLLT+ A+   + G +
Sbjct: 213 TGAAFAAEIGTQKVNEEINALRTFGISPVEFLVIPRIYASILVLPLLTVFADIIGVFGGA 272

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           +V+ K +DI F  ++ +  S  ++ +   GLIKA      I ++  + G A G  S S+G
Sbjct: 273 LVLLK-FDISFVQYYHQLLSALSIWDFGFGLIKATTFGFIIAVIGCERGLATGQGSTSVG 331

Query: 344 KKVTTCVVQSISIVIIIDSLFAIF 367
              T+ VV SI  +++ID  F + 
Sbjct: 332 LAATSAVVSSIIWIVVIDGFFTVL 355


>gi|89256086|ref|YP_513448.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314562|ref|YP_763285.1| ABC transporter ATP-binding protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156502103|ref|YP_001428168.1| ABC transporter membrane protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167010771|ref|ZP_02275702.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367414|ref|ZP_04983440.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|290954528|ref|ZP_06559149.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312044|ref|ZP_06802859.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143917|emb|CAJ79136.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129461|gb|ABI82648.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134253230|gb|EBA52324.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|156252706|gb|ABU61212.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 366

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 110/335 (32%), Positives = 173/335 (51%), Gaps = 24/335 (7%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK-----IKNQ 96
           +D++ I  +DT GA    YF+ K    ++L    T  + +F      H+ K     + N 
Sbjct: 40  IDITKIQALDTAGA----YFILKVLKDLEL----TKEDLIFD----NHKDKNLIELVANN 87

Query: 97  KPQRSFFYNSFK-NLH----YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG 151
            P R    NS K N+     Y +GK     + +  +    LG ++   G        ++ 
Sbjct: 88  FPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEIKASIGFLGAIL--LGYLTLIRKPYRS 145

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
           F   ++   Y   +  + +V+L+S + G V+       + Q+  +IF +D++ I   RE 
Sbjct: 146 FFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPLNLMMQYSTQIFVVDMLGISSFREF 205

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
             L TA++IAGRS SA  +EIG MK+NEEIDA++T+G D ++ L+ PRI ALIISLP+LT
Sbjct: 206 APLFTAIIIAGRSSSAFTSEIGIMKVNEEIDALQTIGEDPIQRLVLPRITALIISLPVLT 265

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
           ++A  + II   I+      I    F  R  S   + + + GL+K PF A  I  +   +
Sbjct: 266 VIAMIANIISGIIIADVIAGITPLQFIERLFSNVNVNHFYIGLLKTPFFALVIAGIGCHQ 325

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           G AV   S S+GK  T  VV SI ++I+ID++FA+
Sbjct: 326 GLAVRRDSQSVGKATTNSVVYSIFLIIVIDAIFAV 360


>gi|94263506|ref|ZP_01287318.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456144|gb|EAT06287.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 379

 Score =  147 bits (370), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 106/387 (27%), Positives = 198/387 (51%), Gaps = 41/387 (10%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +GI      G  ++  I  +  ++   + K+      ++D+  +  +D  G  L+++F
Sbjct: 19  SADGILHAVVRGRMEAGSIGPLWQELASKLKKT--RAGLVLDVEKVDYLDMSGQALLLHF 76

Query: 62  ---MEKYHGKIKLQGVST---HIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIG 115
              M+  +  ++++G+     HI++   +  F +R K   ++       ++ + L    G
Sbjct: 77  SRLMQDSNRPVEVRGLRPDFRHIQE--QIDCFDYRPKPLQRR------LSAVEEL----G 124

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCAS---------SYKFKGFLLSLIRQMYYVGVS 166
           +  V    D       +G   S  GEF +S         + ++K     ++  M  VG  
Sbjct: 125 RAAVNLGRD-------IGQFFSFVGEFVSSLAYCLAHPGTVRWK----DVLSHMENVGGR 173

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
            V ++ L+ F+ G +IA Q A  L  FGAE+F   L+ +  +RE+G L+TA+++AGRSGS
Sbjct: 174 AVFIIALMGFLIGVIIAFQTAITLKTFGAEMFVAKLLGLSMVRELGPLVTAIILAGRSGS 233

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A  AEIG+MK NEEI+A++TMGL+ VR L+ PR+ A ++  PLL +     + IG ++V+
Sbjct: 234 AFAAEIGTMKTNEEINALQTMGLNPVRFLVVPRMLATMLVTPLLCVFFLLFSFIGGALVM 293

Query: 287 WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
               D     +  +  ++  +A+   G++K    +  +  V    G   G  ++++G+  
Sbjct: 294 LS-MDFTLNSYVHQLSTSVGMADFLGGMVKVLVFSILVAWVGCVRGLQTGSGASAVGRST 352

Query: 347 TTCVVQSISIVIIIDSLFAIFYFAIGI 373
           T+ VV +I ++I+ D +FA+ Y+ +GI
Sbjct: 353 TSAVVSAIILIILADGIFAVVYYMLGI 379


>gi|94263144|ref|ZP_01286962.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456515|gb|EAT06629.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 379

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 105/384 (27%), Positives = 193/384 (50%), Gaps = 35/384 (9%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +GI      G  ++  I  +  ++   + K+      ++D+  +  +D  G  L+++F
Sbjct: 19  SADGILHAVVRGRMEAGSIGPLWQELASKLKKT--RAGLVLDVEKVDYLDMSGQALLLHF 76

Query: 62  ---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
              M+  +  ++++G+      +   IS   R    ++  QR        +    +G+  
Sbjct: 77  SRLMQDGNLPVEIRGLHPDFRHIQEQIS---RFDCHSKPAQRRL------SAVEELGRAA 127

Query: 119 VKFINDSCSQAHILGLVISNTGEFCAS---------SYKFKGFLLSLIRQMYYVGVSGVP 169
           V    D       +G   S  GEF +S         + ++K     ++  M  VG   V 
Sbjct: 128 VNLGRD-------IGQFFSFVGEFVSSLAYCLAHPGTVRWK----DVLSHMENVGGRAVF 176

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           ++ L+ F+ G +IA Q A  L  FGAE+F   L+ +  +RE+G L+TA+++AGRSGSA  
Sbjct: 177 IIALMGFLIGVIIAFQTAITLKTFGAEMFVAKLLGLSMVRELGPLVTAIILAGRSGSAFA 236

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           AEIG+MK NEEI+A++TMGL+ VR L+ PR+ A ++  PLL +     + IG ++V+   
Sbjct: 237 AEIGTMKTNEEINALQTMGLNPVRFLVVPRMLATMLVTPLLCVFFLLFSFIGGALVMLS- 295

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D     +  +  ++  +A+   G++K    +  +  V    G   G  ++++G+  T+ 
Sbjct: 296 MDFTLNSYVHQLSTSVGMADFLGGMVKVLVFSILVAWVGCVRGLQTGSGASAVGRSTTSA 355

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV +I ++I+ D +FA+ Y+ +GI
Sbjct: 356 VVSAIILIILADGIFAVVYYMLGI 379


>gi|319791003|ref|YP_004152643.1| hypothetical protein Varpa_0310 [Variovorax paradoxus EPS]
 gi|315593466|gb|ADU34532.1| protein of unknown function DUF140 [Variovorax paradoxus EPS]
          Length = 388

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/340 (28%), Positives = 177/340 (52%), Gaps = 31/340 (9%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ-- 99
           DL  I ++D IGA+L+  ++  ++   ++++  + H   L  +  +T    ++  K    
Sbjct: 67  DLRPIEQLDHIGAQLLWEHWRHEWPATLEME--AQHKAVLDQVAQYTVATPVEPPKTLAD 124

Query: 100 --RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYK-----FKGF 152
             R+F +N         G + +    D      ++G +  + G    + ++     F G 
Sbjct: 125 RIRTFSHN---------GPRAMVVARDFIG---LIGQLAIDVGTLIRAPHRAPWRDFSGH 172

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L       Y  G + + +  L+  + G V+A   + QL  +GAE F ++++ +  +RE+G
Sbjct: 173 L-------YQFGATALHITALVGLLIGVVLAYLISQQLRNYGAEAFVVNILGLSLVRELG 225

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            +L AV+IAGRSGSAI A+IG M++ EE+DA+R MG+     L+ PR+ AL I++PL+++
Sbjct: 226 PVLAAVLIAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRVLALAIAMPLISL 285

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
             + +A++G  +      DI  A F S       +AN++  + K+      I ++    G
Sbjct: 286 WTSMAALLGGMLAADAALDISPAYFLSALPRAVPIANLWLAMAKSAVFGILIALIGCYFG 345

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             V  ++ SLG+  T+ VV SI+ VI++D+LFA+ +  IG
Sbjct: 346 MKVKPNTESLGRGTTSSVVTSITAVILVDALFAVLFKGIG 385


>gi|88810292|ref|ZP_01125549.1| hypothetical protein NB231_14468 [Nitrococcus mobilis Nb-231]
 gi|88791922|gb|EAR23032.1| hypothetical protein NB231_14468 [Nitrococcus mobilis Nb-231]
          Length = 364

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 102/367 (27%), Positives = 194/367 (52%), Gaps = 27/367 (7%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH---GK 68
           +G+W    ++ +   +    N  + S    ++L  I+ +DT GA ++     +       
Sbjct: 13  SGDWSVERLAAVERQIRR--NAPMTSGEWRINLGEISTLDTAGAVMVQRLCRRLRTAGAS 70

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC-- 126
           ++L+ VS     +  L++     ++  ++P        + N    +G+++     D C  
Sbjct: 71  VQLEDVSAERHAVLKLVA--SEMEVTPRRP--------YSNPLERLGRRV----TDGCFG 116

Query: 127 --SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  +G + +++       ++ +   +++  ++   GV  +P++ L++F+ G V+A 
Sbjct: 117 ITEYLAFIGRLTADSLPRMLRPHRLRWHEIAV--ELERAGVMAIPIIGLLAFLIGIVMAY 174

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q    L  +GA IF +DL+ ++ LRE+G L+TAV++AGR+G++  A+IG+M + EE+DA+
Sbjct: 175 QSGDILQTYGANIFLVDLLGVIILREMGPLMTAVIVAGRTGASYTAQIGTMHLTEEVDAL 234

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RTMG+    +L+ P+  AL+I+LPLLT+ A+   ++G  +V    Y + F VF  R   T
Sbjct: 235 RTMGVTPFEMLVLPKFLALLIALPLLTVWADAIGLLGGMLVSSLLYGVDFDVFLRRL-PT 293

Query: 305 ATLANIF-TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           A   N+F  G+ KAP  A  I  +   +GF +   ++ +G+  T  VVQ I  VI+ D++
Sbjct: 294 AVPPNMFWVGIAKAPVFAALIASIGCYQGFRIRYSADEVGRYTTISVVQGIFWVIVADAV 353

Query: 364 FAIFYFA 370
           F+I  F+
Sbjct: 354 FSIVLFS 360


>gi|91786141|ref|YP_547093.1| hypothetical protein Bpro_0230 [Polaromonas sp. JS666]
 gi|91695366|gb|ABE42195.1| protein of unknown function DUF140 [Polaromonas sp. JS666]
          Length = 383

 Score =  146 bits (369), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 180/332 (54%), Gaps = 13/332 (3%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           DLS + ++D +GA+++  ++   +  +++++     +  L ++  F     +   KP+ S
Sbjct: 64  DLSGLEKLDHLGAQVLWNHWGRDWPAQLQVEPSQRAV--LETVAKFA----VVPPKPRGS 117

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
                +K+L   +G + +  ++ S     ++G ++ +        +  +G    L   +Y
Sbjct: 118 ----DWKDLLVLLGNRALDLVDHSKGLVRLVGQLLLDIIRLV--RHPKEGPWRDLSGHLY 171

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
           ++G + +P+  L+ F+ G V+A   + QL QFGA+ + ++++ I  +RE+G +L A++IA
Sbjct: 172 HIGATALPITALVGFLIGVVLAYLISQQLRQFGADAYIVNILGISLIRELGPVLAAILIA 231

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL + +PL+++    +A++G
Sbjct: 232 GRSGSAITAQIGVMRVTEELDAMRVMGIARGFRLVMPRALALAVVMPLISVWTTIAALLG 291

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
             +       +  + F +        AN+     K+      I +V    G  V  ++ S
Sbjct: 292 GMLAADISMGVTPSYFINSLPRAVDAANLTLATGKSVVFGVLIAMVGCHYGLRVKPNTES 351

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           LG+  T  VV SI++VI++D+LFA+ + ++GI
Sbjct: 352 LGQGTTASVVTSITVVILVDALFAVVFKSVGI 383


>gi|77920339|ref|YP_358154.1| ABC transporter permease [Pelobacter carbinolicus DSM 2380]
 gi|77546422|gb|ABA89984.1| ABC-type transport system, permease component [Pelobacter
           carbinolicus DSM 2380]
          Length = 386

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 128/214 (59%), Gaps = 1/214 (0%)

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           M   GV+ +P+V LISF+ G ++A Q    + QFG EI+  +L ++  LRE+G L+TA++
Sbjct: 174 MEKAGVNSLPIVGLISFLIGLIMAFQATIPMRQFGVEIYVANLTALSMLRELGPLMTALL 233

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           +AGRS SA  AE+G+MKINEEIDA+ TMGL  +  L+  R+ A +I LPLL++ AN   +
Sbjct: 234 LAGRSSSAFAAELGTMKINEEIDALTTMGLAPIPFLVVTRVLATVIILPLLSLFANLMGL 293

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           IG ++V+      P   + ++  +   L ++  GL+K    A  +  V    G      +
Sbjct: 294 IGGAVVLLS-LGYPLVTYTNQVKAAVNLGDLTGGLVKTLVFALIVAGVGCLYGLKTRSGA 352

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           +++G   T  VV  I ++++ D LFA+ Y+ +GI
Sbjct: 353 SAVGDSATRAVVSGIILIVVADGLFAVVYYFLGI 386


>gi|313109004|ref|ZP_07794978.1| hypothetical protein PA39016_001650017 [Pseudomonas aeruginosa
           39016]
 gi|310881480|gb|EFQ40074.1| hypothetical protein PA39016_001650017 [Pseudomonas aeruginosa
           39016]
          Length = 240

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 137/218 (62%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           S+I Q+    V  +P+V L+SF+ G V+A  GA  L+ FGA IFS+ L++   +RE GVL
Sbjct: 22  SVIAQIQRSAVDAIPIVALLSFMVGMVVAFLGATVLANFGASIFSVHLVAFSFMREFGVL 81

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           L A++IAGR+ SA  A+IGSMK NEEIDA+R+  LD + +L+ PR+ AL++SLPLLT++ 
Sbjct: 82  LPAILIAGRTASAYTAQIGSMKANEEIDALRSNALDPIELLVLPRVLALLVSLPLLTLVG 141

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
             + I G + V     +IP A F +       + +   G+ K+P  A  I  +   EGF 
Sbjct: 142 ILAGIAGGATVCALSLEIPPAQFLAIVQEKIEVRHFLVGMSKSPLFAVMIAAIGCHEGFK 201

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           V   + S+G   T+ VVQSI +VI+ID++ A+F+  +G
Sbjct: 202 VAGSAESVGDHTTSSVVQSIFMVILIDAIAALFFMEMG 239


>gi|172061853|ref|YP_001809505.1| hypothetical protein BamMC406_2812 [Burkholderia ambifaria MC40-6]
 gi|171994370|gb|ACB65289.1| protein of unknown function DUF140 [Burkholderia ambifaria MC40-6]
          Length = 374

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 103/376 (27%), Positives = 179/376 (47%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   +        +  DLS I  +D +G + +     +  G+ 
Sbjct: 21  RLYGQWTALALARNRGAVARRVAGIASGRVSEWDLSGIERLDHVGGQALW----RVWGRK 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R   +     L + +      F        
Sbjct: 77  LPDGVALSTTQR-TIFERIERLDSQREAPERVVHFGPITRLGFML----FAFAEHLQGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            + GLVI +               LS++R+            +Y  G   +P+  L++F+
Sbjct: 132 AMFGLVILDA--------------LSVLRRPKTMPWKETSANIYSAGAQALPITALVAFL 177

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 178 IGIVLSYLSAQQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 237

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I    F
Sbjct: 238 TEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDINYF 297

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 298 VRSLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVV 357

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 358 ILADAVFAIMFQNVGL 373


>gi|121603099|ref|YP_980428.1| hypothetical protein Pnap_0182 [Polaromonas naphthalenivorans CJ2]
 gi|120592068|gb|ABM35507.1| protein of unknown function DUF140 [Polaromonas naphthalenivorans
           CJ2]
          Length = 382

 Score =  146 bits (369), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 92/331 (27%), Positives = 176/331 (53%), Gaps = 11/331 (3%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF 102
            LS + ++D +GA+ +++    +H    LQ        L ++  FT    ++   P R  
Sbjct: 63  SLSPLEKLDYLGAQ-VLWSAWNHHWPAGLQIEPEQRAMLETVEKFT----VRPLPPPRPS 117

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYY 162
           +          +G++++  ++ +     +LG ++ + G      +  +G    L   +Y 
Sbjct: 118 WLEPV----LMLGERLLSLLSHAKGMLRLLGQLLLDMGRLV--RHPQQGPWRDLSGHLYN 171

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
            G + +P+  L+ F+ G V+A   + QL QFGA+ F ++++ I  +RE+G +L A++IAG
Sbjct: 172 FGATALPITALVGFLIGVVLAYLISQQLRQFGADAFIVNILGISLIRELGPVLAAILIAG 231

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL + +PL+++    +A++G 
Sbjct: 232 RSGSAITAQIGVMRVTEELDAMRVMGIARGFRLVMPRAMALALVMPLISVWTTIAALLGG 291

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
            +       +  + FF+   +   ++N+     K+      I ++    G  V  ++ SL
Sbjct: 292 MLAADISMGVTPSFFFNALPAAVKVSNLVLATAKSVVFGLLIALIGCHYGLRVKPNTESL 351

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  T  VV SI++VI++D+LFA+ + ++GI
Sbjct: 352 GQGTTASVVTSITVVILVDALFAVLFKSVGI 382


>gi|148261999|ref|YP_001236126.1| hypothetical protein Acry_3017 [Acidiphilium cryptum JF-5]
 gi|146403680|gb|ABQ32207.1| protein of unknown function DUF140 [Acidiphilium cryptum JF-5]
          Length = 362

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 169/336 (50%), Gaps = 27/336 (8%)

Query: 42  VDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           +DLS    IDT GA L++     + G+ + QG++   E L +        +++   P+  
Sbjct: 48  LDLSRAARIDTSGAALLLALERGHDGETRWQGLTPAAEGLIA--------RLRAALPETG 99

Query: 102 FFYNSFKNLH-----YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
                 + +        +G +I  F  ++         +++ TG      +   G   + 
Sbjct: 100 APPPPPRTVRGPGPLRTLGVRI-AFFGET---------ILATTGLPARRRFLRGG---NF 146

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
            R     G   +P+VI++ F+ G ++A Q A  + QFGA+I+   L+S+   RE+G LL 
Sbjct: 147 FRIAERAGAQALPLVIMLGFLIGMILAFQSAIPMRQFGADIYVAALVSLSLFRELGPLLA 206

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           AV++AGR+GSA  AE+G+M +NEE+ A+ TMG+D   +L+ PR+ A ++ +P L +  + 
Sbjct: 207 AVILAGRTGSAFAAELGTMMVNEEVAALTTMGIDPGTMLVIPRMAAAMLVMPALALGIDV 266

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           S ++G   V+      P +   ++     +  ++  GL+K+     A+G++  + G   G
Sbjct: 267 SGVLGMGFVM-GILGFPPSAIVAQMQMATSPHDVLLGLMKSVVFGAAVGLIGCRAGLTAG 325

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               ++G+  T+ VV  I   I++D LFA+  + +G
Sbjct: 326 GGPRAVGEAATSAVVGGIVATILLDGLFAVILYRLG 361


>gi|94309017|ref|YP_582227.1| hypothetical protein Rmet_0072 [Cupriavidus metallidurans CH34]
 gi|93352869|gb|ABF06958.1| ABC transporter, inner membrane subunit [Cupriavidus metallidurans
           CH34]
          Length = 376

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 104/332 (31%), Positives = 172/332 (51%), Gaps = 15/332 (4%)

Query: 44  LSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRS 101
           L  IT +D IGA+LI    + ++G +    VS +  Q  +F+ I+    +  K    +R 
Sbjct: 58  LDGITRLDHIGAQLIW---QAWNGHMP-DNVSLNDGQKRVFARIAGLRTEGWKKHMVER- 112

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
             +N        +G  ++ F+        +LG ++ +   F  +  +  G    +   +Y
Sbjct: 113 --FNPVTI----VGASVLSFLAQLGVGVTMLGQLVFDLLRFLRAPQR--GPWREISANIY 164

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
            VG   + +  L++F+ G V++   A QL  FGA  F ++++ +  +RE+G +L A++IA
Sbjct: 165 NVGYKALGITALVAFLIGIVLSYLSANQLRIFGASTFIVNILGMAVIRELGPVLAAILIA 224

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSGSAI A+IG M++ EE+DA+  MG+     L+ PR+ AL IS+PLL    +  A+ G
Sbjct: 225 GRSGSAITAQIGVMRVTEELDAMSVMGISHGFRLVMPRVIALAISMPLLVAWTDLLALFG 284

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
             +      DI +  F  +      +AN++ GL K       I + A   G  V  ++ S
Sbjct: 285 GMVAARLQLDISYVYFLRQLPDAVPVANLWFGLCKGVVFGMLIALTACHFGLRVKPNTQS 344

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           LG+  T  VV SI++VII D++FAI +  IGI
Sbjct: 345 LGQGTTASVVTSITVVIIADAVFAILFKDIGI 376


>gi|323700846|ref|ZP_08112758.1| protein of unknown function DUF140 [Desulfovibrio sp. ND132]
 gi|323460778|gb|EGB16643.1| protein of unknown function DUF140 [Desulfovibrio desulfuricans
           ND132]
          Length = 381

 Score =  146 bits (368), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 95/337 (28%), Positives = 176/337 (52%), Gaps = 19/337 (5%)

Query: 43  DLSAITEIDTIGAELIMYFME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ 99
           D   +T +D  G  L++   E   +    I+L  +     +L  L   T   K ++ + +
Sbjct: 58  DCGGVTYMDGSGVALLLKLKELCAEKKAAIELTNLREEDSRLVDLTWDTALPKQRDSERE 117

Query: 100 RSFFYNSFKNLH---YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
           R     +        +H  ++++ F+ +S S   +LG    + G       ++K  +L+ 
Sbjct: 118 RRGLAEAVGAAGGELWHNVREMIAFVGESFS---LLGRAAVHPG-----MVRWKDVVLAC 169

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I     VGV  + +++LI F+ G +++ Q A  L +FG EIF  +++ ++  RE+G L+T
Sbjct: 170 IN----VGVESMFIIVLIGFLMGLIMSFQSAISLQRFGGEIFVPNMLGLVMFREMGPLVT 225

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           ++++A RSGSA  AEIG+MKINEE+DA+ TMGL  +R L+ P++ A +  +PL+T+  N 
Sbjct: 226 SILLAARSGSAFAAEIGTMKINEELDALTTMGLSPMRFLVVPKLLATMAMVPLMTMFFNL 285

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           ++++G ++V+      P   F SR  +  +  + + G+ K    +  +  V    G    
Sbjct: 286 ASLVGGALVMLS-MGYPLVTFTSRVFANVSATDFWGGMAKGLVFSFLVAGVGCLRGMQTR 344

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             ++++G   T+ VV  I ++   D LFA+ Y+ +GI
Sbjct: 345 SGASAVGLSTTSAVVSGIILIAFADGLFAVAYYYLGI 381


>gi|115353001|ref|YP_774840.1| hypothetical protein Bamb_2950 [Burkholderia ambifaria AMMD]
 gi|115282989|gb|ABI88506.1| protein of unknown function DUF140 [Burkholderia ambifaria AMMD]
          Length = 374

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 103/376 (27%), Positives = 179/376 (47%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   +        +  DLS I  +D +G + +     +  G+ 
Sbjct: 21  RLYGQWTALALARNRGAVARRVAGIASGRVSEWDLSGIERLDHVGGQALW----RVWGRK 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R   +     L + +      F        
Sbjct: 77  LPDGVALSPTQR-TIFERIERLDSQREAPERVVHFGPITRLGFML----FAFAEHLQGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            + GLVI +               LS++R+            +Y  G   +P+  L++F+
Sbjct: 132 AMFGLVILDA--------------LSVLRRPKTMPWKETSANIYSAGAQALPITALVAFL 177

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 178 IGIVLSYLSAQQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 237

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I    F
Sbjct: 238 TEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDINYF 297

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 298 VRSLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVV 357

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 358 ILADAVFAIMFQNVGL 373


>gi|238028752|ref|YP_002912983.1| hypothetical protein bglu_1g32160 [Burkholderia glumae BGR1]
 gi|237877946|gb|ACR30279.1| Hypothetical protein bglu_1g32160 [Burkholderia glumae BGR1]
          Length = 390

 Score =  145 bits (367), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 100/333 (30%), Positives = 167/333 (50%), Gaps = 15/333 (4%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQR 100
           DLSAI  +D +G + +     +  G     GV     Q  +F  I    R     + P+ 
Sbjct: 70  DLSAIERLDHVGGQALW----RVWGHRLPDGVVLTDNQRIVFERI---ERLDEAREAPEP 122

Query: 101 SFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQM 160
              ++    L    G  + +F         + G VI + G             +S    +
Sbjct: 123 VVRHDPVTRL----GLAMFQFGEHLFGGVAMFGRVILDLGAIARRPKTMPWTEISA--NV 176

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G   +P+  L++F+ G V++   A QL QFGA  + ++++ +  +RE+G +L+A+++
Sbjct: 177 YNAGAKALPITALVAFLIGIVLSYLSAQQLQQFGANRYIVNILGLSVIRELGPVLSAILV 236

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRSGSAI A+IG M++ EE+DA+R MG+     ++ PR+ AL +++PLL +  N  A+ 
Sbjct: 237 AGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRIVLPRVLALGVAMPLLVMWTNIVALS 296

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G ++       I F  F         +AN++ GL K       I +V    GF +  +S 
Sbjct: 297 GGALAAKFALGIDFNFFMRSLPGVVPIANLWIGLGKGVVFGMLIALVGCHFGFRIKANSQ 356

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           SLG+  TT VV SI++VI+ D++FAI +  +G+
Sbjct: 357 SLGEGTTTSVVSSITVVILADAVFAILFQNVGL 389


>gi|301062341|ref|ZP_07203004.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300443545|gb|EFK07647.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 390

 Score =  145 bits (367), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 100/384 (26%), Positives = 191/384 (49%), Gaps = 28/384 (7%)

Query: 1   MSENGITVFRFAGNW----KSPEISEIADDVVMAINKSIQSDSAI----VDLSAITEIDT 52
           +SE      +F G+W    K P IS        A+ K + S++A+     D   ++  D+
Sbjct: 24  LSEQKTLQIKFQGDWILENKRPSIS--------ALIKQMDSEAAVRQITFDTLGLSRWDS 75

Query: 53  IGAELIMYFMEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKN 109
                +   +EK   K   +  +G+     +L  L S    KK  ++K  R  F      
Sbjct: 76  ALLICLTKIIEKASQKDIPLDGKGLPEGAFKLLDLASTVPEKKGVHKKNGRPSFL----- 130

Query: 110 LHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVP 169
             + +G + V F N        +G   +   +F     +F+     L+R +   G+  +P
Sbjct: 131 --FQVGSESVAFFNSFLEALGFVGEAFNAFSKFLTGKARFRRS--DLMRIIQDCGIEALP 186

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           +V LIS + G ++A  GA QL+ FGA+I+  +L+ I  +R +G ++  +++AGR+G+A  
Sbjct: 187 IVSLISLLVGLILAFVGAVQLTMFGAQIYVANLVGIAMVRVMGAVMAGIIMAGRTGAAFA 246

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A++G+M++NEEIDA +TMG+  +  L+ PR+ AL + +PLL + A+   I+G  IV    
Sbjct: 247 AQLGTMQVNEEIDAFKTMGISPMEFLVLPRMLALTLMMPLLCLYADLMGILGGFIVGVGM 306

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            D+    ++++  +  TL++++ G++++      + +     G   G  ++++G   T+ 
Sbjct: 307 LDLNMMEYYNQTKAAVTLSDLWIGIVQSAVFGMLVALAGCLRGMQCGRSASAVGDATTSA 366

Query: 350 VVQSISIVIIIDSLFAIFYFAIGI 373
           VV  I  +I+  ++  +    +GI
Sbjct: 367 VVTGIVSIIVATAVITVITNMMGI 390


>gi|119897982|ref|YP_933195.1| hypothetical protein azo1691 [Azoarcus sp. BH72]
 gi|119670395|emb|CAL94308.1| conserved hypothetical membrane protein [Azoarcus sp. BH72]
          Length = 365

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 125/215 (58%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y V V  +PV  L+ F+ G V++   A QL  FGA+IF ++++ +  +RE+G +L +V
Sbjct: 149 NLYKVAVRAMPVTALVGFLIGVVLSYLSALQLRAFGADIFIVNILGLGIIRELGPVLVSV 208

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSA+ A++G M++ EEIDA+  MG+     L+ P++ AL +++PLL +  +  A
Sbjct: 209 LVAGRSGSAMTAQLGVMRVTEEIDALAAMGISASLRLVLPKVLALTLAMPLLVLWTSAVA 268

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G  +  W    + F  F         LAN+F GL K       I +VA   G  V  +
Sbjct: 269 LFGGMVSAWMELGMSFGFFLETLPRVVPLANVFVGLTKGLVFGLLISLVACHFGLRVKPN 328

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SL    T  VV +I++VI++D+LFAI    IG+
Sbjct: 329 TESLSANTTASVVTAITVVILVDALFAIATRRIGV 363


>gi|297538919|ref|YP_003674688.1| hypothetical protein M301_1733 [Methylotenera sp. 301]
 gi|297258266|gb|ADI30111.1| protein of unknown function DUF140 [Methylotenera sp. 301]
          Length = 378

 Score =  145 bits (365), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 118/384 (30%), Positives = 193/384 (50%), Gaps = 39/384 (10%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S N +     +G W +  +  I + +  AI  +I+ +  + D S +  +D  GA    + 
Sbjct: 12  SMNALPNLTLSGAWVASTLHNIVEKI-HAIPTTIELN-IVADGSGVEALDMSGA----WV 65

Query: 62  MEKYHGKIKLQGVS--------THIEQLFSLI-SFTHRKKIKNQ---KPQRSFFYNSFKN 109
           M+     +K QG S          +E+L  +   F+H    +N    KP           
Sbjct: 66  MQSLFSLLKAQGNSITLIGFKPEFVERLKVVTYEFSHHANPQNNIEIKP---------PT 116

Query: 110 LHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCAS-----SYKFKGFLLSLIRQMYYVG 164
           L  HIG    + + ++      +G V S    F AS       +++  L + IR+    G
Sbjct: 117 LLEHIGMATTEALKEAKDLLSFVGEVSS---VFLASFADPQRIRWRPILFN-IRE---AG 169

Query: 165 VSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRS 224
           ++ VP+V +++F+ G V+A Q A QL  +GA IF +DL+ I  LRE   L+ A++IAGRS
Sbjct: 170 LNAVPIVGILAFLLGVVVAYQSADQLRHYGANIFVVDLIGISMLREFAPLIAAIIIAGRS 229

Query: 225 GSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASI 284
           GSA  A+IG+M + EEIDA+R +G+  + +L+ P++  L ISLPLLT+ A+   I G  +
Sbjct: 230 GSAYAAQIGTMSVTEEIDAMRILGIAPMEMLVLPKLIGLAISLPLLTVWADMLGIFGGML 289

Query: 285 VIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
                 D+ F  F  R      +     GL KA   A  I ++   +GF     ++++G+
Sbjct: 290 TASAQLDVSFVDFVGRLVKAVEMTTYTVGLGKAFVFAIIITMIGCFQGFRTKGGADNVGR 349

Query: 345 KVTTCVVQSISIVIIIDSLFAIFY 368
           + T  VVQSI +VI+ D+LF++ +
Sbjct: 350 QTTRSVVQSIFLVIVADALFSVLF 373


>gi|182416429|ref|YP_001821495.1| hypothetical protein Oter_4625 [Opitutus terrae PB90-1]
 gi|177843643|gb|ACB77895.1| protein of unknown function DUF140 [Opitutus terrae PB90-1]
          Length = 376

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 87/302 (28%), Positives = 158/302 (52%), Gaps = 15/302 (4%)

Query: 74  VSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN--DSCSQAHI 131
           +   ++ L + ++ +H   + + +     F     N    + +K   F+     C    +
Sbjct: 88  LPPRVQTLLTQLASSHATSVPHDRSVN--FLAVVGNATMELSRKTQDFVQFFGEC----V 141

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           LG V     +      KF+      + +M   G   +P+V LI+F+ G  +A  GA  L 
Sbjct: 142 LGAV-----KLLKRPDKFR--WRDCLEEMQQCGAMALPIVSLIAFLVGVTLAYIGALVLR 194

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           Q+G +I+  DL+ +  +RE+G ++TAV++AGR+G+A  A++G+MK NEEIDA+ T+G+  
Sbjct: 195 QYGGDIYVADLIGMAMVREMGAVMTAVVLAGRTGAAFAAQLGNMKANEEIDALETLGISP 254

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           V+ L+ PR+ AL + +PLL + AN   I+G   V     DI  + ++    +  TL ++ 
Sbjct: 255 VQFLVMPRLLALGVMMPLLALYANALGILGGMAVSAGVLDISPSAYWVEMGTIVTLRDVA 314

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
           +G IKA      +G+     G      +  +G+  T+ VV SI ++++ D++FA+ +  I
Sbjct: 315 SGFIKAIAFGGIVGLSGCLRGLQAERSAAGVGRAATSAVVTSILLLVVADAIFAVLFNVI 374

Query: 372 GI 373
           G+
Sbjct: 375 GL 376


>gi|218961389|ref|YP_001741164.1| transporter, putative (modular protein) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730046|emb|CAO80958.1| transporter, putative (modular protein) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 358

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 179/353 (50%), Gaps = 16/353 (4%)

Query: 21  SEIADDVVMAINKSIQSDSA-IVDLSAITEIDTIGAELIMYFMEKY--HGKIKLQGVSTH 77
           +E   +  + +N  ++  S   +DLS I  +D+ G   +     +    G +  QG +  
Sbjct: 18  AETVPETFIEVNSLLKHQSPNTIDLSNINVLDSAGVAFLDELNTRLSAEGILLFQGATPE 77

Query: 78  IEQLFSLISFTHRKKIKNQKPQRSF-FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVI 136
           I+++    SF+  K IK   P+R   F+    +     G+    F N     + +    +
Sbjct: 78  IQEVID--SFSSLK-IKVPAPERKMGFFEKIGDSLVLAGQN---FYNVMLLASEVFYWAV 131

Query: 137 SNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAE 196
              G F     +   F +    Q   +G   +P++ L+SF+ G +++ Q + QL+ FGA 
Sbjct: 132 --IGIFSRKGQRKGSFTI----QCSLLGSQALPILSLLSFIVGFILSLQASVQLANFGAN 185

Query: 197 IFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILI 256
           +F  DLM+   +REI  L+TA+++AGRSGSAI +EI +M++ EEIDA++TM L  VR ++
Sbjct: 186 VFIADLMAFAMVREIAPLITAIIVAGRSGSAIASEIATMQVTEEIDALKTMALSPVRYVV 245

Query: 257 SPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIK 316
            P+  A+ + +P+L + +   + IG  ++   Y D+    F  R  +  TL ++ T   K
Sbjct: 246 VPKFHAITVVMPILVMFSILVSEIGGGLIAIDYLDLSVYTFVQRSINVLTLKDLVTSFGK 305

Query: 317 APFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           +   A  I I+    GF V   +  +GK  T+ VV SI  VII D++F++ Y 
Sbjct: 306 SVIFAWTIVIIGAYCGFQVKGGAEGVGKATTSSVVASIFAVIIWDAIFSLLYL 358


>gi|224437093|ref|ZP_03658074.1| hypothetical protein HcinC1_03955 [Helicobacter cinaedi CCUG 18818]
 gi|313143563|ref|ZP_07805756.1| ABC transport system permease [Helicobacter cinaedi CCUG 18818]
 gi|313128594|gb|EFR46211.1| ABC transport system permease [Helicobacter cinaedi CCUG 18818]
          Length = 367

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 102/341 (29%), Positives = 176/341 (51%), Gaps = 17/341 (4%)

Query: 31  INKSIQSDSAI-VDLSAITEIDTIGAELIMYFMEKYHGK-IKLQGVSTHIEQLFSLISFT 88
           ++K I ++  I +D   IT++D +    I   +E   GK  ++    + ++++F  +  +
Sbjct: 32  LSKLISANERITLDFLEITKVDFVFCAFIYGLLE---GKDYEILNADSQVKEIFQSMVES 88

Query: 89  HRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYK 148
             K   ++    S FY +     +  GK   +    S    +  G+    +  F  S + 
Sbjct: 89  LPKLENSKSKSHSMFYGAL----FDFGKFCERSYQSSLDFLNFFGMC---SFYFFRSCWN 141

Query: 149 FKGFLLSLIRQMYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSI 205
            + F L  I  MY++  SG   +PV +L +F+    IA QG  QL + G  + S+++++ 
Sbjct: 142 LRHFKLGSI--MYHINESGFKALPVALLTAFIVSYAIALQGVLQLEKMGVPLMSVEIVAK 199

Query: 206 LQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALII 265
           L LRE+G  + A++IAGRS S+  A+IG M + EE DA++TM L     +I PRI AL+I
Sbjct: 200 LSLREMGPFILAIVIAGRSSSSFAAQIGVMNLTEENDALKTMNLSLFDYIILPRILALVI 259

Query: 266 SLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIG 325
            +PLL  LA+  ++    + I     + F  +  RF+    + N + G+IKAPF   A+ 
Sbjct: 260 IMPLLVFLADAVSLFACFLAINMQTGLDFMQYLERFYEYVGINNFWVGVIKAPFFGAAVA 319

Query: 326 IVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           +V    G  V   + S+G + T  VV +I  VI+I+++F+I
Sbjct: 320 LVGCFRGLYVKGDTESVGIETTKSVVNAIFWVILINAIFSI 360


>gi|328954405|ref|YP_004371739.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454729|gb|AEB10558.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 418

 Score =  144 bits (364), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 177/340 (52%), Gaps = 23/340 (6%)

Query: 36  QSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK---IKLQGVSTHIEQLFSLI---SFTH 89
           Q  S  +DL  +  +D+ GA  ++   EK   +     L  +S  I+++  LI   + TH
Sbjct: 88  QLSSVGLDLGGLEYLDSAGALAVLQLAEKLKSQGIICTLDNISPKIKKILDLIDIQALTH 147

Query: 90  RKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKF 149
              I   K    F + S       +G+  + F  D        G ++ +    C    + 
Sbjct: 148 PPLITVGK---RFGWIS------QVGEASLAFWRDIIEVIAFFGELLLDLASVCLRPRRV 198

Query: 150 KGFLLSLIRQMYYV---GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSIL 206
           +   +     M+Y+   GV G+P+V LI  + G +IA   + QL QFGA I+   L+ + 
Sbjct: 199 RWEYV-----MFYMKRAGVDGLPIVSLIGLLLGLIIAFMSSLQLQQFGANIYVASLLGVA 253

Query: 207 QLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
            +RE+G ++TA+++AGRSGSA  AEIGSMK++EE+DA+  MG + +R+L +P++ A ++ 
Sbjct: 254 MVRELGPIMTAILVAGRSGSAFAAEIGSMKVSEEVDALTVMGFNPMRMLTTPKVIASLVV 313

Query: 267 LPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
           +PLLTI A+   IIG  IV     D+    +        TL +  +  IK+   A  I  
Sbjct: 314 VPLLTIYADLLGIIGGLIVGVTMLDLTVYSYIQETRRILTLFDFTSSFIKSVVFAFLIAA 373

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           +  + GF V   ++++G   T+ VV +I ++I++DS+FAI
Sbjct: 374 IGCQRGFQVRGGASAVGSATTSAVVAAIFLIIVVDSIFAI 413


>gi|317153918|ref|YP_004121966.1| hypothetical protein Daes_2214 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944169|gb|ADU63220.1| protein of unknown function DUF140 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 431

 Score =  144 bits (363), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 106/376 (28%), Positives = 184/376 (48%), Gaps = 37/376 (9%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMYFME---K 64
           F   G   +P  + + D+       S  S  A+  D S I  +D  G  L++   E   +
Sbjct: 75  FEIRGRLDAPGTAHVWDEASRV--ASAGSGGAVEADCSGIEYMDGSGMALLLKLREVVAE 132

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK-------- 116
             G + L  ++    QL   I  T  + +    P  S      + L   +G+        
Sbjct: 133 AGGTLSLVNLAPRHRQL---IDLTGDRPLPGWNPADS----ERRGLAERVGRATRDALTG 185

Query: 117 --KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
             ++V+F+ ++         VI        S  ++K  LLS +    +VGV  + ++ L+
Sbjct: 186 IREMVEFVGEAS--------VIITRSLLHPSRVRWKDVLLSCV----HVGVDSLFIISLL 233

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
            F+ G +++ Q A  L +FG EIF  +++ ++  RE+G L+TA+++A RSGSA  AEIG+
Sbjct: 234 GFLMGLIMSFQSAISLQRFGGEIFVPNMLGLVMFREMGPLVTAILLAARSGSAFAAEIGT 293

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           MKINEE+DA+ TMGL  +R L+ P++ + +  +PL+T+  N ++++G ++V+      P 
Sbjct: 294 MKINEELDALTTMGLSPMRFLVVPKLLSALAMVPLMTLFFNLASLVGGALVMLS-LGFPL 352

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F SR  S    ++ F G+ KA   +  +  V    G      ++++G   T+ VV  I
Sbjct: 353 VTFTSRVFSYVHYSDFFGGMAKALVFSILVAGVGCLRGMQTRSGASAVGLSTTSAVVTGI 412

Query: 355 SIVIIIDSLFAI-FYF 369
             +   D LFA+ FY+
Sbjct: 413 IFIAFADGLFAVAFYY 428


>gi|120609009|ref|YP_968687.1| hypothetical protein Aave_0306 [Acidovorax citrulli AAC00-1]
 gi|120587473|gb|ABM30913.1| protein of unknown function DUF140 [Acidovorax citrulli AAC00-1]
          Length = 375

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 172/332 (51%), Gaps = 12/332 (3%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           DL ++  +D +GA+L+  ++   +  +I L       + L  +  FT    + ++ P   
Sbjct: 55  DLRSVDWLDHVGAQLLWNHWGRVWPERIALD--DAQRDMLDRVAEFT----VIDRPPVPP 108

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
           +      +    +G K++  +        ++G ++ + G    +  +     +S    +Y
Sbjct: 109 WRLVEEVD---RLGVKVLHALGHGRHLLELVGQLVIDLGSALRAPRRAPWRDVS--GHLY 163

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
            +G + +P+  ++ F+ G V+A   + QL QFGAE F ++++ I  +RE+G +L A+++A
Sbjct: 164 RMGATALPITAIVGFLIGVVLAYLMSLQLRQFGAESFIVNILGISLIRELGPMLAAILVA 223

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL I++PL+ +     A+ G
Sbjct: 224 GRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRAVALAIAMPLIAVWTTLCALAG 283

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
             +      D+  A F     +    +N+   + K+      I ++    G  V  ++ S
Sbjct: 284 GMLAADIAMDVSPAYFVQALPNAVGFSNLVLAMAKSVVFGVGIALIGCHWGLRVKPNTQS 343

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           LG+  T  VV +I++VII+D+LFAI +  +GI
Sbjct: 344 LGEGTTASVVNAITMVIIVDALFAIAFKNLGI 375


>gi|171322064|ref|ZP_02910936.1| protein of unknown function DUF140 [Burkholderia ambifaria MEX-5]
 gi|171092626|gb|EDT37930.1| protein of unknown function DUF140 [Burkholderia ambifaria MEX-5]
          Length = 427

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 104/374 (27%), Positives = 178/374 (47%), Gaps = 31/374 (8%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   +        +  DLS I  +D +G + +     +  G+ 
Sbjct: 74  RLYGQWTALALARNRGAVARRVAGIATGRVSEWDLSGIERLDHVGGQALW----RVWGRK 129

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHY-------HIGKKIVKF- 121
              GV+    Q  ++     R   + + P+R   +       +       H+   I  F 
Sbjct: 130 LPDGVALSPTQR-TIFERIERLDSQREAPERVVHFGPITRFGFMLFAFAEHLQGGIAMFG 188

Query: 122 --INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             I D+ S      L   NT  +  +S             +Y  G   +P+  L++F+ G
Sbjct: 189 LVILDALSV-----LRRPNTMPWKETSAN-----------IYSAGAQALPITALVAFLIG 232

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ E
Sbjct: 233 IVLSYLSAQQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTE 292

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I    F  
Sbjct: 293 ELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDINYFVR 352

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                  +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+
Sbjct: 353 SLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVIL 412

Query: 360 IDSLFAIFYFAIGI 373
            D++FAI +  +G+
Sbjct: 413 ADAVFAILFQNVGL 426


>gi|32266623|ref|NP_860655.1| hypothetical protein HH1124 [Helicobacter hepaticus ATCC 51449]
 gi|32262674|gb|AAP77721.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 348

 Score =  144 bits (362), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/297 (31%), Positives = 154/297 (51%), Gaps = 8/297 (2%)

Query: 73  GVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHY---HIGKKIVKFINDSCSQA 129
           G +T   ++F  +S +  K+ +      +F   S K  H     +GK+I +F     +  
Sbjct: 50  GTNTRTNEIFQTLSSSLPKENEENAINNAF---SLKISHMVLIPLGKRIEQFFESFLNFL 106

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
           +  G+ +        S  +FK    S+   M   G   +PV +L +F+    IA QG  Q
Sbjct: 107 NFCGMCLWYFFLSLLSPRRFKCG--SIFYHMNEAGFKALPVALLTAFIVSYAIALQGVLQ 164

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L + G  + S+++++ L LRE+G  + A++IAGRS SA  A++G M + EE DA++TM L
Sbjct: 165 LEKMGVPLMSVEIVAKLSLRELGPFILAIVIAGRSSSAFSAQLGVMNLTEENDALKTMNL 224

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                LI PR+ ALII +PLL  LA+  ++  A + +     I F  +  RF+    + +
Sbjct: 225 SLFDYLILPRVLALIIVMPLLVFLADSVSLFAAMLAVKMQTGINFMQYLERFYEYVGINH 284

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
              G+IKAPF   AI +V    G  V   + S+G + T  VV ++  VI+I+++F++
Sbjct: 285 FLVGMIKAPFFGAAIALVGCFRGLYVKGDTESIGLETTKSVVNALFWVILINAIFSV 341


>gi|326315184|ref|YP_004232856.1| hypothetical protein Acav_0366 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372020|gb|ADX44289.1| protein of unknown function DUF140 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 375

 Score =  143 bits (361), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 93/337 (27%), Positives = 171/337 (50%), Gaps = 22/337 (6%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           DL  +  +D +GA+L+  ++  ++  ++ + G    + +  +  + T R     + P R 
Sbjct: 55  DLRGVEWLDHVGAQLLWNHWGREWPERLSVDGAQRDMLERVAEYTVTRRPP---ESPWR- 110

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKF-----KGFLLSL 156
                   L   + +  VK ++      H+L LV    G+      +      +     +
Sbjct: 111 --------LAEEVDRLGVKVLSALGHGRHLLELV----GQLMIDLVRVVRAPRRAPWRDI 158

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
              +Y +G + +P+  ++ F+ G V+A   + QL QFGAE F ++++ I  +RE+G +L 
Sbjct: 159 SGHLYRMGATALPITAIVGFLIGVVLAYLMSLQLRQFGAESFIVNILGISLIRELGPMLA 218

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+++AGRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL I++PL+ +    
Sbjct: 219 AILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRAVALAIAMPLIAVWTTL 278

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            A+ G  +      ++  A F     +    +N+   + K+      I ++    G  V 
Sbjct: 279 CALAGGMLAADIAMNVSPAYFVQALPNAVGFSNLVLAMGKSVVFGVGIALIGCHWGLRVK 338

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            ++ SLG+  T  VV +I++VII+D+LFAI +  +GI
Sbjct: 339 PNTQSLGEGTTASVVNAITMVIIVDALFAIAFKNLGI 375


>gi|254496222|ref|ZP_05109116.1| ABC transporter, permease [Legionella drancourtii LLAP12]
 gi|254354527|gb|EET13168.1| ABC transporter, permease [Legionella drancourtii LLAP12]
          Length = 375

 Score =  143 bits (360), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 108/370 (29%), Positives = 183/370 (49%), Gaps = 26/370 (7%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEKY 65
           F   G W   ++  +   +  +     Q     V+   I+ +D+ GA  ++     +++ 
Sbjct: 17  FNCTGRWSVMDVGSLLKKITASTLPKTQKIK--VNGEGISHLDSAGALALIKCVNALKQR 74

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             ++ L G S   +QL  LI    +  +  Q P         +N  Y +GK+        
Sbjct: 75  DNEVALVGFSKIQQQLLDLIQ-EKQGILDYQIPSPPK-----ENFLYKLGKE------SE 122

Query: 126 CSQAHILGLVISNTGEFCASSY----KFKGFLL-SLIRQMYYVGVSGVPVVILISFVTGA 180
              A + GL+I   G+     +     ++ F   S++  +   G+  +P++ L+SF+ G 
Sbjct: 123 TKLAQVDGLIIL-IGDLATKLFDAFGNWRRFQWPSIMSNIDATGIKALPILALLSFLIGV 181

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q   QL+ +GA  F   L  +   RE   L+TA+++AGR+ SA  A++GSMK+NEE
Sbjct: 182 VLAYQMGLQLTTYGANSFIAYLSGMAIFREFAPLITAIIVAGRTSSAYTAQLGSMKVNEE 241

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ TMGL    +L+ P++  L+I+ PLL   A+  +I+G+ I+      I F  F  R
Sbjct: 242 IDALLTMGLSPTELLVLPKVLGLLIAFPLLIFWADIFSILGSMIMANNMLGIGFLDFLQR 301

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV--GVHSNSLGKKVTTCVVQSISIVI 358
              +  ++    GL KAP  A  I +V   +GF V  G   N +G + T  VVQS+ ++I
Sbjct: 302 LRDSVGISQFKLGLYKAPAFALLIALVGCFQGFRVEAGTEKN-IGSQTTKSVVQSLFLII 360

Query: 359 IIDSLFAIFY 368
           I D++++I Y
Sbjct: 361 IADAIYSIIY 370


>gi|315927603|gb|EFV06934.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           DFVF1099]
          Length = 194

 Score =  142 bits (359), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 81/193 (41%), Positives = 117/193 (60%)

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +E
Sbjct: 2   VLAYQAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDE 61

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           I A+ TMG      ++ PR+ AL++++PL+  +++  +IIG  +V     DI FA F  R
Sbjct: 62  IAAMNTMGFRSFEFIVIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRR 121

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           F     + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  
Sbjct: 122 FREAVDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAF 181

Query: 361 DSLFAIFYFAIGI 373
           D+LF++   + GI
Sbjct: 182 DALFSVILTSTGI 194


>gi|225165545|ref|ZP_03727365.1| protein of unknown function DUF140 [Opitutaceae bacterium TAV2]
 gi|224800218|gb|EEG18628.1| protein of unknown function DUF140 [Opitutaceae bacterium TAV2]
          Length = 371

 Score =  142 bits (359), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 85/263 (32%), Positives = 143/263 (54%), Gaps = 2/263 (0%)

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
           Q    ++   NL   IG+  ++ ++ +      LG  + +         KF+    S   
Sbjct: 111 QAEPAHDRRTNLLTSIGEATIETVDRATGIMSFLGECLLSFFHLARRPRKFRWGDCS--E 168

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           +M   G   +P+V LISF+ G ++A Q A  + QFGA+I+  D ++++  RE+G ++T +
Sbjct: 169 EMQQCGAMALPIVGLISFLVGVIMAYQSAVLMRQFGADIYVADAVALVMAREMGAMMTGI 228

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGR+G+A  A IG+MK NEEIDA+ T G+  V  L+ PR+ AL + +PLLT+ AN   
Sbjct: 229 ILAGRTGAAFAATIGNMKANEEIDALSTFGIRPVDFLVLPRLVALALMMPLLTLYANALG 288

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I+G   V     DIP   ++++  +   L++I TGLIKA      +G+     G      
Sbjct: 289 IVGGMGVAMGVLDIPPITYWNQTVNALDLSDISTGLIKASCFGILVGLSGCHRGMNADRS 348

Query: 339 SNSLGKKVTTCVVQSISIVIIID 361
           ++ +G+  T+ VV  + ++II D
Sbjct: 349 ASGVGRAATSAVVIGMLLIIIAD 371


>gi|308272474|emb|CBX29078.1| hypothetical protein N47_J00590 [uncultured Desulfobacterium sp.]
          Length = 381

 Score =  142 bits (358), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 126/210 (60%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I  M   GV+ +P++ LISF+ G VIA   + QL QFGA ++   L+SI  + E+G ++T
Sbjct: 166 ILHMEKTGVNALPIIALISFLLGLVIAFMSSLQLEQFGANLYVASLVSIGMVSELGPIMT 225

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++IAGRSGSA  AEIG+MKI+EE DA+  MG D    L  PRI A II +PLLT+ A+ 
Sbjct: 226 AIVIAGRSGSAFAAEIGTMKISEETDALFVMGFDPTLFLAVPRILASIIVVPLLTLFADI 285

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            AI G  +V     D+  + + ++  +   L  I  G+ K+   A  I  V    GF   
Sbjct: 286 FAIAGGLVVGVFILDLTTSSYLTQTMNVLNLFEICWGISKSIVFAVIISWVGCLRGFQTK 345

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
             ++++G   T+ VV SI ++I+IDS+FAI
Sbjct: 346 GGADAVGNAATSAVVSSIFLIILIDSMFAI 375


>gi|217970678|ref|YP_002355912.1| hypothetical protein Tmz1t_2277 [Thauera sp. MZ1T]
 gi|217508005|gb|ACK55016.1| protein of unknown function DUF140 [Thauera sp. MZ1T]
          Length = 371

 Score =  142 bits (358), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 100/365 (27%), Positives = 180/365 (49%), Gaps = 14/365 (3%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R AG+W    + E    +  A+  ++  D A   L A+  +D+ GA   +   + + G+ 
Sbjct: 18  RLAGDWTLRGLDECLPTLRRAL-ATVPPD-ARWSLRAVRRMDSFGA---LLLWQAWGGRW 72

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKN-QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +   ++  ++I        +   +P R+   ++   L    GK +  F       
Sbjct: 73  PAALEADDAQR--AIIGRIENASARALPEPPRASALDAVALL----GKGLFAFAGHLSGF 126

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG ++ + G        +   LL +   ++ VGV  +PV  L+ F+ G V++   A 
Sbjct: 127 VALLGRLVLDLGHLLHHPRDWP--LLEISANLHKVGVKAMPVSALVGFLIGVVLSYLSAL 184

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL  FGA+ F ++++ +  +RE+G +L +V++AGRSGSA+ A++G M++ EEIDA+  MG
Sbjct: 185 QLRTFGADAFIVNILGMGIIRELGPVLVSVLVAGRSGSAMTAQLGVMRVTEEIDALAAMG 244

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +     L+ P++ AL +++PLL +  +  A+ G  +  W    I    F         +A
Sbjct: 245 VSRSLRLVLPKVVALSLAMPLLVLWTSAIALFGGWVSAWVELGIGLQFFLRALPDAVPVA 304

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N++ GL K       I +VA   G  V   + SL    T  VV +I++VI++D++FAI  
Sbjct: 305 NLYIGLAKGAVFGFLIALVACHFGLRVKPDTESLSANTTASVVAAITVVILVDAVFAIAT 364

Query: 369 FAIGI 373
            +IG+
Sbjct: 365 RSIGL 369


>gi|218780630|ref|YP_002431948.1| hypothetical protein Dalk_2788 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762014|gb|ACL04480.1| protein of unknown function DUF140 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 377

 Score =  142 bits (358), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 104/367 (28%), Positives = 183/367 (49%), Gaps = 22/367 (5%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
           ++ R  G         +A  +  AI K    +  ++DL  +T +D  GA L+ +  +  H
Sbjct: 18  SILRLHGPLDQDAYFALAGPLRQAIKKGCAGE-LVIDLKDVTRLDDFGALLLAHVHKAAH 76

Query: 67  G---KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                  ++     + ++  L+ F  ++ I     ++    N F  L   I  K++    
Sbjct: 77  AVNSPCSIEAARPSVREVLDLLHF--QRLINAPALEKPKHENPFVALGGAIIDKVLGAKE 134

Query: 124 DSCSQAHILGLVISNTGE--FCAS---SYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
                      +I  TG+   CA+    + F      ++  M  VGV  VP+V LI+F+ 
Sbjct: 135 -----------LIDFTGDVLLCAAIVVRHPFSMRWDDMLTAMRKVGVDAVPIVGLINFLL 183

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++A   + QL QFGA I+   L++I  +RE+G ++TA+++ GRSGSA  +EIG+MKI+
Sbjct: 184 GFIMAFMTSVQLKQFGANIYVAPLVAIAMVRELGPIMTAIVVTGRSGSAFASEIGAMKIS 243

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+ TMG + V  L+ P++ A +I +P+LT+ A    I+G  +V   + D+  + + 
Sbjct: 244 EEVDALSTMGFNPVVFLVMPKMTAAMIVMPILTVFACLFGILGGLLVGVVFLDLTLSNYL 303

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           S    + ++  +     KA   A  I  +    GF V   S+++G+  T+ VV  I ++I
Sbjct: 304 SETIDSLSMYAVNWCFFKAVVFAFLITWIGCLRGFQVKGGSSAVGEATTSSVVSGIFLII 363

Query: 359 IIDSLFA 365
           + D +FA
Sbjct: 364 LWDCIFA 370


>gi|297569477|ref|YP_003690821.1| protein of unknown function DUF140 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925392|gb|ADH86202.1| protein of unknown function DUF140 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 368

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 125/215 (58%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            MY VGV  +PV  L+ F+ G V++   A QL  FG E++ ID++ +  +RE+G +L A+
Sbjct: 152 NMYKVGVKAMPVAALVGFLIGVVLSYLSAMQLEAFGVEVYLIDILGLGIIRELGPVLVAI 211

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSA+ A++G M++ EEIDA+  MG+     L+ P++ AL + +PLL +  +  A
Sbjct: 212 LVAGRSGSAMTAQLGVMRVTEEIDALAAMGISRTIRLVLPKVLALTLVMPLLVLWTSAVA 271

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++G  +       I FA F  +      +AN++ GL K       I +VA   G  +  +
Sbjct: 272 LLGGMLSANMQLGISFAFFMEKLPQVVPIANLYIGLGKGAVFGLLIALVACHFGLRIRPN 331

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SL    T  VV +I+ VI++D++FA+    +G+
Sbjct: 332 TESLAAHTTASVVTAITTVILVDAVFAVMLRNVGV 366


>gi|195952560|ref|YP_002120850.1| protein of unknown function DUF140 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932172|gb|ACG56872.1| protein of unknown function DUF140 [Hydrogenobaculum sp. Y04AAS1]
          Length = 327

 Score =  141 bits (355), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 111/343 (32%), Positives = 173/343 (50%), Gaps = 27/343 (7%)

Query: 31  INKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR 90
           I+ SI      +D+  I ++DT GA  ++  +EKY  K +L G   HIE +         
Sbjct: 12  IDVSIFIKEHTIDIKDIEKLDTFGAIFVLELLEKYKDK-ELVGKKEHIEFI--------- 61

Query: 91  KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK 150
                QK +    YN+ K        K    IN S +    +G+++ ++ +      +F+
Sbjct: 62  -----QKVKELLKYNNEKT-------KKDSNINLSLTFLEYIGILVYHSFK-NIKDIEFE 108

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
            FL    +++   G+  + ++ ++SF+ G VIA Q A +L  FGA IF ++L+ I   RE
Sbjct: 109 SFL----KEVESSGIGSLFILAVLSFLVGIVIAYQSANELISFGANIFIVNLIGISAFRE 164

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G L+T +++AGR  S   A IG   + EEIDAI  M +    +   PRI  L +  PLL
Sbjct: 165 LGPLITGIILAGRVSSGYTANIGIRNVYEEIDAIEVMSISPYVVFGLPRIITLTLITPLL 224

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
            + ++   ++G +I+     DIPF +FF R         +F GL+KAPF    IG+V   
Sbjct: 225 VLFSSNVMVLGGAIIANTSLDIPFDMFFDRLREVVGFNQVFVGLVKAPFFGAYIGLVGTY 284

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            GF  G     +   V   VV SIS +I+ID+LF+I +  IGI
Sbjct: 285 FGFYSGKKPEDVTLNVMKSVVISISGIIVIDALFSIIFAKIGI 327


>gi|312797432|ref|YP_004030354.1| ABC transporter permease protein [Burkholderia rhizoxinica HKI 454]
 gi|312169207|emb|CBW76210.1| ABC transporter permease protein [Burkholderia rhizoxinica HKI 454]
          Length = 390

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 101/370 (27%), Positives = 184/370 (49%), Gaps = 18/370 (4%)

Query: 10  RFAGNWKSPEIS------EIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           R  G W +  ++       IA  +    + + ++D+ + DLS I  +D +GA+  ++ + 
Sbjct: 32  RLGGQWTALSLALDQRRGGIAAKLRTLRDAAARADT-LWDLSPIQRLDHVGAQ-ALWQIW 89

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
             H    L    T   ++F  I+     + +  +P  +       +    +G  +  F  
Sbjct: 90  GRHLPCGLSLTDTQ-REIFERIALLDATR-EPAEPAAAI------DPITRLGLAVFGFAG 141

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG ++ + G       +     +S    +Y  G   +P+  L++F+ G V++
Sbjct: 142 HLRDGITLLGGLVIDCGRLLRDPRRIPWSEIS--ANVYAAGAQALPITALVAFLIGIVLS 199

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L A+++AGRSGSAI A++G M++ EE+DA
Sbjct: 200 YLSAQQLRLFGANAYIVNILGLSIIRELGPVLAAILVAGRSGSAITAQLGVMRVTEELDA 259

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL I  +  A+ G  +      +I  + F     S
Sbjct: 260 MRVMGISHGLRLILPRVIALGVAMPLLVIWTDAIALAGGMLAAQLVLNIDMSFFIRSLPS 319

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I +V    G  +  +S SLG+  TT VV SI++V++ D++
Sbjct: 320 VVPVANLYLGLGKGVAFGMLIALVGCHFGLRIKPNSQSLGEGTTTSVVSSITVVMLADAV 379

Query: 364 FAIFYFAIGI 373
           FAI +  IG+
Sbjct: 380 FAIMFQRIGL 389


>gi|241661797|ref|YP_002980157.1| hypothetical protein Rpic12D_0175 [Ralstonia pickettii 12D]
 gi|240863824|gb|ACS61485.1| protein of unknown function DUF140 [Ralstonia pickettii 12D]
          Length = 374

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 189/376 (50%), Gaps = 22/376 (5%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVD------LSAITEIDTIGAEL 57
           +G +V   +G+W +  ++E A      +  + Q   A +D      L+ +  ID  GA+L
Sbjct: 15  DGRSVAFLSGDWTTLALAERA-----GVRSARQQIRAGLDNANAWCLTEVGRIDHFGAQL 69

Query: 58  IMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
           +     +  G    + +    +Q   ++    +      K + +   N    L    G+ 
Sbjct: 70  LW----RAWGNQWPEHLDARPDQR-RMLDRVAKLDPGGWKQRLAPRMNPVAIL----GEG 120

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           ++ F + + +   ++G ++ + G F  + ++  G    +   +Y  G   + +  L+ F+
Sbjct: 121 MLDFFDHASNGIAMVGQLVFDLGRFVRAPHR--GPWREISANIYSTGYKALGITALVGFL 178

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++
Sbjct: 179 IGIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRV 238

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F
Sbjct: 239 TEELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYF 298

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +       +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IV
Sbjct: 299 ITSLPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIV 358

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +GI
Sbjct: 359 ILADAVFAILFKDVGI 374


>gi|253828165|ref|ZP_04871050.1| inner membrane protein yrbE [Helicobacter canadensis MIT 98-5491]
 gi|313142364|ref|ZP_07804557.1| ABC transporter [Helicobacter canadensis MIT 98-5491]
 gi|253511571|gb|EES90230.1| inner membrane protein yrbE [Helicobacter canadensis MIT 98-5491]
 gi|313131395|gb|EFR49012.1| ABC transporter [Helicobacter canadensis MIT 98-5491]
          Length = 371

 Score =  140 bits (354), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 187/378 (49%), Gaps = 24/378 (6%)

Query: 3   ENGITVFRFAGNW--KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +N I + + +G W  K P+   +  D +   N  I+     ++L+   ++D  G E++  
Sbjct: 9   DNDIYILKLSGLWDYKIPKSLLLRLDSIKLTNVKIK-----IELAENFDLDFCGGEILER 63

Query: 61  FMEKYHGK-IKLQGV---STHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
           ++     K I L+      +  +Q+F +++ T +  +K    Q       F  LH+   +
Sbjct: 64  WILALESKNIVLENALKNHSKSQQIFQILA-TRKNPLKQDMVQ------DFIKLHWDSFQ 116

Query: 117 KIVKFINDSCSQAHILGLVISN--TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            I  F  DS       G ++    +      + + K  L  +   +    V  + +V L 
Sbjct: 117 IIKGFFKDSLMAIGFFGEILYAWFSSLLQPKNIRLKATLYCIQESL----VKAIGIVALA 172

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
            F+ G VIA QG+ QL QFGA I  +++ S+L LRE+  ++TA++IAGRS SA  AEIG 
Sbjct: 173 CFLIGIVIAYQGSIQLGQFGASILIVEMSSMLTLREMAPIITAIIIAGRSASAFSAEIGM 232

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M+  +EIDA+R MG D +  L+ PR+ AL + LPL+  +A+   ++GA +V      I  
Sbjct: 233 MRATQEIDAMRVMGFDPITFLVLPRMLALCLVLPLVVFIADLFGLLGAMLVCQLQLGIGT 292

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F  RF     + + + G+ KAPF    I  V    GF V   + S+G   T  VV+SI
Sbjct: 293 EQFVERFLQVVDMRHFWVGIAKAPFFGLIISFVGCFHGFIVAKDTRSIGVHTTKSVVESI 352

Query: 355 SIVIIIDSLFAIFYFAIG 372
            +VI  D+L ++ +  +G
Sbjct: 353 FLVIAFDALCSVVFTEMG 370


>gi|224418846|ref|ZP_03656852.1| toluene ABC transporter permease [Helicobacter canadensis MIT
           98-5491]
          Length = 375

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 113/378 (29%), Positives = 187/378 (49%), Gaps = 24/378 (6%)

Query: 3   ENGITVFRFAGNW--KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +N I + + +G W  K P+   +  D +   N  I+     ++L+   ++D  G E++  
Sbjct: 13  DNDIYILKLSGLWDYKIPKSLLLRLDSIKLTNVKIK-----IELAENFDLDFCGGEILER 67

Query: 61  FMEKYHGK-IKLQGV---STHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
           ++     K I L+      +  +Q+F +++ T +  +K    Q       F  LH+   +
Sbjct: 68  WILALESKNIVLENALKNHSKSQQIFQILA-TRKNPLKQDMVQ------DFIKLHWDSFQ 120

Query: 117 KIVKFINDSCSQAHILGLVISN--TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            I  F  DS       G ++    +      + + K  L  +   +    V  + +V L 
Sbjct: 121 IIKGFFKDSLMAIGFFGEILYAWFSSLLQPKNIRLKATLYCIQESL----VKAIGIVALA 176

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
            F+ G VIA QG+ QL QFGA I  +++ S+L LRE+  ++TA++IAGRS SA  AEIG 
Sbjct: 177 CFLIGIVIAYQGSIQLGQFGASILIVEMSSMLTLREMAPIITAIIIAGRSASAFSAEIGM 236

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M+  +EIDA+R MG D +  L+ PR+ AL + LPL+  +A+   ++GA +V      I  
Sbjct: 237 MRATQEIDAMRVMGFDPITFLVLPRMLALCLVLPLVVFIADLFGLLGAMLVCQLQLGIGT 296

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F  RF     + + + G+ KAPF    I  V    GF V   + S+G   T  VV+SI
Sbjct: 297 EQFVERFLQVVDMRHFWVGIAKAPFFGLIISFVGCFHGFIVAKDTRSIGVHTTKSVVESI 356

Query: 355 SIVIIIDSLFAIFYFAIG 372
            +VI  D+L ++ +  +G
Sbjct: 357 FLVIAFDALCSVVFTEMG 374


>gi|187927276|ref|YP_001897763.1| hypothetical protein Rpic_0168 [Ralstonia pickettii 12J]
 gi|309780024|ref|ZP_07674777.1| competence protein ComM [Ralstonia sp. 5_7_47FAA]
 gi|187724166|gb|ACD25331.1| protein of unknown function DUF140 [Ralstonia pickettii 12J]
 gi|308921194|gb|EFP66838.1| competence protein ComM [Ralstonia sp. 5_7_47FAA]
          Length = 374

 Score =  140 bits (353), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 189/376 (50%), Gaps = 22/376 (5%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVD------LSAITEIDTIGAEL 57
           +G +V   +G+W +  ++E A      +  + Q   A +D      L+ +  ID  GA+L
Sbjct: 15  DGRSVAFLSGDWTTLALAERA-----GVRSARQQIRAGLDNANAWCLTEVGRIDHFGAQL 69

Query: 58  IMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
           +     +  G    + +    +Q   ++    +      K + +   N    L    G+ 
Sbjct: 70  LW----RAWGNQWPEHLDARPDQR-RMLDRVAKLDPGGWKQRLAPRMNPVAIL----GEG 120

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           ++ F + + +   ++G ++ + G F  + ++  G    +   +Y  G   + +  L+ F+
Sbjct: 121 MLDFFDHAGNGIAMVGQLVFDLGRFVRAPHR--GPWREISANIYSTGYKALGITALVGFL 178

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++
Sbjct: 179 IGIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRV 238

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F
Sbjct: 239 TEELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYF 298

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +       +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IV
Sbjct: 299 ITSLPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIV 358

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +GI
Sbjct: 359 ILADAVFAILFKDVGI 374


>gi|145589257|ref|YP_001155854.1| hypothetical protein Pnuc_1074 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047663|gb|ABP34290.1| protein of unknown function DUF140 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 393

 Score =  140 bits (352), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 110/379 (29%), Positives = 181/379 (47%), Gaps = 27/379 (7%)

Query: 4   NGI-TVFRFAGNWKSPEISEIADDVVMAINKSIQS--DSAIVDLSAITEIDTIGAELIMY 60
           NG+  V+   G W        A D  +  + ++ S   S   D++ +  +D  G   I+ 
Sbjct: 31  NGVVNVYTLGGVWTQ---VRAAQDAWLHSSSTVNSAAKSLTCDVTKVETLDGAGIAFIIA 87

Query: 61  FMEKYH---GKIKLQGVSTHIEQL---FSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHI 114
             E      G  +L G++   + L   F  IS      +   KPQR F  N        I
Sbjct: 88  LQEAQTVAGGNFELIGLAERYQPLLKEFDPISNLFPAPVA--KPQRGFVTN--------I 137

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLL-SLIRQMYYVGVSGVPVVIL 173
           G      I DS      LG + S   +   S    K       +      G++ +P++ L
Sbjct: 138 GMGTANLIKDSKGLITFLGHLGS---DLVWSVRNLKHVRWGDFVNAAVEAGINALPIIGL 194

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G +++ Q A  + QFGA  F   L ++  +RE+G L+TA+++AGRS +A  AEIG
Sbjct: 195 VAFLIGVILSFQAAIGMKQFGAVSFVGPLAALGIVREMGPLITAILLAGRSSAAFAAEIG 254

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           +M +N E+DA+ + GL  +R L+ PR+ A I+  P+LT+ A+  +I  AS++    Y IP
Sbjct: 255 TMTVNSEVDALVSGGLSPMRFLVVPRVLAGILVAPILTLFADIVSIF-ASMLTMLIYGIP 313

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
           F  F++   S   + ++ +GLIKA      +  V    G   G  + ++G   T  VV S
Sbjct: 314 FINFYNGMLSAVDVEDVTSGLIKATLFGVVVSAVGCLRGMQTGNGAAAVGISATRAVVSS 373

Query: 354 ISIVIIIDSLFAIFYFAIG 372
           I +++I+D +FA   +  G
Sbjct: 374 IVMIVIVDGIFAFISYKTG 392


>gi|323524591|ref|YP_004226744.1| hypothetical protein BC1001_0219 [Burkholderia sp. CCGE1001]
 gi|323381593|gb|ADX53684.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1001]
          Length = 389

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 174 NVYNAGTKALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAI 233

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A
Sbjct: 234 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIA 293

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I  + F         +AN++ GL K       I IV    GF +  +
Sbjct: 294 LTGGALAAKIVLGIDMSYFARALPGVVPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKAN 353

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  T+ VV SI+IVI+ D++FAI +  +G+
Sbjct: 354 SQSLGEGTTSSVVTSITIVILADAVFAILFQNVGL 388


>gi|298530599|ref|ZP_07018001.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509973|gb|EFI33877.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 379

 Score =  139 bits (351), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 97/342 (28%), Positives = 177/342 (51%), Gaps = 27/342 (7%)

Query: 41  IVDLSAITEIDTIGAELIMYF---MEKYHGKIKLQGVSTHIEQLFSLIS-FTHRKKIKNQ 96
           ++D+  +  +D  G  L+++F   M+  +  ++++G+   + ++   I  F  R +   +
Sbjct: 56  VLDVEKVDYMDMSGQALLLHFSRQMQDRNLSVEVRGLRPELREIQEEIDCFDCRPRPMQR 115

Query: 97  KPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCAS---SYKFKGFL 153
           K       ++ + L    G+  V    D+           S  GEF +S   S    G +
Sbjct: 116 K------LSALEEL----GRAAVNLGRDTRQ-------FFSFVGEFVSSFAYSLTHPGTV 158

Query: 154 L--SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
               ++  M  VG   V ++ L+ F+ G +IA Q A  L  FGAEIF   L+ +  +RE+
Sbjct: 159 RWKDVLSHMEAVGGRAVFIIALMGFLIGVIIAFQTAITLRAFGAEIFVAKLLGLSIVREL 218

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
           G L+T++++AGRSGSA  AEIG+MK NEEI+A++TMGL  VR L+ PR+ A ++  PLL 
Sbjct: 219 GPLVTSIILAGRSGSAFAAEIGTMKTNEEINALQTMGLSPVRFLVVPRMLAAMLVTPLLC 278

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
           I     + IG ++V+    D     +  +  ++  + +    ++K    +  +  +    
Sbjct: 279 IFFLLFSFIGGALVMLS-MDFTLTTYIHQLKTSVGMTDFLGSMVKVFVFSILVAWIGCVR 337

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G   G  ++++G+  T+ VV +I ++I+ D +FA+ Y+ +GI
Sbjct: 338 GLQTGSGASAVGRSTTSAVVSAIVLIILADGIFAVVYYMLGI 379


>gi|91776717|ref|YP_546473.1| hypothetical protein Mfla_2365 [Methylobacillus flagellatus KT]
 gi|91710704|gb|ABE50632.1| protein of unknown function DUF140 [Methylobacillus flagellatus KT]
          Length = 373

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 178/365 (48%), Gaps = 17/365 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G W    +     ++  A+      + A  DL+ + ++DT GA ++      + GK++ +
Sbjct: 22  GQWSLRALDNDFAELRRALKPYFSDEKAQWDLTQVEQLDTAGAAVLW---NGWQGKMEGR 78

Query: 73  GVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFF--YNSFKNLHYHIGKKIVKFINDSCSQ 128
            V+   EQ  LF  ++      +  + P+  +      F  L   I   +V F+      
Sbjct: 79  -VTLTDEQVALFDTLASIETTTVAEKPPRFDWLKLVAGFGKLTIFISSHVVDFVKLIGLL 137

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG ++    +F    +            +Y  GV+ +PV  L+ F+ G  ++   A 
Sbjct: 138 VLELGYLLRRPQDFPWREFS---------ANIYKSGVTALPVTALLGFMIGIAMSYLMAT 188

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL  FGA+IF ++++ +  +RE+G +L AV++AGRSGS++ A+IG M++ EEIDA+ TMG
Sbjct: 189 QLRTFGADIFIVNILGLAVIRELGPILMAVLVAGRSGSSMAAQIGVMRVTEEIDALATMG 248

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  +  ++ P++  L +  P L I  +  A++G ++       + F  FF    +     
Sbjct: 249 ISRILRVVLPKVLGLTVIAPFLVIWTSCWALLGGALSANIELGLGFRFFFDYLAAVVQPV 308

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           NI  GLIK       + ++A   G  +  ++ SL +  T+ VV +I+ VI+ID+ FAI  
Sbjct: 309 NITLGLIKGVMFGFIVAVMACHFGLRIKPNTESLSRSTTSSVVTAITCVILIDAAFAIIT 368

Query: 369 FAIGI 373
             IG+
Sbjct: 369 SGIGV 373


>gi|241767246|ref|ZP_04764987.1| protein of unknown function DUF140 [Acidovorax delafieldii 2AN]
 gi|241362094|gb|EER58209.1| protein of unknown function DUF140 [Acidovorax delafieldii 2AN]
          Length = 373

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 188/365 (51%), Gaps = 18/365 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIV---DLSAITEIDTIGAELIM-YFMEKYHGK 68
           G W + E+ + +     A++  ++ ++A     DL  +  +D +GA+L+  ++ + + G+
Sbjct: 23  GRWGAAELGQRSQ--WRALSAQLRDNTAPAGGWDLRGLDWLDHVGAQLLWDHWGQAWPGR 80

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           ++L         L  + +FT        +P R        +   H+G  ++  ++ +   
Sbjct: 81  LEL--TDPQRAMLERVGAFT--APPPPAEPWR------LADQADHLGVLVLHGLDHARHV 130

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             ++G +  +      + ++     +S    +Y +G + +P+  L+ F+ G V+A   + 
Sbjct: 131 VQLIGQLALDLLRLVRAPHRAPWRDMS--GHVYRMGATALPITALVGFLIGVVLAYLMSL 188

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL Q+GAE F ++++ I  +RE+G +L A+++AGRSGS+I A+IG M++ EE+DA+R MG
Sbjct: 189 QLRQYGAESFIVNILGISLIRELGPMLAAILVAGRSGSSITAQIGVMRVTEELDAMRVMG 248

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +     L+ PR  AL +++PL+++    +A+ G  +       I  A F     +   + 
Sbjct: 249 IPHGFRLVMPRTLALALAMPLISVWTTLAALAGGMLAADVSMGISPAYFVEALPAAVKIG 308

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N+     K+      I ++    G  V  ++ SLG+  T  VV SI++VII+D+LFA+ +
Sbjct: 309 NLGLATAKSVVFGALIALIGCHWGLRVKPNTQSLGEGTTASVVTSITMVIIVDALFAVAF 368

Query: 369 FAIGI 373
             IGI
Sbjct: 369 KNIGI 373


>gi|329905881|ref|ZP_08274264.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
 gi|327547452|gb|EGF32273.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
          Length = 372

 Score =  138 bits (348), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 105/378 (27%), Positives = 186/378 (49%), Gaps = 33/378 (8%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIV--------DLSAITEIDTIGAEL 57
           ++V   +G W   ++  +AD  V+      Q D+A+         DL+ IT ID IGA+ 
Sbjct: 16  LSVIVASGAW---QVHALADAGVIG-----QLDAALARLTKPTGWDLTQITAIDHIGAQ- 66

Query: 58  IMYFMEKYHGKIKLQGV--STHIEQLFSLISFTHRKKIKN-QKPQRSFFYNSFKNLHYHI 114
              ++    GK +  G+  S   ++ F  +       +   QKP+       +K L   +
Sbjct: 67  ---WLWNVWGKTRPPGLVLSDRQDEFFQRLEQAGPLTLPEVQKPR-------WKQL-IRL 115

Query: 115 GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
           G +             +LG ++ +   F  +  +  G    +   +Y  G   + +  L+
Sbjct: 116 GARTQSLTGHLIDVVGLLGQLMFDLRRFALNPRR--GPWKEISSNIYRTGYQALGITALV 173

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
             + G V++   A QL  FG +I+ ++++ +  +RE+G LL A+++AGRSGS+I A++G 
Sbjct: 174 GMLIGVVLSYLSAQQLHSFGGDIYLVNILGMSIIRELGPLLAAILVAGRSGSSITAQLGV 233

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M++NEE+DA+  MGL     LI P++ AL I++PLL I  +  A++G  +       +  
Sbjct: 234 MRVNEELDAMLVMGLPHGFRLIMPKVLALAIAMPLLVIWTDAMALLGGMVAANLELGLSP 293

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             F  +      LAN + G+ K       I +VA   GF +  ++ SLG   T+ VV +I
Sbjct: 294 RYFLHKLPDAVPLANYWIGIGKGVVFGGLIALVACHFGFRIKANTESLGAGTTSSVVTAI 353

Query: 355 SIVIIIDSLFAIFYFAIG 372
           ++VI+ D++FAI +  +G
Sbjct: 354 TVVILADAVFAIVFSGVG 371


>gi|257092687|ref|YP_003166328.1| hypothetical protein CAP2UW1_1065 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045211|gb|ACV34399.1| protein of unknown function DUF140 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 370

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 99/344 (28%), Positives = 173/344 (50%), Gaps = 18/344 (5%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMY-FMEKYHGKIKLQGVSTHIEQLFSLISFTHRK 91
           + + S  A  DL +I  +D+  A ++   +  ++   + L G    +            +
Sbjct: 40  RELASREAAWDLLSIARLDSAAAVVLWRSWGRRWPASLALSGEHRLL--------LERVE 91

Query: 92  KIKNQKPQRSFFYNSFKNLHYHI--GKKIVKFINDSCSQAHILGLVISNTGEFCASSYKF 149
            I    P R       + L + +  G+  +  +++      ++G ++ + G  CA     
Sbjct: 92  AIPADLPARPS-----ERLGWLLVPGRLALAAVDNLAGMVALVGQMVLDVGHLCAHPRDI 146

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
                S    +Y  G   +PV  LI F+ G V++   A QL  FGA++F ++L+ I  +R
Sbjct: 147 PWREFS--ANLYKSGAQALPVTALIGFLIGIVLSYLSALQLKTFGADVFIVNLLGISIVR 204

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G +L AV++AGRSGSA+ A++G M++ EEIDA+ TMG+     L+ P+I AL +++PL
Sbjct: 205 ELGPVLVAVLVAGRSGSAMTAQLGVMRVTEEIDALATMGVSRSLRLVLPKIIALAVAMPL 264

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAM 329
           L +  + + I+G  I      D+ +  F         +AN++ G+ K       IG+VA 
Sbjct: 265 LVVWCSAAGIVGGMIAARLQMDLSYGFFIDTLPRVVPVANLWIGMSKGLVFGMLIGLVAC 324

Query: 330 KEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             G  V  ++ SL  + TT VV SI++ I++D++FAI   + GI
Sbjct: 325 HFGLRVKPNTESLSSQTTTSVVTSITVAILVDAVFAIMTRSFGI 368


>gi|254480123|ref|ZP_05093371.1| conserved domain protein [marine gamma proteobacterium HTCC2148]
 gi|214039685|gb|EEB80344.1| conserved domain protein [marine gamma proteobacterium HTCC2148]
          Length = 376

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/213 (38%), Positives = 127/213 (59%), Gaps = 1/213 (0%)

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G     ++ L S + G ++A  GA QL QFGAE++  DL+ I  LRE+GVL+ A+++
Sbjct: 165 YQAGPDAFAIISLTSVLVGMILAYLGAVQLQQFGAEVYVADLVVIGMLREMGVLMAAIVM 224

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGR+G+A  A++G+M+ NEEIDAIRTMG+  +  L+ PR+ AL++++PLLT+ AN   II
Sbjct: 225 AGRTGAAYAAQLGTMQANEEIDAIRTMGISPMEFLVVPRMLALVVAMPLLTLYANLLGII 284

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  IV       P  ++ S   +   L+++  GLIK+      I +   + G   G  S 
Sbjct: 285 GGGIVSGGLGVTPL-MYISEGETALQLSHLSVGLIKSVVFGVLIAVAGCRSGINSGRSSA 343

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           ++G+  T  VV +I  +I+ D+   I +  +GI
Sbjct: 344 AVGQAATQAVVTAIVYLIVADAAINILFQQVGI 376


>gi|107023833|ref|YP_622160.1| hypothetical protein Bcen_2286 [Burkholderia cenocepacia AU 1054]
 gi|105894022|gb|ABF77187.1| protein of unknown function DUF140 [Burkholderia cenocepacia AU
           1054]
          Length = 425

 Score =  137 bits (346), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 181/380 (47%), Gaps = 65/380 (17%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     V   I        +  DLS I  +D +G + +     +  G+ 
Sbjct: 94  RLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALW----RVWGRK 149

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              GV+    Q  ++     R   + + P+R                 IV+F  D  ++ 
Sbjct: 150 LPAGVALSATQ-RTIFERIERLDSEREAPER-----------------IVRF--DPVTR- 188

Query: 130 HILGLVISNTGEFCASSYKFKGFL----LSLIRQ------------MYYVGVSGVPVVIL 173
             LGL I   GE         G +    LS++R+            +Y  G   +P+  L
Sbjct: 189 --LGLAIFAFGEHLQGGITMFGRVILDALSVLRRPKTMPWKETSANIYSAGAQALPITAL 246

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG
Sbjct: 247 VAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIG 306

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G          +P
Sbjct: 307 VMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALPGV---------VP 357

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
                        +AN++ G+ K       I +VA   GF +  +S SLG+  TT VV S
Sbjct: 358 -------------IANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSS 404

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I++VI+ D++FAI +  +G+
Sbjct: 405 ITVVILADAVFAILFQNVGL 424


>gi|71906845|ref|YP_284432.1| hypothetical protein Daro_1206 [Dechloromonas aromatica RCB]
 gi|71846466|gb|AAZ45962.1| Protein of unknown function DUF140 [Dechloromonas aromatica RCB]
          Length = 368

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 168/333 (50%), Gaps = 16/333 (4%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF 102
           DLSA+T +D+  A L+      + G+      S  ++++   +      ++  + P++  
Sbjct: 47  DLSAVTRLDSAAAVLLW---RTWGGQWP---ASLDVDEMHRAV-LVRVAELPREMPEQVL 99

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFL--LSLIRQM 160
                 +L   IG  + K + +      + G ++ +    CA  ++    +        +
Sbjct: 100 ---PRVHLPEFIGVLLFKALANVRGMVALFGQLLLD----CAYLFRHPKDVPWREFTSNV 152

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G   +PV  L+ F+ G  I+   A QL  FGA++F ++++ I  +RE+G +L AV++
Sbjct: 153 YKAGALALPVTALVGFLIGVTISYLSALQLKSFGADLFIVNILGISIIRELGPVLVAVLV 212

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRSGSA+ A+IG M++ EEIDA+ TMG+     ++ P+++ L +++PLL +  +  A+ 
Sbjct: 213 AGRSGSAMTAQIGVMRVTEEIDALSTMGISRSIRVVLPKVFGLTVAMPLLVLWTSAVALF 272

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  +      D+    F         +AN+F GL K         +VA   G  V  ++ 
Sbjct: 273 GGMLAALMQLDLSLIYFLENLPRAVPVANLFIGLGKGLVFGFVTAVVACHFGLHVKPNTE 332

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           SL    T+ VV +I+ VI++D++FAIF   IG+
Sbjct: 333 SLSANTTSAVVTAITSVILVDAIFAIFTRQIGV 365


>gi|258593363|emb|CBE69702.1| toluene transporter subunit: membrane component of ABC superfamily
           [NC10 bacterium 'Dutch sediment']
          Length = 247

 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 135/228 (59%), Gaps = 4/228 (1%)

Query: 143 CASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDL 202
           CA +  F      LIRQ+ ++GV  + +  + +  TG V+A Q A+ LS+FGA+ +   +
Sbjct: 18  CACTPPFNP--RELIRQVDHIGVKSISIAGVAAAFTGLVLALQTAYGLSRFGAKAYVGII 75

Query: 203 MSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWA 262
           +S+  +RE+G +LTA+++ GR GS I AE+GSMK+ E+IDA+R MG + V+ L+ PR+ +
Sbjct: 76  VSLSMVRELGPVLTALLVGGRVGSGITAELGSMKVTEQIDAMRAMGANPVKKLVVPRVLS 135

Query: 263 LIISLPLLTILANFSAIIGASIVIWKY-YDIPFAVFFSRFHSTATLANIFTGLIKAPFMA 321
            ++ LPLLT++A+   I+G  +VI KY + + +  +++      TLA+I +GL K     
Sbjct: 136 TMLVLPLLTVMADILGILGG-MVISKYEFQVDYHFYYNTVTRNLTLADIVSGLGKTVVFG 194

Query: 322 CAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
             I IV   +G A    +  LGK  T  VV S   VII D     F++
Sbjct: 195 FIIAIVGCYKGLATVGGTEGLGKATTATVVTSAIAVIISDFFLTKFFW 242


>gi|113866165|ref|YP_724654.1| putative uncharacterized transport protein [Ralstonia eutropha H16]
 gi|113524941|emb|CAJ91286.1| putative uncharacterized transport protein [Ralstonia eutropha H16]
          Length = 378

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 165/338 (48%), Gaps = 13/338 (3%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ-GVSTHIEQLFSLISFTHRKKIKN 95
            DSA   L+ +  +D IG +L+    + ++G +  +   S    ++F  I+    +  K 
Sbjct: 53  PDSAQWSLAGVERLDHIGGQLLW---QAWNGALPQRLDASEGQRRVFERIAAVQNEGWKK 109

Query: 96  QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
               R   +N         G  ++ F     S   +LG +  +   F     +  G    
Sbjct: 110 HMVDR---FNPIT----LFGANVLSFGAQLRSGITMLGQLAFDLLRFAGVPQR--GPWRE 160

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +   +Y VG   + +  L+ F+ G V++   A QL  FGA  F ++++ +  +RE+G +L
Sbjct: 161 ISANIYNVGYKALGITALVGFLIGIVLSYLSANQLRTFGASTFIVNILGMAVIRELGPVL 220

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++IAGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL I++PLL    +
Sbjct: 221 AAILIAGRSGSAITAQIGVMRVTEELDAMRVMGISHGFRLIMPRVIALAIAMPLLVAWTD 280

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
             A+ G  +       I    F         +AN++ GL K       I + A   G  +
Sbjct: 281 VMALAGGMLAARMQLGISATFFLRELPDAVPVANLWLGLGKGVVFGILIALTACHFGLRI 340

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             ++ SLG+  T  VV +I+IVI+ D++FA+ +  +G+
Sbjct: 341 KPNTQSLGEGTTASVVTAITIVILADAVFAVLFKDVGL 378


>gi|149907972|ref|ZP_01896640.1| membrane protein, putative [Moritella sp. PE36]
 gi|149808978|gb|EDM68909.1| membrane protein, putative [Moritella sp. PE36]
          Length = 262

 Score =  136 bits (342), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 78/217 (35%), Positives = 128/217 (58%), Gaps = 5/217 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +I Q+Y++G   + V+ +    TG V+  QG + LS+FG+       +++  +RE+G +L
Sbjct: 44  VIEQLYFIGAKSIIVICVTGLFTGMVLGLQGYYTLSKFGSTGLLGSAVALTLIRELGPVL 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+MI GR+GSA+ AEIG M+I+E+IDA++TM +D +R L+SPRI A +IS PLLT + +
Sbjct: 104 TAIMIIGRAGSAMTAEIGIMRISEQIDALKTMTIDPIRFLVSPRIIAALISFPLLTAIFD 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G  +   +   I  A +F R  S+  +A++  G IK+ F +  +  V    G+  
Sbjct: 164 TVGIFGGYLTGSQLLGINPATYFYRVESSVIMADVAGGFIKSIFFSITVITVCCYHGYYT 223

Query: 336 GVHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
            +  ++ G K      TT VVQ+  +V++ID +   F
Sbjct: 224 HIRRDNFGAKGVGLSTTTAVVQASILVLVIDYILTTF 260


>gi|89902676|ref|YP_525147.1| hypothetical protein Rfer_3917 [Rhodoferax ferrireducens T118]
 gi|89347413|gb|ABD71616.1| protein of unknown function DUF140 [Rhodoferax ferrireducens T118]
          Length = 376

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 133/224 (59%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KG    +   ++ +G + +P+  L+ F+ G V+A   + QL QFGA+ F ++++ +  +R
Sbjct: 153 KGPWRDVSGHLFSIGATALPITALLGFLIGVVLAYLMSLQLRQFGADSFIVNILGLSVIR 212

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G +L A++IAGRSGS I A+IG M++ EE+DA+R MG+     L+ PR  A+ +++PL
Sbjct: 213 ELGPVLAAILIAGRSGSTITAQIGVMRVTEELDAMRVMGIAKGYRLVLPRAIAMALAMPL 272

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAM 329
           LT+  + +A++G  +       +  A FF+       ++N+   + K+      I ++  
Sbjct: 273 LTVWTSLAALLGGMLAADLTMGVTPAYFFAALPRAVEVSNLTLAMGKSVVFGLLIALIGC 332

Query: 330 KEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             G  V  ++ SLG+  T  VV SI++VI++D++FA+ +  IGI
Sbjct: 333 HYGLRVKPNTESLGQGTTASVVTSIAMVILVDAVFALVFKDIGI 376


>gi|160895814|ref|YP_001561396.1| hypothetical protein Daci_0365 [Delftia acidovorans SPH-1]
 gi|160361398|gb|ABX33011.1| protein of unknown function DUF140 [Delftia acidovorans SPH-1]
          Length = 376

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 96/364 (26%), Positives = 177/364 (48%), Gaps = 11/364 (3%)

Query: 11  FAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
             G+W + E+   A    + A     + D    +L  +  +D +GA+L+      + G+ 
Sbjct: 23  LTGSWGAAELGRRAQWRKLRAQLADAKGDDLGWNLEGLDWLDHVGAQLLW----NHWGRR 78

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
               ++    Q   L       K     P R        +L    G  ++          
Sbjct: 79  LPARLAASDAQRAMLERVGRFSKEPAPPPPRLNLLERIDSL----GCLVINACGHFAQMT 134

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
            ++G ++ +   F  + ++  G    +   +Y +G + +P+  L+ F+ G V+A   A Q
Sbjct: 135 RLIGQLLIDLLRFARAPHR--GPWRDISGHLYSMGATALPITALVGFLIGVVLAYLMALQ 192

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L QFGAE F ++++ I  +RE+G LL A+++AGR+GSAI A+IG M++ EE+DA++ MG+
Sbjct: 193 LRQFGAESFIVNILGISLIRELGPLLAAILVAGRTGSAITAQIGVMRVTEELDAMQVMGI 252

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                L+ PR  AL I++PL+++    +A+ G  +       +  A F     +   + N
Sbjct: 253 PHGFRLVLPRALALAIAMPLVSLWTTLAALAGGMLAADLTMGVTGAYFAEALPAAVKIGN 312

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           ++  + K+      I ++    G  V  ++ SLGK  T  VV +I++VI++D++FAI + 
Sbjct: 313 LWIAMGKSVVFGALIALIGCHWGLRVEPNTQSLGKGTTASVVTAITMVIVVDAIFAILFK 372

Query: 370 AIGI 373
            +GI
Sbjct: 373 DVGI 376


>gi|83748501|ref|ZP_00945522.1| ABC transporter permease protein [Ralstonia solanacearum UW551]
 gi|207742154|ref|YP_002258546.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum IPO1609]
 gi|83724805|gb|EAP71962.1| ABC transporter permease protein [Ralstonia solanacearum UW551]
 gi|206593542|emb|CAQ60469.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum IPO1609]
          Length = 374

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 105/373 (28%), Positives = 186/373 (49%), Gaps = 16/373 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITE---IDTIGAELIMY 60
           +G +V   +G+W +  ++E A   V +  + I++     +   +TE   ID  GA+L+  
Sbjct: 15  DGRSVAYLSGDWTTLALAERAG--VRSARRQIRAGLDNANAWCLTEVGRIDHFGAQLLW- 71

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +  G    + +    +Q   +I    R      K + +   N    L    G  ++ 
Sbjct: 72  ---RAWGNRWPEHLDARADQ-RRMIDRVARLDPGGWKKRIAPRINPVTVL----GGAMID 123

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F +       ++G ++ +   F  + ++  G    +   +Y  G   + +  L+ F+ G 
Sbjct: 124 FADHLRIGVAMVGQLMFDLLRFVRAPHR--GPWREISANIYSTGYKALGITALVGFLIGI 181

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE
Sbjct: 182 VLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEE 241

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F + 
Sbjct: 242 LDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITS 301

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ 
Sbjct: 302 LPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILA 361

Query: 361 DSLFAIFYFAIGI 373
           D++FAI +  +GI
Sbjct: 362 DAVFAILFKDVGI 374


>gi|188590871|ref|YP_001795471.1| hypothetical protein RALTA_A0076 [Cupriavidus taiwanensis LMG
           19424]
 gi|170937765|emb|CAP62749.1| conserved hypothetical protein, DUF140; putative TRANSMEMBRANE
           PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 376

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 105/380 (27%), Positives = 185/380 (48%), Gaps = 28/380 (7%)

Query: 4   NGITVFRFAGNWKSPEISEI--ADDVVMAINKSIQS-DSAIVDLSAITEIDTIGAELIMY 60
           +G    +  G+W +  ++    A  +   +++  Q+ D A   L+ +  +D IG +L+  
Sbjct: 15  DGTVSVQLRGDWTALALAGCHQARQLRAQLHELAQAPDHAQWSLAGVERLDHIGGQLLW- 73

Query: 61  FMEKYHGKI--KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
             + ++G +  +L+  S    ++F+ I+    +  K     R   +N    L    G  +
Sbjct: 74  --QAWNGALPQRLE-ASEGQRRVFARIAAVQDEGWKKHMVDR---FNPVTLL----GANV 123

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKF-----KGFLLSLIRQMYYVGVSGVPVVIL 173
           + F          LG  I+  G+      +F     +G    +   +Y VG   + +  L
Sbjct: 124 MSF-------GVQLGNGITMLGQLAFDLLRFARMPQRGPWREISANIYNVGYKALGITAL 176

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           + F+ G V++   A QL  FGA  F ++++ +  +RE+G +L A++IAGRSGSAI A+IG
Sbjct: 177 VGFLIGIVLSYLSANQLRTFGASTFIVNILGMAVIRELGPVLAAILIAGRSGSAITAQIG 236

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL I++PLL    +  A+ G  +       I 
Sbjct: 237 VMRVTEELDAMRVMGISHGFRLIMPRVIALAIAMPLLVAWTDVMALAGGMLAARMQLGIS 296

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F         +AN++ GL K       I + A   G  +  ++ SLG+  T  VV +
Sbjct: 297 ATFFLRELPDAVPVANLWLGLGKGVVFGILIALTACHFGLRIKPNTQSLGEGTTASVVTA 356

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I+IVI+ D++FAI +  +G+
Sbjct: 357 ITIVILADAVFAILFKDVGL 376


>gi|242310202|ref|ZP_04809357.1| ABC transporter [Helicobacter pullorum MIT 98-5489]
 gi|239523499|gb|EEQ63365.1| ABC transporter [Helicobacter pullorum MIT 98-5489]
          Length = 365

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 155/292 (53%), Gaps = 15/292 (5%)

Query: 94  KNQKPQRSFFYNSFKNL--HYHIGKKIVKFINDSC----SQAHILGLVISNTGE----FC 143
           +N K Q+ F   S K +  + ++ + I+K  +DS     +    L L +   GE    F 
Sbjct: 75  QNPKSQKIFKILSTKEIPSNTNLTQNIIKIHSDSFIIIKNNIKTLILSLGFLGEILYTFL 134

Query: 144 ASSYKFKGFLLSLIRQMYYVG---VSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSI 200
           AS   FK   + L    Y++    +  V +V L  F+ G VIA QG+ QL QFGA I  +
Sbjct: 135 ASFINFKS--IRLKATFYFIQESLIKAVGIVALACFLIGIVIAYQGSIQLRQFGASILIV 192

Query: 201 DLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRI 260
           ++ S+L LRE+  ++TA++IAGRS SA  AEIG M+  +EIDA+R MG + +  L+ PR+
Sbjct: 193 EMSSMLTLREMAPIITAIIIAGRSASAFSAEIGMMRATQEIDAMRVMGFNPMTFLVVPRM 252

Query: 261 WALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFM 320
            AL   LPL+  +A+   ++G+  V     DI    F  RF     + + + G+ KAPF 
Sbjct: 253 LALCCVLPLVVFIADLFGLVGSMFVCQIQLDISTEQFLERFLQMVDMRHFWVGIAKAPFF 312

Query: 321 ACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
              I  +    GF+V   + S+G   T  VV+SI  VI  D++ ++ +  +G
Sbjct: 313 GLIISFIGCFHGFSVAKDTRSIGVHTTKSVVESIFFVIAFDAICSVIFTEMG 364


>gi|299068161|emb|CBJ39380.1| putative abc-type transport system, permease component abc
           transporter protein (resistance to organic solvents)
           [Ralstonia solanacearum CMR15]
          Length = 374

 Score =  135 bits (339), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 188/377 (49%), Gaps = 24/377 (6%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITE---IDTIGAELIMY 60
           +G +V   +G+W +  ++E A   V +  + I++     +   +TE   ID  GA+L+  
Sbjct: 15  DGRSVAYLSGDWTTLALAERAG--VRSARRQIRTGLNTANAWCLTEVGRIDHFGAQLLWR 72

Query: 61  -FMEKYHGKIKLQGVSTH-IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNL--HYHIGK 116
            +  ++   +  +      I+++  L     +K+I  +    +   N+  +   H  IG 
Sbjct: 73  AWGNRWPELLDARPDQRRMIDRVARLDPGGWKKRIAPRINPVAVLGNAMLDFAEHLRIGV 132

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +V             G ++ +   F  + ++  G    +   +Y  G   + +  L+ F
Sbjct: 133 AMV-------------GQLVFDLLRFVRAPHR--GPWREISANIYSTGYKALGITALVGF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M+
Sbjct: 178 LIGIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMR 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + EE+DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    
Sbjct: 238 VTEELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTY 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F +       +AN++ G+ K       I + A   G  +  ++ SLG+  TT VV SI+I
Sbjct: 298 FITSLPDAVPVANLWLGIGKGVVFGMLIALAACHFGLRIQPNTQSLGEGTTTSVVVSITI 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           VI+ D++FAI +  +GI
Sbjct: 358 VILADAVFAILFKDVGI 374


>gi|197120798|ref|YP_002132749.1| hypothetical protein AnaeK_0378 [Anaeromyxobacter sp. K]
 gi|196170647|gb|ACG71620.1| protein of unknown function DUF140 [Anaeromyxobacter sp. K]
          Length = 370

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/341 (29%), Positives = 165/341 (48%), Gaps = 24/341 (7%)

Query: 41  IVDLSAITEIDTIGAELIMYF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQK 97
           ++D S +  +DT GA L+      +E+    + L     H E L +L++ +     +  +
Sbjct: 46  VIDASGVAAMDTAGAWLLRRAARDLERGGRPVTLTLRPEH-EALLALVTSSGEVAPRRAR 104

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK-GFLLSL 156
            +  F           +G+        + S A  +G V++  GE      + + G L   
Sbjct: 105 ERARFLSE--------LGRS-------AWSSALAIGGVLTLVGELAGRVARARAGPLRVR 149

Query: 157 IRQ----MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
            RQ    +   G   +P   L+SF  G V+A QGA  L  FGA I   DL+ +  LRE+ 
Sbjct: 150 ARQAVLHVQSAGFEALPTTALLSFFVGVVLASQGATLLRPFGAGILIADLVGLAMLRELS 209

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            L+TA+++AGRSGSA  A+IG+MK+  EI+++R  G+  V  L+ PRI AL + +PLLT+
Sbjct: 210 PLVTAIVVAGRSGSAYAAQIGAMKMAGEIESLRAGGVSPVDALVVPRIAALALVVPLLTV 269

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
            A+   + GA++V      +    F  R       ++   G+ KAP     +  V   +G
Sbjct: 270 AADVLGLAGATLVARAELGMHAPEFLGRVAREVHASSYLLGVAKAPVFGVIVAAVGCHQG 329

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
                 + S+G++ T  VVQS+ +V++ D L  +    +GI
Sbjct: 330 LRASDDAGSVGRRTTGAVVQSMFLVVLADGLVLVVSRQLGI 370


>gi|28898136|ref|NP_797741.1| putative ABC transport system permease [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153836560|ref|ZP_01989227.1| ABC-type transport system, permease component [Vibrio
           parahaemolyticus AQ3810]
 gi|260366435|ref|ZP_05778874.1| ABC transporter, permease protein [Vibrio parahaemolyticus K5030]
 gi|260878481|ref|ZP_05890836.1| ABC-type transport system, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260897062|ref|ZP_05905558.1| ABC transporter, permease protein [Vibrio parahaemolyticus
           Peru-466]
 gi|260901858|ref|ZP_05910253.1| ABC transporter, permease protein [Vibrio parahaemolyticus AQ4037]
 gi|28806350|dbj|BAC59625.1| putative ABC transport system permease protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149750158|gb|EDM60903.1| ABC-type transport system, permease component [Vibrio
           parahaemolyticus AQ3810]
 gi|308087695|gb|EFO37390.1| ABC transporter, permease protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308091102|gb|EFO40797.1| ABC-type transport system, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308108149|gb|EFO45689.1| ABC transporter, permease protein [Vibrio parahaemolyticus AQ4037]
 gi|308113110|gb|EFO50650.1| ABC transporter, permease protein [Vibrio parahaemolyticus K5030]
          Length = 357

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 104/356 (29%), Positives = 188/356 (52%), Gaps = 28/356 (7%)

Query: 19  EISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH---GKIKLQGVS 75
           ++ E A+D++    +S      +V+ S +T +D  G   +     ++     +I + G+S
Sbjct: 21  DLWEKANDIL----ESYPDSPIVVNASNLTFVDISGVAFLSDLQTRFRPPGAEISIIGLS 76

Query: 76  THIEQLFSLISFTHRKKIKNQKPQRSFFY---NSFKNLHYHIGKKIVKFINDSCSQAHIL 132
             + +L    +  +  +I   + +  FF    N+ + +  ++G  +V+FI + C     L
Sbjct: 77  ASLAELVPPSNIENAPQIP--RGEDGFFERVGNATREMLVYVGS-VVRFIKE-CVLVFKL 132

Query: 133 GLVISNTGEFCASSYKFKGFLLSLIRQM-YYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           G+             + K    + +  +    G   VP+++LI F+ G +IA +      
Sbjct: 133 GI------------NRRKNVNWTTVSNIATRAGADAVPIILLIGFLMGVIIAFEIGLVAQ 180

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           QFGA +F  D + I   RE+G L+TA++ AGR+G+A  AEIG+ K+NEEI+A+ T G+  
Sbjct: 181 QFGAVLFVADGIGISMFRELGPLMTAIVFAGRTGAAFAAEIGTQKVNEEINALHTFGICP 240

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           V  L+ PRI+A ++ LPLLT+LA+   ++G ++V+ K +DI F  ++ +  +  ++ ++F
Sbjct: 241 VEFLVIPRIYASVLVLPLLTVLADIIGVLGGALVLLK-FDISFVQYYHQLLNALSVWDLF 299

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            GLIKA      I ++  + G A G  S S+G   T+ VV SI  +++ID  F + 
Sbjct: 300 FGLIKATTFGFIIAVIGCERGLATGQGSTSVGLAATSAVVSSIIWIVVIDGFFTVL 355


>gi|254441414|ref|ZP_05054907.1| conserved domain protein [Octadecabacter antarcticus 307]
 gi|198251492|gb|EDY75807.1| conserved domain protein [Octadecabacter antarcticus 307]
          Length = 551

 Score =  134 bits (337), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 70/160 (43%), Positives = 105/160 (65%), Gaps = 2/160 (1%)

Query: 133 GLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQ 192
           GL +S          +F+  L +L+     VG+  VP+V L++F+ G V+A QG+ QL Q
Sbjct: 44  GLFLSRLARSIRHPKEFR--LTALVHHCQEVGLKAVPIVALMAFLIGVVLAFQGSTQLKQ 101

Query: 193 FGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFV 252
           FGAE+F +DL+++  LRE+G+LLT++++AGR+ SA  A IGSMK+ EEIDA+R++GLD  
Sbjct: 102 FGAEVFVVDLIAVYILRELGILLTSIIVAGRTASAFTAAIGSMKMREEIDAMRSLGLDPA 161

Query: 253 RILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDI 292
            IL  PRI AL++ LP+L ++AN   + G  +      DI
Sbjct: 162 TILFVPRILALVLMLPILGLVANVMGLFGDPMAAQVPVDI 201


>gi|300705335|ref|YP_003746938.1| ABC transporter permease [Ralstonia solanacearum CFBP2957]
 gi|299072999|emb|CBJ44356.1| putative abc-type transport system, permease component abc
           transporter protein (resistance to organic solvents)
           [Ralstonia solanacearum CFBP2957]
          Length = 374

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 105/373 (28%), Positives = 184/373 (49%), Gaps = 16/373 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITE---IDTIGAELIMY 60
           +G +V   +G+W +  ++E A   V    + I++     +   +TE   ID  GA+L+  
Sbjct: 15  DGRSVAYLSGDWTTLALAERAG--VRGARRQIRAGLDNANAWCLTEVGRIDHFGAQLLW- 71

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +  G    + +    +Q   +I    R      K   +   N    L    G  ++ 
Sbjct: 72  ---RAWGNRWPEHLDARADQ-RRMIDRVARLDPGGWKKHIAPRINPVTVL----GGAMLD 123

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F +       ++G ++ +   F  + ++  G    +   +Y  G   + +  L+ F+ G 
Sbjct: 124 FADHLQIGVAMVGQLMFDLLRFVRAPHR--GPWREISANIYSTGYKALGITALVGFLIGI 181

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE
Sbjct: 182 VLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEE 241

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F + 
Sbjct: 242 LDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITS 301

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ 
Sbjct: 302 LPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILA 361

Query: 361 DSLFAIFYFAIGI 373
           D++FAI +  +GI
Sbjct: 362 DAVFAILFKDVGI 374


>gi|298530716|ref|ZP_07018118.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510090|gb|EFI33994.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 256

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 124/212 (58%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
           +QM ++GV+ + VV L S  TG V+A Q  +  S FGAE      +++   RE+G ++T 
Sbjct: 45  KQMEFIGVNSLFVVALTSLFTGMVLALQTFYAFSMFGAETLVGATVALSMTRELGPVITG 104

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+ GR+GSAI AEIG+M++ E++DA+  M ++ V+ L+ PRI A +I LPLLTI++N  
Sbjct: 105 LMVTGRAGSAICAEIGTMRVTEQVDALTVMAINPVQYLVLPRIVAGVIMLPLLTIISNTM 164

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            I+G  +V  +  DI   +F ++     T+A+++ GLIKA      + +V   +GF    
Sbjct: 165 GILGGYLVGVQLLDIHGGMFLNKIQEHVTMADVYNGLIKASAFGGILTLVGCYKGFYTRG 224

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
            +  +G+  T  VV S  ++++ D       F
Sbjct: 225 GAEGVGRSTTQAVVMSSVLILVSDYFLTALMF 256


>gi|239907930|ref|YP_002954671.1| putative ABC transporter permease protein [Desulfovibrio magneticus
           RS-1]
 gi|239797796|dbj|BAH76785.1| putative ABC transporter permease protein [Desulfovibrio magneticus
           RS-1]
          Length = 384

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 95/379 (25%), Positives = 179/379 (47%), Gaps = 18/379 (4%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTI---GAEL 57
           ++  G+    F+G+W+  +     + V  A+  S      ++    +T  D++       
Sbjct: 18  VASGGVVTLTFSGSWRMDQTLPDIEAVRQALAASPAPQKLVLAGEGVTGWDSLFLTQCRA 77

Query: 58  IMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIG-- 115
           I+    +    +    +   +E L +L +    ++   +  +R+ F     ++ Y     
Sbjct: 78  IIALARERGVAVDAGALPPGVESLLALAAKVPERQGAARAAKRTPFLERMADMGYGAAQG 137

Query: 116 -KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILI 174
            + ++ F  D    A  L   ++    F  S       L +LI   Y   +  + +V LI
Sbjct: 138 VRNLLDFTGDVTLAAWAL---VTGRAVFQRSQ------LTTLI---YQASIDALGIVSLI 185

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           SF+ G ++A  GA QLSQFGA+I+   ++ I  +R +G ++T +++AGR+G+A  AE+G+
Sbjct: 186 SFLVGLILAFVGAIQLSQFGAQIYVSTIVGIAMVRVMGAIMTGIIMAGRTGAAYAAELGT 245

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M++NEEIDA+RT G    + L+ PR+ AL++ +PLL I A+   I+G  +V      I  
Sbjct: 246 MQVNEEIDALRTFGFSPTQFLVLPRMIALVLMMPLLCIYADLMGIMGGFVVGVFMLKINP 305

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             + +    +  LAN + GL+ +      + +     G   G  +  +G+  T  VV SI
Sbjct: 306 IQYLTHTWQSVPLANFWIGLVHSTVFGVLVAMAGCYRGMRCGRSALGVGQATTAAVVTSI 365

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             ++I  ++  +    IG+
Sbjct: 366 LAIVIATAILTVCCNIIGV 384


>gi|17545032|ref|NP_518434.1| hypothetical protein RSc0313 [Ralstonia solanacearum GMI1000]
 gi|17427322|emb|CAD13841.1| putative abc-type transport system involved in resistance to
           organic solvents, permease component abc transporter
           protein [Ralstonia solanacearum GMI1000]
          Length = 374

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 188/377 (49%), Gaps = 24/377 (6%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITE---IDTIGAELIMY 60
           +G +V   +G+W +  ++E A   V +  + I++     +   +TE   ID  GA+L+  
Sbjct: 15  DGRSVAYLSGDWTTLALAERAG--VRSARRQIRAGLNTANAWCLTEVGRIDHFGAQLLWR 72

Query: 61  -FMEKYHGKIKLQGVSTH-IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNL--HYHIGK 116
            +  ++   +  +      I+++  L     +K+I  +    +   N+  +   H  IG 
Sbjct: 73  AWGNRWPELLDARPDQRRMIDRVARLDPGGWKKRIAPRINPVTVLGNAMLDFARHLRIGV 132

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +V             G ++ +   F  + ++  G    +   +Y  G   + +  L+ F
Sbjct: 133 AMV-------------GQLMFDLLRFVRAPHR--GPWREISANIYSTGYKALGITALVGF 177

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M+
Sbjct: 178 LIGIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMR 237

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + EE+DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    
Sbjct: 238 VTEELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALGGGILAARFQLDISPTY 297

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           F +       +AN++ G+ K       I + A   G  +  ++ SLG+  TT VV SI+I
Sbjct: 298 FITSLPDAVPVANLWLGIGKGVVFGMLIALTACHFGLRIQPNTQSLGEGTTTSVVVSITI 357

Query: 357 VIIIDSLFAIFYFAIGI 373
           VI+ D++FAI +  +GI
Sbjct: 358 VILADAVFAILFKDVGI 374


>gi|300692713|ref|YP_003753708.1| abc-type transport system, permease abc transporter protein
           (resistance to organic solvents) [Ralstonia solanacearum
           PSI07]
 gi|299079773|emb|CBJ52450.1| putative abc-type transport system, permease component abc
           transporter protein (resistance to organic solvents)
           [Ralstonia solanacearum PSI07]
          Length = 374

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 103/375 (27%), Positives = 188/375 (50%), Gaps = 20/375 (5%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITE---IDTIGAELIMY 60
           +G +V   +G+W +  ++E A   V +  + I++     +   +TE   ID  GA+L+  
Sbjct: 15  DGRSVAYLSGDWTTLALAERAG--VRSARRQIRAGLNNANAWCLTEVGRIDHFGAQLLWR 72

Query: 61  -FMEKYHGKIKLQGVSTH-IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            +  ++  ++  +      I+++  L     +K+I  +            N    +G  +
Sbjct: 73  AWGNRWPERLDARPDQRRMIDRVARLDPGGWKKRIAPRI-----------NPVMVLGGAM 121

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
             F         ++G ++ +   F  + ++  G    +   +Y  G   + +  L+ F+ 
Sbjct: 122 FDFAGHLQIGVAMVGQLMFDLLRFVRAPHR--GPWREISANIYSTGYKALGITALVGFLI 179

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ 
Sbjct: 180 GIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVT 239

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F 
Sbjct: 240 EELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFI 299

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +       +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI
Sbjct: 300 TSLPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVI 359

Query: 359 IIDSLFAIFYFAIGI 373
           + D++FAI +  +GI
Sbjct: 360 LADAVFAILFKDVGI 374


>gi|114563133|ref|YP_750646.1| hypothetical protein Sfri_1962 [Shewanella frigidimarina NCIMB 400]
 gi|114334426|gb|ABI71808.1| protein of unknown function DUF140 [Shewanella frigidimarina NCIMB
           400]
          Length = 370

 Score =  133 bits (335), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 125/210 (59%), Gaps = 1/210 (0%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           G  G+ +V LIS + G ++A  G+ QL Q GA+++  +L++I  +RE+G L+T V++AGR
Sbjct: 162 GPKGLAIVTLISLLVGMILAYLGSVQLRQLGAQVYVANLVAIGMVREMGALMTGVIMAGR 221

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           +G+A  A++G+M++NEEIDA+R MG+  +  L+ PR+ ALI  +PL+ I ++   ++G +
Sbjct: 222 TGAAYAAQLGTMQVNEEIDALRVMGIPTMEFLVLPRLLALIFIMPLMCIYSDVIGMLGGA 281

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           +V      + +  +  +        +I TGLIK+      I I   + G   G  SN++G
Sbjct: 282 LVA-NGMGVSYTQYILQTQVAIDWVDISTGLIKSLIFGFLIAIAGCQAGLLCGRDSNAVG 340

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              T  VV++I  +++ D+   I Y  +GI
Sbjct: 341 LATTHAVVKAIVFLVVADAALNILYDKLGI 370


>gi|303247224|ref|ZP_07333498.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
 gi|302491383|gb|EFL51271.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
          Length = 368

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 101/364 (27%), Positives = 176/364 (48%), Gaps = 27/364 (7%)

Query: 1   MSE-NGITVFRFAGNWK----SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDT--I 53
           M+E +G+    F+G W+    SP++S I      A+ KS    +   + + +T+ D+  +
Sbjct: 1   MAESDGVLTLTFSGTWRIDRPSPDLSPIR----AALGKSPAPKTLAFESAKVTDWDSRFL 56

Query: 54  GAELIMYFMEKYHG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHY 112
                +  + K HG    L G+    + L  L      ++   +K   + F     ++ +
Sbjct: 57  TQCRAILALAKAHGVTPDLSGLPAGAKSLLELAEKVPERQGAARKEASTPFLTRVADMAF 116

Query: 113 HIGK---KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVP 169
              +    ++ F+ D       L         F  S+      L +LI   Y  GV  +P
Sbjct: 117 GAWQGVHNLLDFVGDVTLACLALA---GGRAVFQRSN------LFALI---YQAGVEALP 164

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           +V LIS + G ++A  GA QLSQFGA+I+   ++ I  +R +G ++T +++AGR+G+A  
Sbjct: 165 IVSLISLLVGLILAFVGAIQLSQFGAQIYVSTIVGIAMVRVMGAIMTGIIMAGRTGAAYA 224

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           AE+G+M++NEEIDA+RT G    + L+ PR+ AL++ +PLL I A+   I+G  IV    
Sbjct: 225 AELGTMQVNEEIDALRTFGFSPTQFLVLPRMIALVLMMPLLCIYADIMGILGGFIVGVFM 284

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
             I    + +    +  LAN + GL+ +      + +     G   G  + ++G+  T  
Sbjct: 285 LKINPIQYLTHTWQSVPLANFWIGLVHSTVFGVLVAMAGCYRGMRCGRSALAVGQATTAA 344

Query: 350 VVQS 353
           VV S
Sbjct: 345 VVTS 348


>gi|56710306|dbj|BAD81021.1| permease component of ABC-type transport system [uncultured
           bacterium]
          Length = 405

 Score =  132 bits (333), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 97/370 (26%), Positives = 172/370 (46%), Gaps = 31/370 (8%)

Query: 8   VFRFAGNWK----SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY--- 60
           V   +G W+    +P  + +A+  + A   + Q+    VD +A+   D+    L+++   
Sbjct: 43  VVALSGAWQLGRPAPRFAPLAESALSAGTGATQTARVTVDAAALGSWDS---SLLIFLRQ 99

Query: 61  ---FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
              F E +        +   I  L +L      + +  + P           L   +G  
Sbjct: 100 GQEFCEAHKLDFVTDALPDRITSLLALARAVPERAVDAEVPA--------LPLRARVGLA 151

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYV----GVSGVPVVIL 173
            V   + S +    LG V+         +   +G +    R+ + V    G   +P+V L
Sbjct: 152 GVSAWDASMAAVTFLGEVLQR------GALLLRGRVRMRWREFWVVVQSNGSGALPIVTL 205

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           I+ + G +IA  G   L +FGA  ++  L+    LRE+G L+T ++IAGR+G+A  AE+G
Sbjct: 206 IALLVGVIIAFLGVVVLKRFGAGYYASYLVGFGMLREMGALMTGIIIAGRTGAAFAAELG 265

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           SMKI EEIDA+ T+G+  V  L+ PR+  L + +PLL + A+   I+G   V     D+ 
Sbjct: 266 SMKITEEIDALTTLGISPVDHLVLPRVLGLFVMMPLLVVYADLVGIVGGMGVAVAMLDVT 325

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F +   +   L++   G+ K       IG+    +G   G  + ++G+  T+ VV S
Sbjct: 326 PTQFMNGLLTAVVLSDALLGVFKGLIFGAIIGLAGCMKGLQAGSDAGAVGRAATSAVVIS 385

Query: 354 ISIVIIIDSL 363
           I++VI+ +++
Sbjct: 386 ITLVILANAV 395


>gi|317401487|gb|EFV82119.1| integral membrane protein [Achromobacter xylosoxidans C54]
          Length = 377

 Score =  132 bits (332), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 100/368 (27%), Positives = 186/368 (50%), Gaps = 13/368 (3%)

Query: 8   VFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY-FMEKY 65
           V    G+W    ++E  + +   A         A  DL  I+ +DTIGA LI   + EK 
Sbjct: 21  VCHVGGDWSVLALAEPGEVERRRAAMAKATDAGARWDLQGISRLDTIGALLIWQAWGEKL 80

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +++    S   + +F+ ++     K    +P+ ++ +         +G  +++   + 
Sbjct: 81  PERVRW---SAGQQDVFTALATNKGGKQALPRPEPAWGW------LRALGGAVLQAGENG 131

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +   +LG ++ +   F   S   +G    +  Q+Y  G   + +  L+ F+ G V++  
Sbjct: 132 RALLTMLGQLVLDL--FGMLSRPSRGPWREISAQVYRTGAQALGITALVGFLIGVVLSYL 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL   GA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+ 
Sbjct: 190 SAQQLQMIGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAML 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+   + LI PR+ AL +++PLL +  +  AI+G  +       +    F        
Sbjct: 250 VMGISHGQRLILPRVVALAVTMPLLVLWTDAMAILGGMLAAQVQLGVSAQWFLQSLPDAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           +L N + G++K       I ++A   G  +  ++ SLG+  TT VV SI+ VI++D+L+A
Sbjct: 310 SLTNYWIGILKGVTFGILIALIACHFGLRIQPNTESLGRGTTTSVVTSITGVILLDALYA 369

Query: 366 IFYFAIGI 373
           + + ++GI
Sbjct: 370 VIFSSVGI 377


>gi|82703102|ref|YP_412668.1| hypothetical protein Nmul_A1981 [Nitrosospira multiformis ATCC
           25196]
 gi|82411167|gb|ABB75276.1| Protein of unknown function DUF140 [Nitrosospira multiformis ATCC
           25196]
          Length = 378

 Score =  132 bits (332), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   + +  L+ F+ G V++   + QL  FGA +F ++++ I  +RE+G +L A+
Sbjct: 163 NLYRTGAQALGITALVGFLIGVVLSYLSSRQLQIFGAHVFIVNILGISVIRELGPMLAAI 222

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGS++ A++G M++ EE+DA+  MG+     LI P++ AL +++PL+ +  +  A
Sbjct: 223 LVAGRSGSSMTAQLGVMRVTEELDALTVMGIPHSLRLILPKVIALGLAMPLVVLWTSAVA 282

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           +IG   V      + +  F SR      ++N++ GL K      AI +++   G  +  +
Sbjct: 283 LIGGMTVAELQLGLGYKFFLSRLPDAVAVSNLWLGLGKGIVCGMAIALISCHFGLRIKSN 342

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           + SLG+  T  VV SI++VIIID++FA+ +  +G+
Sbjct: 343 TESLGEGTTNSVVTSITVVIIIDAIFAVIFSDVGL 377


>gi|242277489|ref|YP_002989618.1| hypothetical protein Desal_0007 [Desulfovibrio salexigens DSM 2638]
 gi|242120383|gb|ACS78079.1| protein of unknown function DUF140 [Desulfovibrio salexigens DSM
           2638]
          Length = 249

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/214 (36%), Positives = 124/214 (57%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LIR +  VG   +P+V +IS  TG ++A Q A QL + GA  +  +L+ +  +RE+G LL
Sbjct: 33  LIRDLASVGADSIPIVSVISACTGIILALQSAQQLEKVGAISYVANLVGVTIIRELGPLL 92

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+++ GRSG+A  AEI +M+I+EEIDA+  MG++ VR L+ P++ A++I +P LT+ A+
Sbjct: 93  TAIIVTGRSGAAFTAEIATMQISEEIDALEVMGIEPVRFLVVPKMIAMLIMVPCLTVWAD 152

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  I            I    +F+       L ++  GL+KA   A AI ++   +GF  
Sbjct: 153 FVGIFSGGAFSAIALGINEVTYFNNSVEFLKLHDVLAGLVKAGGFAVAITLIGCWQGFLA 212

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              +  +G+K T  VV SI ++I++D  F    F
Sbjct: 213 REGAADVGRKTTNSVVISIFMIILLDLFFTALNF 246


>gi|134297087|ref|YP_001120822.1| hypothetical protein Bcep1808_2996 [Burkholderia vietnamiensis G4]
 gi|134140244|gb|ABO55987.1| protein of unknown function DUF140 [Burkholderia vietnamiensis G4]
          Length = 374

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 110/388 (28%), Positives = 186/388 (47%), Gaps = 44/388 (11%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
            E G TV R  G W +  ++     +   +     +     DLS I  +D +G + +   
Sbjct: 14  GEQGQTV-RLYGQWTALALARNRGAITRRVAGLASARPREWDLSGIERLDHVGGQALW-- 70

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +  G+    GV     Q  ++     R   + + P+R                 +V+F
Sbjct: 71  --RVWGRKLPAGVELSDTQR-TIFERIERLDSQREAPER-----------------VVRF 110

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFL----LSLIRQ------------MYYVGV 165
             D  ++   LGL I   GE         G +    LS++R+            +Y  G 
Sbjct: 111 --DPVTR---LGLAIFTFGEHLQGGIAMFGRVILDALSVLRRPQTMPWKETSANIYSAGA 165

Query: 166 SGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSG 225
             +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSG
Sbjct: 166 QALPITALVAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSG 225

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           SAI A IG M++ EE+DA+R MG+     L+ PR+ AL +++PLL +  N  A+ G ++ 
Sbjct: 226 SAITARIGVMRVTEELDAMRVMGIPHGLRLVLPRVLALGVAMPLLVMWTNIIALTGGALA 285

Query: 286 IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKK 345
                 I F  F         +AN++ G+ K       I +VA   GF +  +S SLG+ 
Sbjct: 286 AKFVLAIDFNYFVRSLPGVVPIANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEG 345

Query: 346 VTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            TT VV SI++VI+ D++FAI +  +G+
Sbjct: 346 TTTSVVTSITVVILADAVFAILFQNVGL 373


>gi|88706598|ref|ZP_01104301.1| conserved hypothetical protein, membrane (DUF140) [Congregibacter
           litoralis KT71]
 gi|88699094|gb|EAQ96210.1| conserved hypothetical protein, membrane (DUF140) [Congregibacter
           litoralis KT71]
          Length = 370

 Score =  131 bits (329), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 99/359 (27%), Positives = 174/359 (48%), Gaps = 20/359 (5%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDT---IGAELIMYFMEKY 65
            + +G+W S E+  +   V +        DS  VD+S +++ D     G   +    +  
Sbjct: 16  LQISGDWTSAELPAL---VPLFTTLLETRDSPAVDVSEVSDWDPRLEAGLLRLQRLAQAK 72

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
              I+  G      QL +L +     +         F     +     IG  ++    DS
Sbjct: 73  ARDIRYLGAPDSQTQLMNLATAVAPYEAPAASATGFFSTKQLRRSLADIGDDLL----DS 128

Query: 126 CSQAHILGLVI--SNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                 +G+ +  + TG    S  + + F+ SL +     G   + ++ L S + G ++A
Sbjct: 129 LEFLGGVGIALWRTLTGR---SGMRRREFVESLAQ----AGPQAIGIITLTSILVGMILA 181

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA QL QFGA +F  DL++I  LRE+G L+TAV++AGR+G+A  A++ +M+ NEEIDA
Sbjct: 182 YLGAAQLQQFGAAVFVADLVAIGMLREMGALMTAVVMAGRTGAAYAAQLSTMQTNEEIDA 241

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           I T+G+D +  L++PR+ AL + +PLL + A+   ++G ++V       P   + S+  +
Sbjct: 242 ISTLGIDPMEFLVAPRVLALFLMMPLLVVYADALGVLGGAVVAGGMGVTPLQ-YISQLSA 300

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
             T  + F G+ K    A  I     + G   G +S ++G+  T  VV ++  +I+ D+
Sbjct: 301 AITPTHFFVGIFKGFVFAALIATAGCRAGMNAGRNSEAVGQATTEAVVTAVVYLIVADA 359


>gi|237749352|ref|ZP_04579832.1| ABC transport system permease [Oxalobacter formigenes OXCC13]
 gi|229380714|gb|EEO30805.1| ABC transport system permease [Oxalobacter formigenes OXCC13]
          Length = 374

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 90/336 (26%), Positives = 174/336 (51%), Gaps = 19/336 (5%)

Query: 41  IVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKP 98
           + DL+ I E+D I A+    F+ +  G+ +   ++   EQ   F+ +    + K+ +   
Sbjct: 53  VWDLTRIRELDYISAQ----FLWESWGEKRPANLALTEEQGRFFARLEQAGQLKLPDTTK 108

Query: 99  QRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR 158
              + +  F+N+ + + +     +        ++G ++ +   F  +  +  G    +  
Sbjct: 109 PFLWPWQRFRNIVHKVSEHFSGMV-------ALVGQLMIDIVNFAKAPRR--GPWTEISA 159

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y+ G   + +  ++ F+ G V++   A QL  FG ++F ++L+ I  LRE+G LL A+
Sbjct: 160 NIYHAGAQALGITAVVGFLIGVVLSYLSAQQLHMFGGDVFLVNLLGISVLRELGPLLAAI 219

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGS++ A++G M++ EE+ A++ MGL     LI P++ AL I +PLL I  +  A
Sbjct: 220 LVAGRSGSSMTAQLGVMRVTEELSAMQVMGLPQGFRLIMPKVIALSIVMPLLVIWTDVIA 279

Query: 279 IIGASIVIWKYYDIPFAV--FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           ++G  +     Y+I  ++  F +       +AN + G+ K       I ++A   G  + 
Sbjct: 280 LLGGMLA--GSYEIGLSMSYFLASLPDAVPIANFWIGVGKGYVFGILIALIACYYGLKIK 337

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            ++ SLG+  T  VV SI++VI+ D++FAI    +G
Sbjct: 338 PNTESLGEGTTRSVVTSITVVILADAIFAIVLQGVG 373


>gi|283853770|ref|ZP_06370995.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
 gi|283570832|gb|EFC18867.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
          Length = 385

 Score =  130 bits (328), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 92/355 (25%), Positives = 168/355 (47%), Gaps = 20/355 (5%)

Query: 4   NGITVFRFAGNWKS----PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDT---IGAE 56
           NGI     +G W+     P ++ + D    A+  S      +   +A+T  D+       
Sbjct: 22  NGILTLTLSGVWRLDRPFPPLAPVKD----ALATSPAPRKLVFAATAVTGWDSRFLADCR 77

Query: 57  LIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
            ++    +   ++++ G+      L  L +    ++   +K   + F  S  +L     +
Sbjct: 78  AVLVLARERGVEVEVSGLPEGAASLLDLAAKVPERQGAARKTSHAAFLESMGDLGLGFAQ 137

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +V  +         LG V             F+    +L+  +Y  GV  +P+V LIS 
Sbjct: 138 GVVNLL-------EFLGEVTLACLALLRGRAVFQRS--NLVTLIYQAGVEALPIVSLISL 188

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G ++A  GA QLSQFGA+I+   ++ I  +R +G ++T +++AGR+G+A  AE+G+M+
Sbjct: 189 LVGLILAFVGAIQLSQFGAQIYVSTIVGIAMVRVMGAIMTGIIMAGRTGAAYAAELGTMQ 248

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           +NEEIDA++T G    + L+ PR+ AL++ LPLL + A+   I+G  IV      I    
Sbjct: 249 VNEEIDALKTFGFSPTQFLVLPRMIALVLMLPLLCVYADLMGILGGFIVGVFMLHINPIQ 308

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVV 351
           + +    +  LAN + GL+ +      + +     G   G  + ++G+  T+ VV
Sbjct: 309 YLTHTWQSVPLANFWIGLVHSTVFGVLVAMAGCYRGMRCGRSALAVGQAATSAVV 363


>gi|83814459|ref|YP_444490.1| ABC transporter, permease [Salinibacter ruber DSM 13855]
 gi|83755853|gb|ABC43966.1| ABC transporter, permease [Salinibacter ruber DSM 13855]
          Length = 371

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 92/361 (25%), Positives = 175/361 (48%), Gaps = 27/361 (7%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIV--DLSAITEIDTIGAELIMYFME-----KY 65
           G+W       + D   + +N +  S  A V  D S + + D+    L+ +  E     + 
Sbjct: 18  GDWTLDR--PLPDARAVMVNAAPSSPVAAVAFDTSGLGDWDS---SLVTFLFEAAEYGRA 72

Query: 66  HG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFF--YNSFKNLHYHIGKKIVKFI 122
           H   +++  + T +E+L +L           +    +       +    Y     +V F+
Sbjct: 73  HDLDVRIDTLPTSLERLVALSQAVPEADTTPEAADTALLARLGHWGLAAYDEAHALVTFL 132

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             +      +G +++  G       +++ F ++L         S +P+V +IS + G ++
Sbjct: 133 GQAVRS---VGAILTGRGRM-----RWRTFGVALQEST----ASALPIVTVISLLVGLIV 180

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L +FGA+ F   L+S   LRE+G L+TA+++ GR+G+A  AE+GSM++NEEID
Sbjct: 181 AFLGAVVLQRFGADYFVSYLVSYGMLRELGALMTAIIMTGRTGAAFAAELGSMQVNEEID 240

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ T G+  +  L++PRI A++++LP+LT+ A+   I+G   V     D+    F +   
Sbjct: 241 ALETFGISPIDFLVTPRILAVVLALPMLTLYADALGIVGGMGVAVTMLDLTTTQFLTGLL 300

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L++   G+ KA      IG+     G   G  ++++G+  T+ VV  I +++  ++
Sbjct: 301 EPVVLSDALVGIFKAVVYGGIIGLAGCMRGLQAGDDASAVGQATTSAVVTGILLIVFANA 360

Query: 363 L 363
           +
Sbjct: 361 I 361


>gi|33599154|ref|NP_886714.1| putative integral membrane protein [Bordetella bronchiseptica RB50]
 gi|33575200|emb|CAE30663.1| putative integral membrane protein [Bordetella bronchiseptica RB50]
          Length = 378

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 169/333 (50%), Gaps = 14/333 (4%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKP-QR 100
           DL  +  +DTIGA L+   + ++   +++    S    ++F  +     + +    P  R
Sbjct: 58  DLRGVERLDTIGAHLLWGAWGQQLPERVRW---SDGQREVFQTLQRNRGEALPAPAPADR 114

Query: 101 SFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQM 160
             +  +  +  +  G+     I        + G ++ + G F       +G    +  Q+
Sbjct: 115 WGWLRAIGDAVFDAGRNGRALII-------MFGQLVLDLGAFL--RRPSRGPWREISAQV 165

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G   + +  L+ F+ G V++   A QL  FGA+ F + L+ +  +RE+G +L A+++
Sbjct: 166 YRTGAQALGITALVGFLIGVVLSYLSAQQLQMFGADRFIVRLLGVSIVRELGPVLAAILV 225

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRSGSAI A+IG M++ +E+DA+  MG+   + LI PR+ AL I++PLL +  +  A++
Sbjct: 226 AGRSGSAITAQIGVMRVTQELDAMLVMGISHGQRLILPRVIALAITMPLLVVWTDAMALL 285

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  +       +    F +      +L N + G+ K       I +VA   G  +  ++ 
Sbjct: 286 GGMLAAQMQLGVSAQWFLTSLPDAISLTNYWIGMFKGVSFGVLIALVACHFGLCIQPNTE 345

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           SLG+  TT VV SI+ VI++D+L+A+ + +IGI
Sbjct: 346 SLGRGTTTSVVTSITGVILVDALYAVIFSSIGI 378


>gi|313672871|ref|YP_004050982.1| hypothetical protein Calni_0908 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939627|gb|ADR18819.1| protein of unknown function DUF140 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 256

 Score =  130 bits (326), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 124/214 (57%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+QM ++G + + V+IL    TG V A Q      +FGAE     ++ +   RE+G +L
Sbjct: 43  LIKQMEFIGANSISVIILTGTFTGMVFAFQSYIGFHKFGAEYMVGTVVGLGMARELGPVL 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           +A+M+A R+GSAI AEIG+MK+ E+IDA+ ++ +D V+ L++PRI A ++ +PLL  +A 
Sbjct: 103 SAIMVAARAGSAITAEIGTMKVTEQIDALHSLAVDPVQYLVTPRILAGLLVMPLLNSIAV 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  ++G   V  K  DI   ++    +    L++++ G+IK+      + +V   +G AV
Sbjct: 163 FCGVLGGYFVGVKILDINRTLYLQYMYQYVDLSDLYNGMIKSVVFGLILTLVGCYKGMAV 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              +  +G+  T  VV S  ++++ D +   F F
Sbjct: 223 SGGAEGVGRATTESVVLSCILILVFDYILTAFMF 256


>gi|325982943|ref|YP_004295345.1| hypothetical protein NAL212_2362 [Nitrosomonas sp. AL212]
 gi|325532462|gb|ADZ27183.1| protein of unknown function DUF140 [Nitrosomonas sp. AL212]
          Length = 370

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 91/345 (26%), Positives = 179/345 (51%), Gaps = 15/345 (4%)

Query: 31  INKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISF--T 88
           +++  ++ +   DL+ I +IDT G  ++++ + K     +LQ    H E++F  +    T
Sbjct: 38  LSREARNQNLYWDLTGIGQIDTAGT-ILLWRVWKTKRPDRLQLRPEH-EKMFQRLERLPT 95

Query: 89  HRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYK 148
           H+  IK+    R   +         +GK ++     S     ++G ++ +          
Sbjct: 96  HQSGIKH----RDLLWPITT-----LGKLVLVLWQHSVGLITLIGQLMLDVIYLIRHPVY 146

Query: 149 FKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL 208
                +S    +Y  G   + +  L+ F+ G V++   + QL  FGA+IF I+++ I  +
Sbjct: 147 IPWREIS--ANLYRTGAQALGITALVGFLIGIVLSYLSSKQLQLFGADIFIINILGISII 204

Query: 209 REIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLP 268
           RE+G +L A+++AGRSGSA+ A++G M++ +E+DA+  MG+   + LI P++  L I++P
Sbjct: 205 RELGPMLAAILVAGRSGSAMTAQLGVMRVTQELDALTVMGISHSQRLILPKVLGLGIAMP 264

Query: 269 LLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVA 328
           LL +  +  A++G  +       + +  F +    +  + N++ GL K       I ++A
Sbjct: 265 LLVMWTSAVALLGGMVAAEIQLGLHYHYFITALPDSVPVGNLWLGLGKGIVCGMVIALIA 324

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              G  +  ++ SLG+  T  VV +I++VIIID++FA+ +  +G+
Sbjct: 325 CHFGLKIKPNTESLGEGTTASVVTAITMVIIIDAIFAVLFSDVGL 369


>gi|281356107|ref|ZP_06242600.1| protein of unknown function DUF140 [Victivallis vadensis ATCC
           BAA-548]
 gi|281317476|gb|EFB01497.1| protein of unknown function DUF140 [Victivallis vadensis ATCC
           BAA-548]
          Length = 263

 Score =  129 bits (325), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 124/222 (55%), Gaps = 3/222 (1%)

Query: 154 LSLIRQMYYVGVSG---VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
           L L   +YY+ + G   +P+V+LI F+ G V+A  G  QLS+FG+EIF +D++    L+E
Sbjct: 41  LRLKETLYYLDLCGAQSLPLVLLICFLMGGVLAINGQIQLSKFGSEIFIVDMVGFSVLKE 100

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
            G L+ A++  G++GSA  +EIG+MK++EEI A+ T+G+     L+ P++ A++I+LPLL
Sbjct: 101 FGPLMVALIATGQAGSAFASEIGTMKVDEEISALETLGIRPAAYLVLPKLIAMLIALPLL 160

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
           T+  +F+ + G   V      +P A +  R            G++K+   A  I +    
Sbjct: 161 TVFGDFAGLTGGLAVGITVAGLPLAAYVERTLDILDSTTFLLGVLKSFVFAVLITLAGCY 220

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
            GF     +  +G+  T  VV SI  V++  +L  + Y  IG
Sbjct: 221 CGFRSSGDAQGVGRAATAAVVISILFVVVATALLTVLYSFIG 262


>gi|294506238|ref|YP_003570296.1| ABC transporter permease [Salinibacter ruber M8]
 gi|294342566|emb|CBH23344.1| ABC transporter, permease [Salinibacter ruber M8]
          Length = 371

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 92/356 (25%), Positives = 172/356 (48%), Gaps = 27/356 (7%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIV--DLSAITEIDTIGAELIMYFME-----KY 65
           G+W       + D   + +N +  S  A V  D S + + D+    L+ +  E     + 
Sbjct: 18  GDWTLDR--PLPDARAVMVNAAPSSPVAAVAFDTSGLGDWDS---SLVTFLFEAAEYGRA 72

Query: 66  HG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFF--YNSFKNLHYHIGKKIVKFI 122
           H   +++  + T +E+L +L           +    +       +    Y     +V F+
Sbjct: 73  HDLDVRIDTLPTSLERLVALSQAVPEADTTPEAEDTALLARLGHWGLAAYDEAHALVTFL 132

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             +      +G +++  G       +++ F ++L         S +P+V +IS + G ++
Sbjct: 133 GQAVRS---VGAILTGRGRM-----RWRTFGVALQEST----ASALPIVTVISLLVGLIV 180

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L +FGA+ F   L+S   LRE+G L+TA+++ GR+G+A  AE+GSM++NEEID
Sbjct: 181 AFLGAVVLQRFGADYFVSYLVSYGMLRELGALMTAIIMTGRTGAAFAAELGSMQVNEEID 240

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ T G+  +  L++PRI A++++LP+LT+ A+   I+G   V     D+    F +   
Sbjct: 241 ALETFGISPIDFLVTPRILAVVLALPMLTLYADALGIVGGMGVAVTMLDLTTTQFLTGLL 300

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               L++   G+ KA      IG+     G   G  ++++G+  T+ VV  I +++
Sbjct: 301 EPVVLSDALVGIFKAVVYGGIIGLAGCMRGLQAGDDASAVGQATTSAVVTGILLIV 356


>gi|33591357|ref|NP_879001.1| putative integral membrane protein [Bordetella pertussis Tohama I]
 gi|33570999|emb|CAE40477.1| putative integral membrane protein [Bordetella pertussis Tohama I]
          Length = 376

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 92/332 (27%), Positives = 168/332 (50%), Gaps = 12/332 (3%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           DL  +  +DTIGA L+   + ++   +++    S    ++F  +     + +    P   
Sbjct: 56  DLRGVERLDTIGAHLLWGAWGQQLPERVRW---SDGQREVFQTLQRNRGEALPAPAPADR 112

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
           + +         IG  +     +  +   + G ++ + G F       +G    +  Q+Y
Sbjct: 113 WGW------LRAIGDAVFDAGRNGRALVIMFGQLVLDLGAFL--RRPSRGPWREISAQVY 164

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
             G   + +  L+ F+ G V++   A QL  FGA+ F + L+ +  +RE+G +L A+++A
Sbjct: 165 RTGAQALGITALVGFLIGVVLSYLSAQQLQMFGADRFIVRLLGVSIVRELGPVLAAILVA 224

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSGSAI A+IG M++ +E+DA+  MG+   + LI PR+ AL I++PLL +  +  A++G
Sbjct: 225 GRSGSAITAQIGVMRVTQELDAMLVMGISHGQRLILPRVIALAITMPLLVVWTDAMALLG 284

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
             +       +    F +      +L N + G+ K       I +VA   G  +  ++ S
Sbjct: 285 GMLAAQMQLGVSAQWFLTSLPDAISLTNYWIGMFKGVSFGILIALVACHFGLCIQPNTES 344

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           LG+  TT VV SI+ VI++D+L+A+ + +IGI
Sbjct: 345 LGRGTTTSVVTSITGVILVDALYAVIFSSIGI 376


>gi|167585308|ref|ZP_02377696.1| hypothetical protein BuboB_08232 [Burkholderia ubonensis Bu]
          Length = 374

 Score =  129 bits (325), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 107/383 (27%), Positives = 186/383 (48%), Gaps = 40/383 (10%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G TV R  G W +  ++     V   +    +      DLS I  ID +G + +     +
Sbjct: 17  GPTV-RLYGQWTALALARNRGAVARRVAGLAKGRVREWDLSGIERIDHVGGQALW----R 71

Query: 65  YHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             G+    G++    Q  +F  I    R++   + P+R    +    L    G+ +  F 
Sbjct: 72  VWGRKLPDGIALSETQRTIFERIERLDRQR---EAPERIERIDPVTRL----GRALFTFA 124

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPV 170
                   + G V+ +               LS++R+            +Y  G   +P+
Sbjct: 125 EHLQGGIAMFGRVMLDA--------------LSVLRRPKTMPWKETSANVYSAGAQALPI 170

Query: 171 VILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVA 230
             L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A
Sbjct: 171 TALVAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITA 230

Query: 231 EIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYY 290
           +IG M++ EE+DA+R MG+     L+ PR+ AL +++PLL +  N  A+ G ++      
Sbjct: 231 QIGVMRVTEELDAMRVMGIPHGLRLVLPRVLALGVAMPLLVMWTNIIALTGGALAAKLAL 290

Query: 291 DIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCV 350
            I F+ F         +AN++ GL K       I +VA   GF +  +S SLG+  TT V
Sbjct: 291 GIDFSFFVRSLPGVVPIANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSV 350

Query: 351 VQSISIVIIIDSLFAIFYFAIGI 373
           V SI++VI+ D++FA+ +  +G+
Sbjct: 351 VTSITVVILADAVFAMLFQNVGL 373


>gi|33594879|ref|NP_882522.1| putative integral membrane protein [Bordetella parapertussis 12822]
 gi|33564955|emb|CAE39902.1| putative integral membrane protein [Bordetella parapertussis]
          Length = 378

 Score =  129 bits (324), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 169/333 (50%), Gaps = 14/333 (4%)

Query: 43  DLSAITEIDTIGAELIM-YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKP-QR 100
           DL  +  +DTIGA L+   + ++   +++    S    ++F  +     + +    P  R
Sbjct: 58  DLRGVERLDTIGAHLLWGAWGQQLPERVRW---SDGQREVFQTLQRNRGEALPAPAPADR 114

Query: 101 SFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQM 160
             +  +  +  +  G+     I        + G ++ + G F       +G    +  Q+
Sbjct: 115 WGWLRAIGDAVFDAGRNGRALII-------MFGQLVLDLGAFL--RRPSRGPWREISAQV 165

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G   + +  L+ F+ G V++   A QL  FGA+ F + L+ +  +RE+G +L A+++
Sbjct: 166 YRTGAQALGITALVGFLIGVVLSYLSAQQLQMFGADRFIVRLLGVSIVRELGPVLAAILV 225

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRSGSAI A+IG M++ +E+DA+  MG+   + LI PR+ AL I++PLL +  +  A++
Sbjct: 226 AGRSGSAITAQIGVMRVTQELDAMLVMGISHGQRLILPRVIALAITMPLLVVWTDAMALL 285

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  +       +    F +      +L N + G+ K       I +VA   G  +  ++ 
Sbjct: 286 GGMLAAQMQLGVSAQWFLTSLPDAISLTNYWIGMFKGVSFGILIALVACHFGLCIQPNTE 345

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           SLG+  TT VV SI+ VI++D+L+A+ + +IGI
Sbjct: 346 SLGRGTTTSVVTSITGVILVDALYAVIFSSIGI 378


>gi|303256383|ref|ZP_07342397.1| ABC transporter, permease protein [Burkholderiales bacterium
           1_1_47]
 gi|331001491|ref|ZP_08325109.1| hypothetical protein HMPREF9439_02780 [Parasutterella
           excrementihominis YIT 11859]
 gi|302859874|gb|EFL82951.1| ABC transporter, permease protein [Burkholderiales bacterium
           1_1_47]
 gi|329568220|gb|EGG50037.1| hypothetical protein HMPREF9439_02780 [Parasutterella
           excrementihominis YIT 11859]
          Length = 354

 Score =  129 bits (324), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 101/339 (29%), Positives = 167/339 (49%), Gaps = 17/339 (5%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFS--LISFTHRKKIK 94
           S   I D S +T  D  G  L +Y +       KL  VS  IE L++  L +F+ +   K
Sbjct: 31  SGQTIFDASDLTFCDESGLTL-LYELRSRPDAFKLINVSASIETLYNTMLKNFSPKPVEK 89

Query: 95  NQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLL 154
                 S       +      + I+   +  C+   +L            S  +F G +L
Sbjct: 90  KSLGVVSSLGKWLYDAASSTKQSIIFLGSACCALTDVL---------LHPSQIRF-GEIL 139

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           S+  +    G   V ++ LI F+ G +IA + A     FGA IF ++ + I   RE+G L
Sbjct: 140 SVSDE---AGSRAVGIICLIGFLMGVIIAFETALVAQIFGAVIFVVNGIGIAMTRELGPL 196

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           +TA++ AGRSGSA  A++G+ K+NEE++A+ T GL  +  L+ PR+ A  + +PLL++ A
Sbjct: 197 MTAILFAGRSGSAFAAQLGTQKVNEELNALTTFGLSPMYFLVVPRLIASSLVVPLLSVFA 256

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I+G  +V+   YDI +  F+ +   + T+ +I  GL+KA      I ++  + G  
Sbjct: 257 TILGILGGGLVM-AMYDITYTQFYVQLLKSVTVTDIVFGLVKAVIFGFVIALIGCQCGMN 315

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            G  + ++G   T  VV+SI  +++ID   A+    +GI
Sbjct: 316 TGAGAAAVGSSTTKSVVKSIIWIVVIDGAAALLTNRLGI 354


>gi|161523583|ref|YP_001578595.1| hypothetical protein Bmul_0403 [Burkholderia multivorans ATCC
           17616]
 gi|189351647|ref|YP_001947275.1| putative ABC transporter permease [Burkholderia multivorans ATCC
           17616]
 gi|160341012|gb|ABX14098.1| protein of unknown function DUF140 [Burkholderia multivorans ATCC
           17616]
 gi|189335669|dbj|BAG44739.1| putative ABC transport system permease protein [Burkholderia
           multivorans ATCC 17616]
          Length = 374

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 105/374 (28%), Positives = 177/374 (47%), Gaps = 31/374 (8%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++     VV           +  DLS I  +D +G + +     +  G+ 
Sbjct: 21  RLTGQWTALALARNRGAVVRRAESVATGSVSEWDLSGIGRLDHVGGQALW----RVWGRK 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNL---------HYHIGKKIV- 119
              G++    Q  ++     R   + + P+R         L         H H G  +  
Sbjct: 77  LPPGIALTATQ-RTIFERIERLDSQREAPERIVRVGPVTRLGLMLFAFAEHLHGGIAMFG 135

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           + I D+ S      L    T  +  +S             +Y  G   +P+  L++F+ G
Sbjct: 136 RVILDALSV-----LRRPQTMPWKETSAN-----------IYSAGAQALPITALVAFLIG 179

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ E
Sbjct: 180 IVLSYLSAQQLQMFGANRYIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTE 239

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I    F  
Sbjct: 240 ELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIVALTGGALAAKMVLGIDVNYFVR 299

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                  +AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+
Sbjct: 300 SLPGVVPIANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVIL 359

Query: 360 IDSLFAIFYFAIGI 373
            D++FAI +  +G+
Sbjct: 360 ADAVFAILFQNVGL 373


>gi|198282934|ref|YP_002219255.1| hypothetical protein Lferr_0798 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665617|ref|YP_002425137.1| ABC transporter, permease protein, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247455|gb|ACH83048.1| protein of unknown function DUF140 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218517830|gb|ACK78416.1| ABC transporter, permease protein, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 378

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 122/211 (57%)

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
            G + +P++ LI F+ G VI+ Q A  L+Q+GA I+ I++  +  LRE G L+TA++++G
Sbjct: 166 TGPNSLPILTLIGFLIGVVISFQSASTLAQYGANIYIINIAGLSILREFGPLITAIILSG 225

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSA  A+IG M + EE+DA+RT G+  +R LI P++  L + +PLL +  +   + GA
Sbjct: 226 RSGSAFTAQIGGMCVTEELDALRTFGIPPIRRLILPKVIGLALVMPLLVLWTDMVGLYGA 285

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
            +V      I    F  +        N++ G++K       I  +A   G  V  ++ SL
Sbjct: 286 MLVAKLELGISNRFFIQQMPVVVPSFNLWLGVVKGALFGILIAWIAGFHGLKVKPNTTSL 345

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            ++ T  VV SI+++I+ID++ A+ +   GI
Sbjct: 346 SRETTNSVVMSITVMILIDAILALVFANTGI 376


>gi|330818440|ref|YP_004362145.1| hypothetical protein bgla_1g35860 [Burkholderia gladioli BSR3]
 gi|327370833|gb|AEA62189.1| hypothetical protein bgla_1g35860 [Burkholderia gladioli BSR3]
          Length = 395

 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 96/331 (29%), Positives = 168/331 (50%), Gaps = 11/331 (3%)

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF 102
           DLSAI  +D +G + +     +  G    +G++    Q  ++     R     ++P+   
Sbjct: 75  DLSAIDRLDHVGGQALW----RVWGHRLPEGLTLTDNQ-RTIFERIQRLDEAREEPEPVI 129

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYY 162
            ++    L    G  +++F         + G VI + G             +S    +Y 
Sbjct: 130 RHDPVTRL----GLALMQFGEHLFGGIAMFGRVILDLGSIARRPKTMPWTEISA--NVYN 183

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
            G   +P+  L++F+ G V++   A QL QFGA  + ++++ +  +RE+G +L A+++AG
Sbjct: 184 AGAKALPITALVAFLIGIVLSYLSAQQLQQFGANRYIVNILGLSVIRELGPVLAAILVAG 243

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSAI A+IG M++ EE+DA+R MG+     ++ PR+ AL +++PLL +  N  A+ G 
Sbjct: 244 RSGSAITAQIGVMRVTEELDAMRVMGIPHGLRIVLPRVLALGVAMPLLVMWTNIVALSGG 303

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
           ++       I    F         +AN++ GL K       I +V    GF +  +S SL
Sbjct: 304 ALAAKLALGIDVNFFIRSLPGVVPIANLWIGLGKGVVFGMLIALVGCHFGFRIKANSQSL 363

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  TT VV SI++VI+ D++FAI +  +G+
Sbjct: 364 GEGTTTSVVTSITVVILADAVFAILFQNVGL 394


>gi|196232812|ref|ZP_03131662.1| protein of unknown function DUF140 [Chthoniobacter flavus Ellin428]
 gi|196223011|gb|EDY17531.1| protein of unknown function DUF140 [Chthoniobacter flavus Ellin428]
          Length = 245

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 125/213 (58%), Gaps = 1/213 (0%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           QM  +GV  +P+  L SF  G  +A Q A QL + GA  F  DL+ +  LRE+G LL AV
Sbjct: 33  QMVLIGVRALPMASLTSFSIGLTLAMQAAGQLRKMGASQFVPDLVILSLLRELGPLLVAV 92

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++ GRSGSA+ AE+G+M+++EEI+A+  M ++ +R LI PR  A++I LP+LTI  ++  
Sbjct: 93  VVIGRSGSAVTAELGTMRVSEEIEALEVMAINPIRFLIVPRFLAMMIMLPVLTIFGSYVG 152

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           ++G   +     D   A +       A   ++++GLIK+   A  I  +A   G  V   
Sbjct: 153 MVGGWSICHFALDYSTASYILHSFERARPWDLYSGLIKSVVFAWIIITIACHMGLRVEGG 212

Query: 339 SNSLGKKVTTCVVQSISIVIIID-SLFAIFYFA 370
           +  +G+  T  VV S+ I++I + +L A+F+FA
Sbjct: 213 AEGVGQATTGSVVWSLLIMLIANATLTALFFFA 245


>gi|221211088|ref|ZP_03584067.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD1]
 gi|221168449|gb|EEE00917.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD1]
          Length = 446

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 180/380 (47%), Gaps = 32/380 (8%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            G TV R  G W +  ++     VV           +  DLS I  +D +G + +     
Sbjct: 88  QGQTV-RLTGQWTALALARNRGAVVRRAESVATGSVSEWDLSGIGRLDHVGGQALW---- 142

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNL---------HYHI 114
           +  G+    G++    Q  ++     R   + + P+R         L         H H 
Sbjct: 143 RVWGRKLPPGIALTATQ-RTIFERIERLDSQREAPERIVRVGPVTRLGLMLFAFAEHLHG 201

Query: 115 GKKIV-KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           G  +  + I D+ S      L    T  +  +S             +Y  G   +P+  L
Sbjct: 202 GIAMFGRVILDALSV-----LRRPQTMPWKETSAN-----------IYSAGAQALPITAL 245

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG
Sbjct: 246 VAFLIGIVLSYLSAQQLQMFGANRYIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIG 305

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I 
Sbjct: 306 VMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIVALTGGALAAKMVLGID 365

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F         +AN++ GL K       I +VA   GF +  +S SLG+  TT VV S
Sbjct: 366 VNYFVRSLPGVVPIANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTS 425

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I++VI+ D++FAI +  +G+
Sbjct: 426 ITVVILADAVFAILFQNVGL 445


>gi|221199880|ref|ZP_03572923.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2M]
 gi|221207452|ref|ZP_03580461.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2]
 gi|221172655|gb|EEE05093.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2]
 gi|221180119|gb|EEE12523.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2M]
          Length = 446

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 108/380 (28%), Positives = 180/380 (47%), Gaps = 32/380 (8%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            G TV R  G W +  ++     VV           +  DLS I  +D +G + +     
Sbjct: 88  QGQTV-RLTGQWTALALARNRGAVVRRAESVATGSVSEWDLSGIGRLDHVGGQALW---- 142

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNL---------HYHI 114
           +  G+    G++    Q  ++     R   + + P+R         L         H H 
Sbjct: 143 RVWGRKLPPGIALTATQ-RTIFERIERLDSQREAPERVVRVGPITRLGLMLFAFAEHLHG 201

Query: 115 GKKIV-KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           G  +  + I D+ S      L    T  +  +S             +Y  G   +P+  L
Sbjct: 202 GIAMFGRVILDALSV-----LRRPQTMPWKETSAN-----------IYSAGAQALPITAL 245

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           ++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG
Sbjct: 246 VAFLIGIVLSYLSAQQLQMFGANRYIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIG 305

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I 
Sbjct: 306 VMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIVALTGGALAAKMVLGID 365

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F         +AN++ GL K       I +VA   GF +  +S SLG+  TT VV S
Sbjct: 366 VNYFVRSLPGVVPIANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTS 425

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I++VI+ D++FAI +  +G+
Sbjct: 426 ITVVILADAVFAILFQNVGL 445


>gi|91792032|ref|YP_561683.1| hypothetical protein Sden_0670 [Shewanella denitrificans OS217]
 gi|91714034|gb|ABE53960.1| protein of unknown function DUF140 [Shewanella denitrificans OS217]
          Length = 369

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 104/368 (28%), Positives = 182/368 (49%), Gaps = 26/368 (7%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY---FMEKYHGKI 69
           G+W+     + AD +  AI    QS S I+D  A+   D+  A  ++    + E+    +
Sbjct: 21  GDWQLGHALD-ADSICAAIPS--QSRSVIIDTQALGLWDSSLAVALLQLSRWCEQAELPL 77

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
            L      ++QL  L +     + ++Q  Q S       NL    G+ +   +       
Sbjct: 78  SLDACPPSLQQLLKLATEVPSNQTQSQA-QLSLKQKLRANLTEQ-GQGVYDSL------- 128

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYY----VGVSGVPVVILISFVTGAVIAQQ 185
               L + N+    A S+  +G   +    + +     G  G+ +V LIS + G ++A  
Sbjct: 129 ----LFLGNS--VLAISHWLRGKAKTRASDIIFFIEQAGPQGLAIVTLISLLVGMILAYL 182

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G+ QL Q GA+++  DL++I  +RE+G L+TAV++AGR+G+A  A++G+M+ NEE+DA+ 
Sbjct: 183 GSVQLRQLGAQVYVADLVAIGMVREMGPLMTAVIMAGRTGAAYAAQLGTMQANEEVDALS 242

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+  +  L+ PR+ AL+  +PL+ I ++   IIG  IV      +    +  +     
Sbjct: 243 VMGISAMEFLVVPRLVALVFIMPLMCIYSDAIGIIGGGIVA-NGMGVSATQYLLQAQVAV 301

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
              +I TGL+K+      I I   + G A G +SN++G   T  VV++I  +++ D+   
Sbjct: 302 DWLDITTGLVKSLIFGILIAIAGCQAGLACGRNSNAVGVATTKAVVKAIVFLVVSDAALN 361

Query: 366 IFYFAIGI 373
           I Y  +GI
Sbjct: 362 ILYDKLGI 369


>gi|187476645|ref|YP_784668.1| membrane protein [Bordetella avium 197N]
 gi|115421231|emb|CAJ47736.1| putative membrane protein [Bordetella avium 197N]
          Length = 377

 Score =  127 bits (320), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 98/333 (29%), Positives = 169/333 (50%), Gaps = 14/333 (4%)

Query: 43  DLSAITEIDTIGAELIMYFM-EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           DL  I  +DTIGA L+     E+   +++L   +    ++F+ ++  +   +    P   
Sbjct: 57  DLRGIQRLDTIGANLLWRLWGERLPERVRL---TDGQREVFNALA-VNPGAVAPAPP--- 109

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILG-LVISNTGEFCASSYKFKGFLLSLIRQM 160
                  +    IG+ I    ++      +LG LV+   G     S   +G    +  Q+
Sbjct: 110 --VTDRLSWVRAIGQAIFDAAHNGIMLLRMLGQLVLDFIGLLLRPS---RGPWREISAQI 164

Query: 161 YYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMI 220
           Y  G   + +  L+ F+ G V++   A QL  FGA+ F + L+ +  +RE+G +L A+++
Sbjct: 165 YRTGAQALGITALVGFLIGVVLSYLSAQQLQMFGADRFIVRLLGVSIVRELGPVLAAILV 224

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           AGRSGSAI A+IG M++ +E+DA+  MG+   + LI PR+ AL I++PLL +  +  A++
Sbjct: 225 AGRSGSAITAQIGVMRVTQELDAMSVMGISQSQRLILPRVVALAITMPLLVLWTDAMALL 284

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN 340
           G  +       I    F     +  T+ N + G++K       I +VA   G  +   + 
Sbjct: 285 GGMLAAQMQLGISAQWFLESLPNAVTITNYWIGMVKGVSFGVLIALVACHFGLRIKPDTE 344

Query: 341 SLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           SLG+  TT VV SI+ VI++D+L+A+    +GI
Sbjct: 345 SLGRGTTTSVVTSITGVILVDALYAVILSGMGI 377


>gi|30248137|ref|NP_840207.1| ABC transporter permease [Nitrosomonas europaea ATCC 19718]
 gi|30180022|emb|CAD84017.1| possible ABC transport permease [Nitrosomonas europaea ATCC 19718]
          Length = 386

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 91/345 (26%), Positives = 179/345 (51%), Gaps = 24/345 (6%)

Query: 36  QSDSAIV--DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKI 93
           QSD++ +  DL+ ++++D  GA      + +  G+ +   +    EQ    +       +
Sbjct: 55  QSDASSLHWDLTDVSQLDYAGA----VMLWRIWGEQRPAHLLLRPEQERMFLRLEKSVSL 110

Query: 94  KNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGE-----FCASSYK 148
             Q P+R  F          +GK++++F++      H+ G+ I+ +G+     F   ++ 
Sbjct: 111 PEQ-PRRILFLPI-----SMLGKQLLRFLD------HLTGM-ITLSGQIVLDLFFLMTHP 157

Query: 149 FKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL 208
            +     +   +Y  G   + +  ++ F+ G V++   + QL  FGA+I+ ++++ +  +
Sbjct: 158 GRIPAREISANLYRTGAQALGITAVVGFLIGIVLSYLTSEQLHMFGADIYIVNILGMSII 217

Query: 209 REIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLP 268
           RE+G +L A+++AGRSGSA+ A++G M++ EE+DA+  MG+     L+ P+I  L I+LP
Sbjct: 218 RELGPMLAAILVAGRSGSAMTAQLGVMRVTEELDALTVMGIPHSMRLVLPKIIGLGIALP 277

Query: 269 LLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVA 328
           L+ +  +  A++G  +       +      +    T  +AN++ GL K       I ++A
Sbjct: 278 LIVLWTSAIALLGGLVAAELQIGLSIHYALTALPDTVPIANLWLGLGKGMVCGMTIALIA 337

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              G  +  ++ SLG+  T  VV SI+ VI+ID++FA+ +  IGI
Sbjct: 338 CHFGLRIKPNTESLGEGTTNSVVTSITAVILIDAIFAVAFSNIGI 382


>gi|293602529|ref|ZP_06684975.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Achromobacter piechaudii ATCC 43553]
 gi|292819291|gb|EFF78326.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Achromobacter piechaudii ATCC 43553]
          Length = 383

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 94/332 (28%), Positives = 174/332 (52%), Gaps = 12/332 (3%)

Query: 43  DLSAITEIDTIGAELIMY-FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRS 101
           DL  I+ +DTIGA LI   + EK   +++    S   + +F+ ++  ++ +++   P+  
Sbjct: 63  DLHGISRLDTIGALLIWQAWGEKLPERVRW---SAGQQDVFNALAM-NKGEVQTAPPKPE 118

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
            F          +G  I++   +  +   +LG ++ + G          G    +  Q+Y
Sbjct: 119 TF-----GWVRGLGGAILQAAENGRALLIMLGQLMLDLGGMLRRPRL--GPWREISAQVY 171

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
             G   + +  L+ F+ G V++   A QL   GA+ F + L+ +  +RE+G +L A+++A
Sbjct: 172 RTGAQALGITALVGFLIGVVLSYLSAQQLQMIGADRFIVRLLGVSIVRELGPVLAAILVA 231

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSGSAI A+IG M++ +E+DA+  MG+   + LI PR+ AL +++PLL +  +  AI+G
Sbjct: 232 GRSGSAITAQIGVMRVTQELDAMLVMGISHGQRLILPRVVALAVTMPLLVLWTDAMAILG 291

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
             +       +    F +      +L N + G+ K       I ++A   G  +  ++ S
Sbjct: 292 GMLAAQMQLGVSAQWFLTSLPDAISLTNYWIGIFKGVTFGILIALIACHFGLRIQPNTES 351

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           LG+  TT VV SI+ VI++D+L+AI + ++G+
Sbjct: 352 LGRGTTTSVVTSITGVILLDALYAIIFSSVGV 383


>gi|116619717|ref|YP_821873.1| hypothetical protein Acid_0582 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116222879|gb|ABJ81588.1| protein of unknown function DUF140 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 265

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 126/218 (57%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            +I QM  +GV  +P+V+L  F +GAV+A Q +  L+Q+G    +  ++S+   RE+G +
Sbjct: 46  DIILQMDTIGVGSLPIVVLTGFFSGAVMALQMSRALAQYGQVGKTGTVVSVTLARELGPV 105

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+M+AGR+ S I +E+GSMK+ E+IDA+R +G D V+ L++PR+ A  + LPLLTI+A
Sbjct: 106 LTALMVAGRNASGIASELGSMKVTEQIDAMRALGTDPVQKLVTPRLIATGVMLPLLTIIA 165

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           +F  + G  I+   + ++P   +++         ++  GL+K    A  I +V    G  
Sbjct: 166 DFVGMFGGFIIAKFFLNLPPRQYWTSVWRALEWNDVTQGLLKPLIFAIVISLVGCFYGLR 225

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               +  +G+  T  VV +  +V ++D L    + + G
Sbjct: 226 TTGGTQGVGRSTTQAVVLATVLVFVLDLLITKIFVSQG 263


>gi|326800463|ref|YP_004318282.1| hypothetical protein Sph21_3067 [Sphingobacterium sp. 21]
 gi|326551227|gb|ADZ79612.1| protein of unknown function DUF140 [Sphingobacterium sp. 21]
          Length = 254

 Score =  127 bits (319), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 119/223 (53%), Gaps = 4/223 (1%)

Query: 141 EFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSI 200
           E     Y+FK     +I Q Y VGV  +P++ L  F+TG V   Q    L  FGA     
Sbjct: 26  ELVMPPYEFK----EIINQCYEVGVKSLPLISLTGFITGIVFTNQSRPSLEDFGATAMLP 81

Query: 201 DLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRI 260
            L++I  +R +  L+TA++ AG+ GS I AE+GSMK+ E+IDA+   G +  + L+  R+
Sbjct: 82  SLIAIAIVRALAPLVTALIAAGKVGSNIGAELGSMKVTEQIDAMEVSGTNPFKFLVVSRV 141

Query: 261 WALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFM 320
            A  I +P+L+    F  ++G+ + ++++  + F  FF +   T T  +IF  +IKA F 
Sbjct: 142 LATTIMIPILSCYTGFVGLMGSFLNVYQHESVSFISFFDQVFETVTFLDIFQAIIKAAFF 201

Query: 321 ACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              IGIV   +G+     +  +GK     VV S+ ++ I + L
Sbjct: 202 GFTIGIVGCYQGYNSSKGTEGVGKAANAAVVASMFLIFIEEQL 244


>gi|167617722|ref|ZP_02386353.1| ABC transporter, permease protein [Burkholderia thailandensis Bt4]
 gi|257140414|ref|ZP_05588676.1| ABC transporter, permease protein [Burkholderia thailandensis E264]
          Length = 374

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 181/376 (48%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R +G W +  ++    +V   I +  +      DLS +  +D +G + +     +  G+ 
Sbjct: 21  RLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALW----RVWGRR 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              G++    Q  ++     R     + P+     +         G+ +  F        
Sbjct: 77  LPAGIALTDNQ-RTVFERIERLDAGREAPEPVVRIDPVT----RFGQGLFTFGEHLYGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            +LG +I +              LLS++R+            +Y  G   +P+  L++F+
Sbjct: 132 ALLGGLIVD--------------LLSVLRRPRTMPWTEISANVYAAGTKALPITALVAFL 177

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 178 IGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 237

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F
Sbjct: 238 TEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFF 297

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 298 VRSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVV 357

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 358 ILADAVFAILFQNVGL 373


>gi|167579644|ref|ZP_02372518.1| ABC transporter, permease protein [Burkholderia thailandensis
           TXDOH]
          Length = 374

 Score =  127 bits (318), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 181/376 (48%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R +G W +  ++    +V   I +  +      DLS +  +D +G + +     +  G+ 
Sbjct: 21  RLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALW----RVWGRR 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              G++    Q  ++     R     + P+     +         G+ +  F        
Sbjct: 77  LPAGIALTDNQ-RTVFERIERLDAGREAPEPVVRIDPVT----RFGQGLFTFGEHLYGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            +LG +I +              LLS++R+            +Y  G   +P+  L++F+
Sbjct: 132 ALLGGLIVD--------------LLSVLRRPRTMPWTEISANVYAAGTKALPITALVAFL 177

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 178 IGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 237

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F
Sbjct: 238 TEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFF 297

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 298 VRSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVV 357

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 358 ILADAVFAILFQNVGL 373


>gi|83720699|ref|YP_440931.1| ABC transporter permease [Burkholderia thailandensis E264]
 gi|83654524|gb|ABC38587.1| ABC transporter, permease protein [Burkholderia thailandensis E264]
          Length = 404

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 102/376 (27%), Positives = 181/376 (48%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R +G W +  ++    +V   I +  +      DLS +  +D +G + +     +  G+ 
Sbjct: 51  RLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALW----RVWGRR 106

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
              G++    Q  ++     R     + P+     +         G+ +  F        
Sbjct: 107 LPAGIALTDNQR-TVFERIERLDAGREAPEPVVRIDPVT----RFGQGLFTFGEHLYGGI 161

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            +LG +I +              LLS++R+            +Y  G   +P+  L++F+
Sbjct: 162 ALLGGLIVD--------------LLSVLRRPRTMPWTEISANVYAAGTKALPITALVAFL 207

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 208 IGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 267

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F
Sbjct: 268 TEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFF 327

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 328 VRSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVV 387

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 388 ILADAVFAILFQNVGL 403


>gi|78357028|ref|YP_388477.1| ABC transporter permease [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219433|gb|ABB38782.1| ABC transporter permease protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 373

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 92/348 (26%), Positives = 160/348 (45%), Gaps = 17/348 (4%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G  V  F G W   +       + + +    +  +     + +T  D+         +E 
Sbjct: 12  GRCVIVFQGRWTLHDTVPSVGKLALRLESDCRGGAVSFSCAGLTAWDSRFLTFCRSVLET 71

Query: 65  YHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKN-LHYHIGKKIVK 120
             G+       G+   + +L SL +         Q P+R     S K+ L   +G+ +  
Sbjct: 72  LEGRGIAYDTSGLPDGVLRLLSLAA---------QVPEREGAAVSRKSPLSARMGEALHA 122

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFK-GFLLSLIRQMYYVGVSGVPVVILISFVTG 179
               + S    +G V  +    C     F+     +L+R   + G   +P+V LIS + G
Sbjct: 123 AFAGTISVMEFIGDVTLSVLRMCIGRAVFRWSDTFALLR---FCGAQSLPIVSLISMLAG 179

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            + A  GA QL  FGAEI+   L+ I  LR +G ++TA++++GR G+A  AE+G+M++NE
Sbjct: 180 LIFAFVGAVQLKMFGAEIYVASLVGIAMLRVMGAVMTAIIVSGRVGAAFAAELGTMQVNE 239

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA  T G+  +  L+ PR+ AL++ +PLL + AN   I+G + V W   DI    +F+
Sbjct: 240 EIDAFSTFGISPLDFLVLPRMLALVLMMPLLCVYANLMGIVGGAAVGWLMLDINLHQYFN 299

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
               T +L +   G+  +      + + +   G   G  ++++GK  T
Sbjct: 300 MTWQTVSLTHFGVGIAHSVVFGFVVAVCSCYMGIHCGRSASAVGKATT 347


>gi|311109431|ref|YP_003982284.1| hypothetical protein AXYL_06276 [Achromobacter xylosoxidans A8]
 gi|310764120|gb|ADP19569.1| hypothetical protein AXYL_06276 [Achromobacter xylosoxidans A8]
          Length = 354

 Score =  126 bits (317), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 99/365 (27%), Positives = 185/365 (50%), Gaps = 13/365 (3%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDS-AIVDLSAITEIDTIGAELIMY-FMEKYHGK 68
            AG+W    ++E  +        +  +D  A  DL  I  +DTIGA LI   +  K   +
Sbjct: 1   MAGDWSVLALAEPGEVQRRREALACATDGGARWDLHGIGRLDTIGALLIWEAWGHKLPER 60

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           ++    S   + +F+ ++  ++ +     P+R  +     +    +G+ I + I++  + 
Sbjct: 61  VRW---SAGQQDVFNALAM-NKGETPAAAPKRDPW-----SWPRAVGEAIFQAIDNGRAL 111

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG ++ + G          G    +  Q+Y  G   + +  L+ F+ G V++   A 
Sbjct: 112 LVMLGQLVLDFGGMLRRPRL--GPWREISAQVYRTGAQALGITALVGFLIGVVLSYLSAQ 169

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL   GA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  MG
Sbjct: 170 QLQMIGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMLVMG 229

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +   + LI PR+ AL +++PLL +  +  AI+G  +       +    F        +L 
Sbjct: 230 ISHGQRLILPRVVALAVTMPLLVLWTDAMAILGGMLAAQMQLGVSAQWFLQSLPDAISLT 289

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N + G++K       I ++A   G  +  ++ SLG+  TT VV SI+ VI++D+ +A+ +
Sbjct: 290 NYWIGILKGVTFGMLIALIACHFGLRIQPNTESLGRGTTTSVVTSITGVILLDAFYAVIF 349

Query: 369 FAIGI 373
            ++GI
Sbjct: 350 SSVGI 354


>gi|255019625|ref|ZP_05291705.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970928|gb|EET28410.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Acidithiobacillus caldus
           ATCC 51756]
          Length = 380

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/210 (37%), Positives = 124/210 (59%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           G   +P++ LI F+ G VI+ Q A  L+ +GA I+ I +  +  LRE G L+TAV++AGR
Sbjct: 168 GPDSLPILSLIGFLIGIVISFQSAPTLASYGANIYIISIAGLSILREFGPLITAVILAGR 227

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           +GSA  A+IG+M++ EE+DA+RT G+  V+ LI P++ AL I+LPLL +  +  AI+GA 
Sbjct: 228 TGSAFTAQIGAMRVTEELDALRTFGISPVQRLILPKVIALAITLPLLVVWTDAVAILGAI 287

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           IV      I  + F           N + G+ K       I  V+   G  V  +++SL 
Sbjct: 288 IVAKLDLGISASFFLREMPIMVPDFNFWLGIGKGILFGILIAWVSGYHGLKVQPNTDSLS 347

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           ++ T  VV ++++VI+ID++ A+ +   GI
Sbjct: 348 RETTDSVVLTLTLVIVIDAVLAMVFANTGI 377


>gi|114777488|ref|ZP_01452485.1| ABC-type transport system involved in resistance to organic
           solvents [Mariprofundus ferrooxydans PV-1]
 gi|114552270|gb|EAU54772.1| ABC-type transport system involved in resistance to organic
           solvents [Mariprofundus ferrooxydans PV-1]
          Length = 257

 Score =  126 bits (317), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 120/215 (55%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q   VGV  +PVV+L +  TG V+A Q      +F AE  +  ++S+  +RE+G +L
Sbjct: 43  LLQQAEEVGVQSLPVVMLTALFTGMVLALQSYIVFHRFAAESLTGLVVSMSLVRELGPVL 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
             +M+AGR G+A  AE+G+M++ E+IDA+ T+  D VR LI PR+ A+ + +PLL ++A+
Sbjct: 103 VGLMVAGRVGAAFAAELGTMRVTEQIDALWTLSTDPVRYLIMPRLIAVTLMMPLLVVVAD 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  I G   +     D   +V+         L++ +TGL+KA F    IGI+   EGF  
Sbjct: 163 FIGIYGGYAISIYLLDQNPSVYIENTTQYMELSDFYTGLVKAGFFGILIGIIGCTEGFNC 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
              +  +G   T  VV S   ++I D     + FA
Sbjct: 223 KGGAAGVGTATTRAVVISCMSILISDYFLTAWMFA 257


>gi|254251295|ref|ZP_04944613.1| hypothetical protein BDAG_00477 [Burkholderia dolosa AUO158]
 gi|124893904|gb|EAY67784.1| hypothetical protein BDAG_00477 [Burkholderia dolosa AUO158]
          Length = 386

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 171 NVYSAGAQALPITALVAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAI 230

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A
Sbjct: 231 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIVA 290

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I    F         +AN++ GL K       I +VA   GF +  +
Sbjct: 291 LTGGALAAKMVLGIDVNYFVRSLPGVVPIANLYIGLGKGVVFGMLIALVACHFGFRIKAN 350

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI++VI+ D++FAI +  +G+
Sbjct: 351 SQSLGEGTTTSVVTSITVVILADAVFAILFQNVGL 385


>gi|254000132|ref|YP_003052195.1| hypothetical protein Msip34_2431 [Methylovorus sp. SIP3-4]
 gi|313202095|ref|YP_004040753.1| hypothetical protein MPQ_2372 [Methylovorus sp. MP688]
 gi|253986811|gb|ACT51668.1| protein of unknown function DUF140 [Methylovorus sp. SIP3-4]
 gi|312441411|gb|ADQ85517.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 371

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 90/366 (24%), Positives = 171/366 (46%), Gaps = 15/366 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W    +     ++  A+           DL A  ++DT GA +++     + GK+
Sbjct: 19  RLLGQWSLRALDNDFAELKQALQPFFSDPFTQWDLLATEQLDTAGATILL---NGWEGKL 75

Query: 70  --KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             ++Q V+     LF+ +           +   +F   +   L     + +  F+     
Sbjct: 76  DARMQ-VTEEQRALFTTLQGLRVPARTGSQFDWAFPLVATGELVMKFAQHLTDFVQLIGL 134

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +  ++        S++ ++ F+ ++    Y  GV+ +PV  L+ F+ G  ++   +
Sbjct: 135 LLLEMLYLVRR-----PSAFPWREFMANI----YKSGVTALPVTGLLGFMIGVAMSYLMS 185

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA+IF ++++ +  +RE+G +L A+++AGRSGSA+ A+IG M++ EEIDA+ TM
Sbjct: 186 SQLRTFGADIFIVNILGLSMIRELGPILMAILVAGRSGSAMTAQIGVMRVTEEIDALTTM 245

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+  +  ++ P++  L    P L +  +F  + G ++       + F  FF         
Sbjct: 246 GVSRILRIVLPKVLGLTFVAPFLVLWTSFWGLAGGALSANTELGLSFRFFFDYLPMVVEP 305

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            N+   L K       + +VA   G  +  ++ SL    T+ VV +I+ VI++D+ FAI 
Sbjct: 306 VNLTLSLFKGLLFGFVVTLVACHFGLRIMPNTESLSASTTSSVVTAITSVILLDAAFAIL 365

Query: 368 YFAIGI 373
              IG+
Sbjct: 366 TSGIGV 371


>gi|209521691|ref|ZP_03270381.1| protein of unknown function DUF140 [Burkholderia sp. H160]
 gi|209497882|gb|EDZ98047.1| protein of unknown function DUF140 [Burkholderia sp. H160]
          Length = 388

 Score =  126 bits (316), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 107/372 (28%), Positives = 188/372 (50%), Gaps = 20/372 (5%)

Query: 8   VFRFAGNWKSPEISEIADDV-VMAINKSIQSDSAI--VDLSAITEIDTIGAELIMYFMEK 64
           + R +G W +  ++   +   V+ + +++     I   DLS +  +D +G + +     +
Sbjct: 31  IVRLSGQWTALALARDRETGHVIPLLRALTGAQGIGEWDLSGVDRMDHVGGQALW----R 86

Query: 65  YHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             G+    G +    Q  +F  I+     +   +   R    + F  L    G  I  F+
Sbjct: 87  VWGRKMPPGTALTDTQRDIFERIALLDTVRESAEPVSR---IDPFTRL----GLGIFSFL 139

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVTGAV 181
           +       +LG V+    +  A + K K    + I   +Y  G   +P+  L++F+ G V
Sbjct: 140 DHMQGGVTMLGRVVL---DLLAIARKPKLTPWTEISANIYNAGARALPITALVAFLIGIV 196

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   A QL  FGA  F ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+
Sbjct: 197 LSYLSAQQLRIFGANQFIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEEL 256

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R MG+     LI PR+ AL +++PLL +  N  ++ G ++       I  + F  + 
Sbjct: 257 DAMRVMGIPHGLRLILPRVVALAVAMPLLVMWTNVISLTGGALAAKLVLGIEMSFFARQL 316

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            S   +AN++ GL K       I I     GF +  +S SLG+  TT VV SI+IVI+ D
Sbjct: 317 PSVVPIANLWIGLGKGAVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVTSITIVILAD 376

Query: 362 SLFAIFYFAIGI 373
           ++FAI +  +G+
Sbjct: 377 AVFAILFQNVGL 388


>gi|73539807|ref|YP_294327.1| hypothetical protein Reut_A0101 [Ralstonia eutropha JMP134]
 gi|72117220|gb|AAZ59483.1| Protein of unknown function DUF140 [Ralstonia eutropha JMP134]
          Length = 357

 Score =  126 bits (316), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 168/338 (49%), Gaps = 13/338 (3%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ-GVSTHIEQLFSLISFTHRKKIKN 95
            D A   L+ + ++D IG +L+    + + GK+  +   S    ++F  I+  H    + 
Sbjct: 32  PDDAHWSLAGVDKLDHIGGQLLW---QAWDGKLPQRLDASEGQRRVFERIADLHADGWRK 88

Query: 96  QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
              +R   +N         G  ++ F   + +   +LG +  +   F  +    +G    
Sbjct: 89  HIVER---FNPIT----LFGASVLSFCAQAANGVSMLGQLTFDLIRF--ARMPQRGPWRE 139

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +   +Y +G   + +  L+ F+ G V++   A QL  FGA  F ++++ +  +RE+G +L
Sbjct: 140 ISANIYNIGYKALGITALVGFLIGIVLSYLSANQLRTFGASTFIVNILGMAVIRELGPVL 199

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A+++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL + +PLL    +
Sbjct: 200 AAILVAGRSGSAITAQIGVMRVTEELDAMRVMGISHGFRLIMPRVIALAVCMPLLVAWTD 259

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
             A+ G  I       I    F         +AN++ GL K       IG+ A   G  +
Sbjct: 260 VLALAGGIIAARMQLGISPTFFLRALPDAVPVANLWLGLGKGVAFGILIGLAACHFGLRI 319

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             ++ SLG+  T  VV SI+IVI+ D++FA+ +  +G+
Sbjct: 320 KPNTQSLGEGTTASVVVSITIVIVADAIFAVMFKDVGL 357


>gi|307635079|gb|ADI85448.2| ABC transporter, membrane protein of unknown function DUF140
           [Geobacter sulfurreducens KN400]
          Length = 380

 Score =  125 bits (315), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 140/277 (50%), Gaps = 3/277 (1%)

Query: 98  PQRSFFYN-SFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
           P+++  +  S   L   I  +++         +  LG V    G   A   +F+     L
Sbjct: 106 PEQTLTHGGSRPPLLERIADRVIGMWKSMVEMSAFLGEVTVACGRLLAGRARFRRS--EL 163

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +  M   G   +P+V LISF+ G ++A  GA QLS FGA+I+   L+ I  +R +G ++T
Sbjct: 164 LAIMQECGAQALPIVSLISFLVGLILAFVGAVQLSMFGAQIYVASLVGIGIVRIMGAIMT 223

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            +++AGR+G+A  A +G+M++NEEIDA+ T+G+  V  L+ PR+ AL++ +PLL + A+ 
Sbjct: 224 GIIMAGRTGAAFAARLGTMQVNEEIDALATLGISPVEFLVIPRVAALVLMMPLLCLYADL 283

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
             I+G   V     D+    + +       L + + GL  +      + +     G   G
Sbjct: 284 MGILGGLAVGVLMLDLNVTEYITMTKKAVRLKDFWVGLFHSGVFGVLVALAGCLRGIQCG 343

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             ++S+G   T+ VV  I  +++  ++  +    +GI
Sbjct: 344 RSASSVGDAATSAVVTGIVSIVVATAVITVICNILGI 380


>gi|289547869|ref|YP_003472857.1| hypothetical protein Thal_0093 [Thermocrinis albus DSM 14484]
 gi|289181486|gb|ADC88730.1| protein of unknown function DUF140 [Thermocrinis albus DSM 14484]
          Length = 245

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 117/209 (55%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L   ++Q+ Y+G   VPVV++ S  +G VIA Q      +F AE     ++++   RE+G
Sbjct: 29  LYHFVKQLAYLGAETVPVVVITSLFSGGVIALQTYSTFHRFNAEFLIGAVVALSMFRELG 88

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            +LTA+M+  R GSA+ A IG+M+I E+IDA+  MG++ V  L++PRI A ++ LPLLTI
Sbjct: 89  PVLTALMVTARVGSAMTASIGTMRITEQIDALEVMGMNPVSYLVTPRIVAGVLGLPLLTI 148

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +++ + I+G   V    + +   +F+ R        +   GL KA F    +  V+   G
Sbjct: 149 ISDVAGILGGWFVAVGLFGVNNHLFWERMRDLVEFYDFVGGLYKAVFFGLVVSAVSCYFG 208

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           F     +  +G+  T+ VV S  +V+I D
Sbjct: 209 FYTKGGTEGVGRATTSSVVTSSMLVLISD 237


>gi|167717852|ref|ZP_02401088.1| ABC transporter, permease protein [Burkholderia pseudomallei DM98]
          Length = 374

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 104/374 (27%), Positives = 179/374 (47%), Gaps = 16/374 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G TV R  G W +  ++    +V   I +  +      DLS +  +D +G + +   
Sbjct: 14  GSQGRTV-RLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW-- 70

Query: 62  MEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +  G+    G++    Q  +F  I    R     + P+     +         G+ + 
Sbjct: 71  --RVWGRRLPDGIALTDNQRVVFERI---ERLDAGRESPEPVVRIDPVT----RFGQGLF 121

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
            F         +LG +I +               +S    +Y  G   +P+  L++F+ G
Sbjct: 122 TFGEHLYGGIALLGSLIVDLLAVLRRPRTMPWTEISA--NVYAAGTKALPITALVAFLIG 179

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ E
Sbjct: 180 IVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTE 239

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F  
Sbjct: 240 ELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVR 299

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
              S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+
Sbjct: 300 SLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVIL 359

Query: 360 IDSLFAIFYFAIGI 373
            D++FAI +  +G+
Sbjct: 360 ADAVFAILFQNVGL 373


>gi|53718041|ref|YP_107027.1| hypothetical protein BPSL0401 [Burkholderia pseudomallei K96243]
 gi|76809874|ref|YP_332026.1| ABC transporter permease [Burkholderia pseudomallei 1710b]
 gi|126441439|ref|YP_001057484.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 668]
 gi|126452246|ref|YP_001064733.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106a]
 gi|134279780|ref|ZP_01766492.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 305]
 gi|167736870|ref|ZP_02409644.1| ABC transporter, permease protein [Burkholderia pseudomallei 14]
 gi|167813976|ref|ZP_02445656.1| ABC transporter, permease protein [Burkholderia pseudomallei 91]
 gi|167822497|ref|ZP_02453968.1| ABC transporter, permease protein [Burkholderia pseudomallei 9]
 gi|167844078|ref|ZP_02469586.1| ABC transporter, permease protein [Burkholderia pseudomallei B7210]
 gi|167892582|ref|ZP_02479984.1| ABC transporter, permease protein [Burkholderia pseudomallei 7894]
 gi|167901079|ref|ZP_02488284.1| ABC transporter, permease protein [Burkholderia pseudomallei NCTC
           13177]
 gi|167909299|ref|ZP_02496390.1| ABC transporter, permease protein [Burkholderia pseudomallei 112]
 gi|167917331|ref|ZP_02504422.1| ABC transporter, permease protein [Burkholderia pseudomallei
           BCC215]
 gi|226193717|ref|ZP_03789320.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237810635|ref|YP_002895086.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei MSHR346]
 gi|242316672|ref|ZP_04815688.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106b]
 gi|254181998|ref|ZP_04888595.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1655]
 gi|254187927|ref|ZP_04894439.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254196514|ref|ZP_04902938.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei S13]
 gi|254260256|ref|ZP_04951310.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1710a]
 gi|254295953|ref|ZP_04963410.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 406e]
 gi|52208455|emb|CAH34389.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76579327|gb|ABA48802.1| ABC transporter, permease protein [Burkholderia pseudomallei 1710b]
 gi|126220932|gb|ABN84438.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 668]
 gi|126225888|gb|ABN89428.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106a]
 gi|134248980|gb|EBA49062.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 305]
 gi|157805700|gb|EDO82870.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 406e]
 gi|157935607|gb|EDO91277.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|169653257|gb|EDS85950.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei S13]
 gi|184212536|gb|EDU09579.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1655]
 gi|225934295|gb|EEH30279.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237504399|gb|ACQ96717.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei MSHR346]
 gi|242139911|gb|EES26313.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106b]
 gi|254218945|gb|EET08329.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1710a]
          Length = 374

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 183/375 (48%), Gaps = 18/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G TV R  G W +  ++    +V   I +  +      DLS +  +D +G + +   
Sbjct: 14  GSQGRTV-RLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW-- 70

Query: 62  MEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +  G+    G++    Q  +F  I      +   +   R      F    +  G+ + 
Sbjct: 71  --RVWGRRLPDGIALTDNQRVVFERIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHLY 128

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVT 178
             I      A + GL++    +  A   + +    + I   +Y  G   +P+  L++F+ 
Sbjct: 129 GGI------ALLGGLIV----DLLAVLRRPRTMPWTEISANVYAAGTKALPITALVAFLI 178

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ 
Sbjct: 179 GIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVT 238

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F 
Sbjct: 239 EELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFV 298

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI
Sbjct: 299 RSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVI 358

Query: 359 IIDSLFAIFYFAIGI 373
           + D++FAI +  +G+
Sbjct: 359 LADAVFAILFQNVGL 373


>gi|217419400|ref|ZP_03450906.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 576]
 gi|217396704|gb|EEC36720.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 576]
          Length = 366

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 183/375 (48%), Gaps = 18/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G TV R  G W +  ++    +V   I +  +      DLS +  +D +G + +   
Sbjct: 6   GSQGRTV-RLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW-- 62

Query: 62  MEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +  G+    G++    Q  +F  I      +   +   R      F    +  G+ + 
Sbjct: 63  --RVWGRRLPDGIALTDNQRVVFERIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHLY 120

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVT 178
             I      A + GL++    +  A   + +    + I   +Y  G   +P+  L++F+ 
Sbjct: 121 GGI------ALLGGLIV----DLLAVLRRPRTMPWTEISANVYAAGTKALPITALVAFLI 170

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ 
Sbjct: 171 GIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVT 230

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F 
Sbjct: 231 EELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFV 290

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI
Sbjct: 291 RSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVI 350

Query: 359 IIDSLFAIFYFAIGI 373
           + D++FAI +  +G+
Sbjct: 351 LADAVFAILFQNVGL 365


>gi|254176752|ref|ZP_04883409.1| putative ABC transporter, permease protein [Burkholderia mallei
           ATCC 10399]
 gi|254202028|ref|ZP_04908392.1| putative ABC transporter, permease protein [Burkholderia mallei
           FMH]
 gi|254207359|ref|ZP_04913710.1| putative ABC transporter, permease protein [Burkholderia mallei
           JHU]
 gi|147747922|gb|EDK54998.1| putative ABC transporter, permease protein [Burkholderia mallei
           FMH]
 gi|147752901|gb|EDK59967.1| putative ABC transporter, permease protein [Burkholderia mallei
           JHU]
 gi|160697793|gb|EDP87763.1| putative ABC transporter, permease protein [Burkholderia mallei
           ATCC 10399]
          Length = 374

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 183/375 (48%), Gaps = 18/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G TV R  G W +  ++    +V   I +  +      DLS +  +D +G + +   
Sbjct: 14  GSQGRTV-RLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW-- 70

Query: 62  MEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +  G+    G++    Q  +F  I      +   +   R      F    +  G+ + 
Sbjct: 71  --RVWGRRLPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHLY 128

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVT 178
             I      A + GL++    +  A   + +    + I   +Y  G   +P+  L++F+ 
Sbjct: 129 GGI------ALLGGLIV----DLLAVLRRPRTMPWTEISANVYAAGTKALPITALVAFLI 178

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ 
Sbjct: 179 GIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVT 238

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F 
Sbjct: 239 EELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFV 298

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI
Sbjct: 299 RSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVI 358

Query: 359 IIDSLFAIFYFAIGI 373
           + D++FAI +  +G+
Sbjct: 359 LADAVFAILFQNVGL 373


>gi|53724609|ref|YP_101915.1| ABC transporter permease [Burkholderia mallei ATCC 23344]
 gi|52428032|gb|AAU48625.1| ABC transporter, permease protein [Burkholderia mallei ATCC 23344]
          Length = 355

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 101/367 (27%), Positives = 176/367 (47%), Gaps = 15/367 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G W +  ++    +V   I +  +      DLS +  +D +G + +     +  G+
Sbjct: 1   MRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW----RVWGR 56

Query: 69  IKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
               G++    Q  +F  I    R     + P+     +         G+ +  F     
Sbjct: 57  RLPDGIALTDNQRVVFKRI---ERLDAGRESPEPVVRIDPVT----RFGQGLFTFGEHLY 109

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
               +LG +I +               +S    +Y  G   +P+  L++F+ G V++   
Sbjct: 110 GGIALLGGLIVDLLAVLRRPRTMPWTEISA--NVYAAGTKALPITALVAFLIGIVLSYLS 167

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R 
Sbjct: 168 AQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRV 227

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S   
Sbjct: 228 MGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVVP 287

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI
Sbjct: 288 IANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAI 347

Query: 367 FYFAIGI 373
            +  +G+
Sbjct: 348 LFQNVGL 354


>gi|67642420|ref|ZP_00441177.1| putative ABC transporter, permease protein [Burkholderia mallei GB8
           horse 4]
 gi|121598966|ref|YP_991583.1| putative ABC transporter, permease protein [Burkholderia mallei
           SAVP1]
 gi|126450485|ref|YP_001082718.1| putative ABC transporter, permease protein [Burkholderia mallei
           NCTC 10247]
 gi|251768288|ref|ZP_02270158.2| putative ABC transporter, permease protein [Burkholderia mallei
           PRL-20]
 gi|254357616|ref|ZP_04973890.1| putative ABC transporter, permease protein [Burkholderia mallei
           2002721280]
 gi|121227776|gb|ABM50294.1| putative ABC transporter, permease protein [Burkholderia mallei
           SAVP1]
 gi|126243355|gb|ABO06448.1| putative ABC transporter, permease protein [Burkholderia mallei
           NCTC 10247]
 gi|148026680|gb|EDK84765.1| putative ABC transporter, permease protein [Burkholderia mallei
           2002721280]
 gi|238523569|gb|EEP87007.1| putative ABC transporter, permease protein [Burkholderia mallei GB8
           horse 4]
 gi|243060282|gb|EES42468.1| putative ABC transporter, permease protein [Burkholderia mallei
           PRL-20]
          Length = 366

 Score =  125 bits (313), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 183/375 (48%), Gaps = 18/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G TV R  G W +  ++    +V   I +  +      DLS +  +D +G + +   
Sbjct: 6   GSQGRTV-RLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW-- 62

Query: 62  MEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +  G+    G++    Q  +F  I      +   +   R      F    +  G+ + 
Sbjct: 63  --RVWGRRLPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHLY 120

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVT 178
             I      A + GL++    +  A   + +    + I   +Y  G   +P+  L++F+ 
Sbjct: 121 GGI------ALLGGLIV----DLLAVLRRPRTMPWTEISANVYAAGTKALPITALVAFLI 170

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ 
Sbjct: 171 GIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVT 230

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F 
Sbjct: 231 EELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFV 290

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI
Sbjct: 291 RSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVI 350

Query: 359 IIDSLFAIFYFAIGI 373
           + D++FAI +  +G+
Sbjct: 351 LADAVFAILFQNVGL 365


>gi|124386096|ref|YP_001027344.1| ABC transporter, permease protein [Burkholderia mallei NCTC 10229]
 gi|124294116|gb|ABN03385.1| ABC transporter, permease protein [Burkholderia mallei NCTC 10229]
          Length = 428

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 105/375 (28%), Positives = 183/375 (48%), Gaps = 18/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
              G TV R  G W +  ++    +V   I +  +      DLS +  +D +G + +   
Sbjct: 68  GSQGRTV-RLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALW-- 124

Query: 62  MEKYHGKIKLQGVSTHIEQ--LFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +  G+    G++    Q  +F  I      +   +   R      F    +  G+ + 
Sbjct: 125 --RVWGRRLPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHLY 182

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVT 178
             I      A + GL++    +  A   + +    + I   +Y  G   +P+  L++F+ 
Sbjct: 183 GGI------ALLGGLIV----DLLAVLRRPRTMPWTEISANVYAAGTKALPITALVAFLI 232

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ 
Sbjct: 233 GIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVT 292

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F 
Sbjct: 293 EELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFV 352

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
               S   +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI
Sbjct: 353 RSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVI 412

Query: 359 IIDSLFAIFYFAIGI 373
           + D++FAI +  +G+
Sbjct: 413 LADAVFAILFQNVGL 427


>gi|187250741|ref|YP_001875223.1| ABC transporter-like protein [Elusimicrobium minutum Pei191]
 gi|186970901|gb|ACC97886.1| ABC transporter related [Elusimicrobium minutum Pei191]
          Length = 258

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 80/261 (30%), Positives = 143/261 (54%), Gaps = 8/261 (3%)

Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           IG++I+ F N+ C +A    ++ S       + +++       ++Q   +G++ + V  L
Sbjct: 5   IGREIIIFFNE-CGKA--FNMLRSCMFWLFKAPFEWA----QAMQQSVTIGINSLTVTTL 57

Query: 174 ISFVTGAVIAQQGAFQLSQFGAE-IFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEI 232
            S  TG V+A QG   +S   +E +F   L+S   +RE+G +LTAV++ GR+G+A+ AEI
Sbjct: 58  TSIFTGMVLALQGGNTISNILSEPMFVGTLVSFSLIRELGPVLTAVVVVGRAGAAVTAEI 117

Query: 233 GSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDI 292
           G+M++ E+IDA+ T+G + VR L+ PR++A ++++P+LT+ ANFS I G  +V      +
Sbjct: 118 GTMQVTEQIDALYTLGTNPVRQLVLPRMFAFMLTVPILTLFANFSGIFGGYLVAVHGLGV 177

Query: 293 PFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQ 352
           P   +     +     +   G IK+ F A  +G V   +G      +  +G+  T  VV 
Sbjct: 178 PDVTYLEDITNYMNTLDFMHGFIKSIFFAFMVGTVCCYKGLDTKGGAEGVGRSTTIAVVT 237

Query: 353 SISIVIIIDSLFAIFYFAIGI 373
           S+ +++++D        A GI
Sbjct: 238 SMVLILVLDYFLTAILTAFGI 258


>gi|325527206|gb|EGD04595.1| putative ABC transporter permease [Burkholderia sp. TJI49]
          Length = 351

 Score =  124 bits (312), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 136 NIYSAGTQALPITALVAFLIGIVLSYLSAQQLQMFGANRYIVNILGLSVIRELGPVLSAI 195

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL I++PLL +  N  A
Sbjct: 196 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGIAMPLLVMWTNIIA 255

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I    F         +AN++ G+ K       I +VA   GF +  +
Sbjct: 256 LTGGALAAKLVLGIDVNYFVRSLPGVVPIANLYIGIGKGVVFGMLIALVACHFGFRIKAN 315

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI++VI+ D++FAI +  +G+
Sbjct: 316 SQSLGEGTTTSVVTSITVVILADAVFAILFQNVGL 350


>gi|223940090|ref|ZP_03631954.1| protein of unknown function DUF140 [bacterium Ellin514]
 gi|223891275|gb|EEF57772.1| protein of unknown function DUF140 [bacterium Ellin514]
          Length = 399

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 93/334 (27%), Positives = 173/334 (51%), Gaps = 15/334 (4%)

Query: 42  VDLSAITEIDTIGAELIMYFMEK----YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQK 97
           V+++ +T  D+ G    +Y + K       ++ L G+    ++     S    +  + ++
Sbjct: 75  VNVAPLTYSDSAGFAF-LYLLSKGCMTPQSQVSLNGLKPEYQKALQNYSMEDVQAYQGEQ 133

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           P R       ++L   IG  ++    +   +   +G VIS  G         +     ++
Sbjct: 134 PVR-------QSLMDEIGMAVIAKTLEVRQKVIFVGDVISGLGYVLTHPRWMRRN--EIV 184

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
           R     G + +P+V LIS + G VIA + A   ++FGA+I+  +L+ ++ +RE+  ++TA
Sbjct: 185 RIFETAGANALPIVSLISLLLGLVIAFEAAQPFARFGAKIYIANLIGLIMVRELSPVMTA 244

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +++AGRSGSA  AE+G+MK+NEE++A+ T+GLD +R L+  RI A ++  PLLTI +  +
Sbjct: 245 ILLAGRSGSAFAAELGTMKVNEELNALETIGLDPMRFLVVQRILASLLLTPLLTIYSMAT 304

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            ++G  +V+      P ++ + +  S+  + +I  G++KA      +   A   G     
Sbjct: 305 GVLGGVLVMLG-LGFPLSIAWHQLQSSVRINDIAFGILKAFVFGGIVAGTACLRGLETKS 363

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
              ++G+  T  VV  I ++II DS+FAI  F +
Sbjct: 364 GPAAVGESTTRSVVSGILLIIIADSVFAILKFVL 397


>gi|114328116|ref|YP_745273.1| ABC transporter permease [Granulibacter bethesdensis CGDNIH1]
 gi|114316290|gb|ABI62350.1| ABC transporter permease protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 392

 Score =  124 bits (311), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 125/218 (57%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+R +   G S + +V +++F+ G+++A  GA QL +F A+I+  +L+ +  +RE+  ++
Sbjct: 175 LLRDISDAGPSALLIVGIVNFLMGSILAFVGAVQLRKFAADIYVANLVGLASVREMSAVM 234

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+++AGR+G A  A I +M  NEEIDA+R  G+   R L+ P I AL++++P+L + A 
Sbjct: 235 TAIIMAGRTGGAYAARIATMTGNEEIDALRVFGIPVSRYLLLPSIAALVLTMPILYLYAC 294

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
             +++G  IV     D+  A F++    +  +     G +K    A  IG+V+ + G   
Sbjct: 295 LISLVGGYIVSQGMLDVTMAGFWNHLFGSVHIDQFVFGFVKTITFAMLIGLVSCRIGLKA 354

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G  +  +G   T  VV  I  VI +DS+FA+    IGI
Sbjct: 355 GRSAADVGVAATRAVVSGIVGVIALDSMFAVLATIIGI 392


>gi|295675321|ref|YP_003603845.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1002]
 gi|295435164|gb|ADG14334.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1002]
          Length = 389

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 108/382 (28%), Positives = 186/382 (48%), Gaps = 40/382 (10%)

Query: 8   VFRFAGNWKSPEISEIADDV-VMAINKSIQSDSAI--VDLSAITEIDTIGAE-LIMYFME 63
           + R +G W +  ++   D   V+   +S+     I   DLS +  +D +G + L   +  
Sbjct: 31  IVRLSGQWTALALARDRDTGHVIPQLRSLTGAQGIGGWDLSRVDSMDHVGGQALWRVWGR 90

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K      L      I +  +L+        ++ +P   F  + F  L    G  I  F+ 
Sbjct: 91  KLPPGTALTDTQRDIFERIALLDTVR----ESAEPVTRF--DPFTRL----GLGIFSFVE 140

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVV 171
                  +LG V+ +              LL+++R+            +Y  G   +P+ 
Sbjct: 141 HMQGGVAMLGRVVLD--------------LLAILRKPKLTPWTEISANIYNAGARALPIT 186

Query: 172 ILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAE 231
            L++F+ G V++   A QL  FGA  F ++++ +  +RE+G +L+A+++AGRSGSAI A+
Sbjct: 187 ALVAFLIGIVLSYLSAQQLRIFGANQFIVNILGLAVIRELGPVLSAILVAGRSGSAITAQ 246

Query: 232 IGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYD 291
           IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  ++ G ++       
Sbjct: 247 IGVMRVTEELDAMRVMGIPHGLRLILPRVIALAVAMPLLVMWTNVISLTGGALAAKLVLG 306

Query: 292 IPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVV 351
           I  + F  +      +AN++ GL K       I I     GF +  +S SLG+  TT VV
Sbjct: 307 IDMSFFARQLPVVVPIANLWIGLGKGAVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVV 366

Query: 352 QSISIVIIIDSLFAIFYFAIGI 373
            SI+IVI+ D++FAI +  +G+
Sbjct: 367 TSITIVILADAVFAILFQNVGL 388


>gi|91781621|ref|YP_556827.1| ABC transporter inner membrane protein [Burkholderia xenovorans
           LB400]
 gi|91685575|gb|ABE28775.1| Putative ABC transporter, inner membrane subunit [Burkholderia
           xenovorans LB400]
          Length = 377

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 162 NVYNAGTQALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAI 221

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A
Sbjct: 222 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIA 281

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I  + F         +AN++ GL K       I IV    GF +  +
Sbjct: 282 LTGGALAARIVLGIDMSYFARALPGVVPVANLWIGLGKGVVFGMLIAIVGCHFGFRIKAN 341

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI+IVI+ D++FAI +  +G+
Sbjct: 342 SQSLGEGTTTSVVTSITIVILADAVFAILFQNVGL 376


>gi|296160361|ref|ZP_06843178.1| protein of unknown function DUF140 [Burkholderia sp. Ch1-1]
 gi|295889342|gb|EFG69143.1| protein of unknown function DUF140 [Burkholderia sp. Ch1-1]
          Length = 377

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 162 NVYNAGTQALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAI 221

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A
Sbjct: 222 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIA 281

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I  + F         +AN++ GL K       I IV    GF +  +
Sbjct: 282 LTGGALAAKIVLGIDMSYFARALPGVVPVANLWIGLGKGVVFGMLIAIVGCHFGFRIKAN 341

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI+IVI+ D++FAI +  +G+
Sbjct: 342 SQSLGEGTTTSVVTSITIVILADAVFAILFQNVGL 376


>gi|167561346|ref|ZP_02354262.1| ABC transporter, permease protein [Burkholderia oklahomensis EO147]
 gi|167568578|ref|ZP_02361452.1| ABC transporter, permease protein [Burkholderia oklahomensis C6786]
          Length = 374

 Score =  124 bits (310), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 100/376 (26%), Positives = 181/376 (48%), Gaps = 35/376 (9%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G W +  ++    +V   I +  +      DLS +  +D +G + +     +  G+ 
Sbjct: 21  RLYGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVVRLDHVGGQALW----RVWGRR 76

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
             +G++    Q  ++     R     + P+     +         G+ +  F        
Sbjct: 77  LPEGLALTDNQ-RTVFERIERLDEGREAPEPVVRIDPIT----RFGQGLFTFGEHLYGGI 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQ------------MYYVGVSGVPVVILISFV 177
            +LG ++ +              LLS++R+            +Y  G   +P+  L++F+
Sbjct: 132 GLLGRLVID--------------LLSVLRRPRTMPWTEISANVYAAGAKALPITALVAFL 177

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++   A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++
Sbjct: 178 IGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRV 237

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EE+DA+R MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F
Sbjct: 238 TEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLAIDLNFF 297

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                S   +AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++V
Sbjct: 298 VRSLPSVVPIANLWIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVV 357

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D++FAI +  +G+
Sbjct: 358 ILADAVFAILFQNVGL 373


>gi|167835250|ref|ZP_02462133.1| ABC transporter, permease protein [Burkholderia thailandensis
           MSMB43]
          Length = 281

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 66  NVYAAGAKALPITALVAFLIGIVLSYLSAQQLQLFGANRYIVNILGLSVIRELGPVLSAI 125

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     +  PR+ AL +++PLL +  N  A
Sbjct: 126 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRITLPRVLALGVAMPLLVMWTNVIA 185

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I    F     S   +AN+F GL K       I +VA   GF +  +
Sbjct: 186 LTGGALAAKFVLGIDLNFFVRSLPSVVPIANLFIGLGKGVVFGMLIALVACHFGFRIKAN 245

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI++VI+ D++FAI +  +G+
Sbjct: 246 SQSLGEGTTTSVVTSITVVILADAVFAILFQNVGL 280


>gi|85858103|ref|YP_460305.1| organic solvents resistance ABC transporter permease [Syntrophus
           aciditrophicus SB]
 gi|85721194|gb|ABC76137.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Syntrophus aciditrophicus
           SB]
          Length = 284

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 86/280 (30%), Positives = 147/280 (52%), Gaps = 17/280 (6%)

Query: 90  RKKIKNQKPQRSFFYNSFKNLHY---HIGKKIVKFINDSCSQAHILGLVISNTGEFCASS 146
           R  I+    +++  +N+ + L +    +G+ ++ +IN+S       G             
Sbjct: 6   RPDIQESSEEKAG-WNAIRLLSWPFAQLGRSVISWINNS-------GAAAIFLLLAALKI 57

Query: 147 YKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSIL 206
           ++ +  L+ + +Q+YY+G     +++L+   TG V+  Q    L Q GAE     L+++ 
Sbjct: 58  FRPRQ-LMKITQQIYYIGARSTMIIMLVGLFTGMVLGLQSYHALVQVGAEGALGTLVALS 116

Query: 207 QLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
            +RE+G +LTA+MI  R+GSAI A+IG  +I+E+IDA+ TM +D +R LISPRI A IIS
Sbjct: 117 LIRELGPVLTAIMITARAGSAITAQIGIERISEQIDALDTMHIDPLRYLISPRIAAAIIS 176

Query: 267 LPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
            P+LT L +   I+G+ I            FF R  S+  ++++  G IKA   A  +  
Sbjct: 177 FPVLTALFDLIGILGSYISGVLIMGANAGTFFHRVQSSVEMSDVNEGFIKAIVFAVIVST 236

Query: 327 VAMKEGFAVGVHSNSLGKK-----VTTCVVQSISIVIIID 361
           V   +G+   +  +S G K      T+ VV S  ++++ D
Sbjct: 237 VCCYQGYFAHMRPDSHGAKAVGLSTTSAVVLSCVLILVSD 276


>gi|187922498|ref|YP_001894140.1| hypothetical protein Bphyt_0491 [Burkholderia phytofirmans PsJN]
 gi|187713692|gb|ACD14916.1| protein of unknown function DUF140 [Burkholderia phytofirmans PsJN]
          Length = 377

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 109/371 (29%), Positives = 183/371 (49%), Gaps = 18/371 (4%)

Query: 8   VFRFAGNWKSPEIS-EIADDVVMAINKSIQSDSAI--VDLSAITEIDTIGAE-LIMYFME 63
           + R +G W +  ++ + A   V+ + +S+     I   DLS I  +D +G + L   +  
Sbjct: 19  IVRLSGQWTALALARDRATGHVIPLLRSLVGAEGIGQWDLSRIDRMDHVGGQALWRVWGH 78

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K      L      I +  +L+          +K +    ++    L    G  I  F  
Sbjct: 79  KMPPDTTLTDTQRDIFERIALLDTVR------EKAEPVIRFDPLTRL----GLAIFSFFE 128

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIR-QMYYVGVSGVPVVILISFVTGAVI 182
                  +LG V+    +  A + K K    + I   +Y  G   +P+  L++F+ G V+
Sbjct: 129 HLYGGVAMLGRVVL---DLLAIARKPKITPWTEISANIYNAGTKALPITALVAFLIGIVL 185

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA  + ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 186 SYLSAQQLRLFGANQYIVNILGLSVIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 245

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I  + F     
Sbjct: 246 AMRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIALTGGALAAKIALGIDMSYFARALP 305

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ GL K       I IV    GF +  +S SLG+  TT VV SI+IVI+ D+
Sbjct: 306 GVVPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADA 365

Query: 363 LFAIFYFAIGI 373
           +FAI +  +G+
Sbjct: 366 VFAILFQNVGL 376


>gi|239906932|ref|YP_002953673.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239796798|dbj|BAH75787.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 269

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 125/217 (57%), Gaps = 5/217 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q+Y++GV  + V+ LI   TG V+  QG + L +FG+E      +++  +RE+G +L
Sbjct: 51  IVQQVYFIGVKSIFVIALIGLFTGMVLGLQGYYTLVKFGSEGLLGAAVALSIIRELGPVL 110

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+MI GR+GS++ AE+G M+I+E+IDA+ TM ++ +R L++PR+ A +I  PLLT + +
Sbjct: 111 TAIMITGRAGSSMAAELGIMRISEQIDALSTMDINPMRFLVAPRLAASLICFPLLTAIFD 170

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I+G  +       I   V+F R  +T  LA++  G +K+   A  + ++   EG+  
Sbjct: 171 VVGILGGYLSGCVLLGINPGVYFDRIDATVELADVTGGFVKSVVFALLVAVICCYEGYFT 230

Query: 336 GVHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
                  G K      T+ VV S  ++++ D +   F
Sbjct: 231 HARQGGFGAKGVSLATTSAVVLSCVVILVADYVLTSF 267


>gi|330822969|ref|YP_004386272.1| hypothetical protein Alide2_0328 [Alicycliphilus denitrificans
           K601]
 gi|329308341|gb|AEB82756.1| protein of unknown function DUF140 [Alicycliphilus denitrificans
           K601]
          Length = 372

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 125/214 (58%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y +G   + +  L+ F+ G V+A   + QL QFGAE F ++++ I  +RE+G +L A+
Sbjct: 158 HVYQMGAKALHITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAI 217

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL +++PL+ +    +A
Sbjct: 218 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIAHGFRLVMPRALALGLAMPLIALWTTLAA 277

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G  +       I  A F     +   ++N++  + K+      I ++    G  V  +
Sbjct: 278 LAGGMLAADLTMGISSAYFLQALPAAVKVSNLWLAMAKSVVFGVFIALIGCHWGLRVKPN 337

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           + SLG+  T  VV +I++VI++D+LFA+ +  +G
Sbjct: 338 TQSLGEGTTASVVSAITMVIVVDALFAVAFKNLG 371


>gi|121607910|ref|YP_995717.1| hypothetical protein Veis_0920 [Verminephrobacter eiseniae EF01-2]
 gi|121552550|gb|ABM56699.1| protein of unknown function DUF140 [Verminephrobacter eiseniae
           EF01-2]
          Length = 374

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 97/365 (26%), Positives = 181/365 (49%), Gaps = 17/365 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIV----DLSAITEIDTIGAELIMYFMEKYHGK 68
           G W + E+   A     A++  ++   A+     DL A+  +D +GA+L+    ++   +
Sbjct: 23  GRWGAAELGNAAQ--WQALSGQLRKHPAVPTLGWDLRALQWLDHVGAQLLWNHWQRAWPQ 80

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            +L    +    L  +  F+         P   +   +  +   H+G  ++  +  +   
Sbjct: 81  -QLACTDSQRSMLARVAQFS-----TTAPPPAPWRLAAQVD---HLGLLVLHGVEHARHI 131

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG ++ +      +  +  G    +   +Y +G + +P+  L+ F+ G V+A   + 
Sbjct: 132 LEMLGQLVLDLARLARAPRR--GPWRDVSGHLYRMGATALPITALVGFLIGVVLAYLMSL 189

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+R MG
Sbjct: 190 QLRQFGAESFIVNILGISLIRELGPMLAAILVAGRSGSAITAQIGVMRVTEELDAMRVMG 249

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +     L+ PR  AL +++PLL++    +A+ G  +       I  A F     +     
Sbjct: 250 IAHGFRLVLPRTLALALAMPLLSLWTTLAALAGGMLAADLTMGISPAYFAQALPAAVRPG 309

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N+   + K+      I ++    G  V   + SLG+  T  VV +I++VI++D+LFA+ +
Sbjct: 310 NLGLAMAKSVVFGAGIALIGCHWGLRVRPDTQSLGEGTTASVVSAITMVIVVDALFAVTF 369

Query: 369 FAIGI 373
             IGI
Sbjct: 370 KTIGI 374


>gi|319761111|ref|YP_004125048.1| hypothetical protein Alide_0383 [Alicycliphilus denitrificans BC]
 gi|317115672|gb|ADU98160.1| protein of unknown function DUF140 [Alicycliphilus denitrificans
           BC]
          Length = 388

 Score =  123 bits (309), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 71/214 (33%), Positives = 125/214 (58%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y +G   + +  L+ F+ G V+A   + QL QFGAE F ++++ I  +RE+G +L A+
Sbjct: 174 HVYQMGAKALHITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAI 233

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL +++PL+ +    +A
Sbjct: 234 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIAHGFRLVMPRALALGLAMPLIALWTTLAA 293

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G  +       I  A F     +   ++N++  + K+      I ++    G  V  +
Sbjct: 294 LAGGMLAADLTMGISSAYFLQALPAAVKVSNLWLAMAKSVVFGVFIALIGCHWGLRVKPN 353

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           + SLG+  T  VV +I++VI++D+LFA+ +  +G
Sbjct: 354 TQSLGEGTTASVVSAITMVIVVDALFAVAFKNLG 387


>gi|307728301|ref|YP_003905525.1| hypothetical protein BC1003_0230 [Burkholderia sp. CCGE1003]
 gi|307582836|gb|ADN56234.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1003]
          Length = 389

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/215 (36%), Positives = 128/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 174 NIYNAGTRALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAI 233

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  N  A
Sbjct: 234 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIA 293

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I  + F         +AN++ GL K       I IV    GF +  +
Sbjct: 294 LTGGAVAAKIVLGIDMSYFARALPGVVPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKAN 353

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI+IVI+ D++FAI +  +G+
Sbjct: 354 SQSLGEGTTTSVVTSITIVILADAVFAILFQNVGL 388


>gi|258404804|ref|YP_003197546.1| hypothetical protein Dret_0676 [Desulfohalobium retbaense DSM 5692]
 gi|257797031|gb|ACV67968.1| protein of unknown function DUF140 [Desulfohalobium retbaense DSM
           5692]
          Length = 256

 Score =  123 bits (308), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 137/256 (53%), Gaps = 7/256 (2%)

Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           +G   ++ +      A +LG   S  G      ++ + F     +QM +VGV    VVIL
Sbjct: 8   LGAGTMRGLQQMGQMALLLG---SACGWLLRRPFRIRLFF----KQMEFVGVHSGFVVIL 60

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
               TG V+A Q  +    F AE      +++   RE+G ++TA+M+ GR+GSA+ AEIG
Sbjct: 61  TGLFTGMVLALQTYYAFRMFSAESLVGATVALSMTRELGPVITALMVTGRAGSAMAAEIG 120

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           +M++ E++DA+  M ++ V+ L++PR+ A ++ LPLLT++++F  I G  +V  K   I 
Sbjct: 121 TMRVTEQVDALEVMAINPVQYLVTPRLLAGMVMLPLLTVISDFVGIAGGYLVGVKMLGIN 180

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
            ++F ++ +    L++I+ GL KA      + +V   +GF     +  +G+  T  VV +
Sbjct: 181 SSMFMNKIYDLLELSDIYNGLTKAVVFGLILTLVGCYKGFYTSGGAEGVGRSTTQAVVLA 240

Query: 354 ISIVIIIDSLFAIFYF 369
             ++++ D +     F
Sbjct: 241 SVLILMSDYILTALMF 256


>gi|283853085|ref|ZP_06370341.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
 gi|283571552|gb|EFC19556.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
          Length = 274

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 123/217 (56%), Gaps = 5/217 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q+Y++GV  V V++LI   TG V+  QG + L +FG+E      +++  +RE+G +L
Sbjct: 56  IVQQVYFIGVKSVFVIVLIGLFTGMVLGLQGYYTLVKFGSEGLLGAAVALSIIRELGPVL 115

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+MI GR+GS++ AEIG M+I+E+IDA+ TMG++ +R LI+PR+ A ++  PLLT + +
Sbjct: 116 TAIMITGRAGSSMAAEIGIMRISEQIDALSTMGINPLRFLIAPRLAASLVCFPLLTAIFD 175

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G  +       I   V+F R  ST  L ++  G +K+   A  +  +   EG+  
Sbjct: 176 VVGIGGGYLTGVVLLGINPGVYFDRIDSTVELGDVTGGFVKSLVFALLVAAICCFEGYFT 235

Query: 336 GVHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
                  G K      T+ VV S   +++ D +   F
Sbjct: 236 HTRREGFGAKGVSLATTSAVVLSCITILVADYVLTSF 272


>gi|315122739|ref|YP_004063228.1| ABC transporter [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496141|gb|ADR52740.1| ABC transporter [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 147

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 58/102 (56%), Positives = 76/102 (74%), Gaps = 1/102 (0%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           SENG+ VFR  G+W+S EIS+I+  +++ INKS Q D AIVDL  ITEIDTIG   I+YF
Sbjct: 18  SENGVKVFRLTGSWRSAEISKISKGILITINKSTQEDLAIVDLLEITEIDTIGVATIIYF 77

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFF 103
            EKY GKI+LQG++ H+EQLFS++S     K+K QK Q+ +F
Sbjct: 78  TEKYRGKIQLQGMTAHMEQLFSIMSLNPNNKLK-QKNQKIYF 118


>gi|283852492|ref|ZP_06369760.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
 gi|283572100|gb|EFC20092.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
          Length = 256

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 118/206 (57%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            M ++G   +P++ +IS   G ++A Q A QL + GA  +  +L+    + E+G LLT +
Sbjct: 43  HMAWIGADSLPIISIISACVGIILALQAATQLEKVGALSYVANLVGFSIITELGPLLTCL 102

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGR+G+A  AEI +M+I+EEIDA+  MGLD VR L+ P+  A+ +  PLLT+  +   
Sbjct: 103 ILAGRAGAAFTAEIATMQISEEIDALEVMGLDPVRFLVWPKFLAMCVMAPLLTLWGDAVG 162

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I    +    +  +    +F +     T+ ++  GL+K+     AI IV+  +GF     
Sbjct: 163 ITAGGVFSALFLGLAGKAYFLQTAHFLTMRDLLAGLVKSAGFGVAITIVSCWQGFLAKEG 222

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLF 364
           +  +G++ T  VV+SI ++I++D  F
Sbjct: 223 AADVGRRTTKAVVESIFLMILLDLFF 248


>gi|288817534|ref|YP_003431881.1| ABC transporter permease protein [Hydrogenobacter thermophilus
           TK-6]
 gi|288786933|dbj|BAI68680.1| ABC transporter permease protein [Hydrogenobacter thermophilus
           TK-6]
 gi|308751137|gb|ADO44620.1| protein of unknown function DUF140 [Hydrogenobacter thermophilus
           TK-6]
          Length = 245

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 116/209 (55%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L   I Q+ Y+G   VPVV++ S  +G VIA Q      +F AE     +++I   RE+G
Sbjct: 29  LRHFISQLAYLGAETVPVVVITSIFSGGVIALQTYSTFHRFNAEFLIGAVVAISMGRELG 88

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            +L ++M+  R GSA+ A IG+M+I E+IDA+  MG++ V  L+SPR++A ++ +P+L I
Sbjct: 89  PVLASLMVVARVGSAMTASIGTMRITEQIDALEVMGINPVSYLVSPRVFAGVLGVPMLVI 148

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           LA+ + + G   V  K + +   +F+ +    A   +   GL KA F    I  V+   G
Sbjct: 149 LADIAGVFGGWFVAVKLFGVNEYLFWEKMRDIAEFYDFIGGLYKAVFFGLIISAVSCYFG 208

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           F  G  +  +G+  T  VV S  +++I D
Sbjct: 209 FYTGGGTEGVGRATTNSVVVSSMLILISD 237


>gi|116749843|ref|YP_846530.1| hypothetical protein Sfum_2414 [Syntrophobacter fumaroxidans MPOB]
 gi|116698907|gb|ABK18095.1| protein of unknown function DUF140 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 384

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 103/379 (27%), Positives = 185/379 (48%), Gaps = 42/379 (11%)

Query: 13  GNWKSPEISEIADDV--VMAINKSIQSDSAIVDLSAIT-EIDTIGAELIMYFMEKYHGKI 69
           GNW+      IAD+   V AI +  +SD  I  L+  T E+    + L+ + ++     +
Sbjct: 30  GNWR------IADEPIPVDAIIREFESDPRIRILAFDTGELGEWDSSLLTFLIKVIDTGV 83

Query: 70  KL------QGVSTHIEQLFSLIS-FTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           +        G+   + +L SL S        + Q+ ++ F           +G + +   
Sbjct: 84  RRGLEADRTGLPEGVGRLLSLASAVPEATDARRQEAKQPFLT--------RVGTQAI--- 132

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKF-KGF-------LLSLIRQMYYVGVSGVPVVILI 174
               S A  +G ++   GE   + ++  +G        L++LI+     G   +P+V LI
Sbjct: 133 ----SLAAAVGQMMEFLGEAAIAFFQLVRGRARLRRVDLMTLIQD---CGADALPIVSLI 185

Query: 175 SFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGS 234
           S + G ++A  GA QL  FGA+I+  DL+ +   RE+G ++TAV++AGR+G+A  A++G+
Sbjct: 186 SVLVGLILAFVGAVQLRMFGAQIYVADLVGLGMAREMGAMMTAVIMAGRTGAAFAAQLGT 245

Query: 235 MKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPF 294
           M++NEEIDA++T+G+  +  L+ PR+ AL++ +P L + A+   I+G  IV      +  
Sbjct: 246 MQVNEEIDALQTLGVSPMEFLVLPRMLALVLMMPFLCLYADLMGILGGGIVGVGMLGLSP 305

Query: 295 AVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
             ++        L +   GLIK       I +     G   G  S ++G   T+ VV  I
Sbjct: 306 LEYYHETVQAVGLMDFGAGLIKGAVFGVLIALSGCLRGMQCGRSSAAVGLATTSAVVTGI 365

Query: 355 SIVIIIDSLFAIFYFAIGI 373
             +++ D++  + Y  +GI
Sbjct: 366 VAIVVSDAILTVIYDRLGI 384


>gi|251771480|gb|EES52057.1| putative integral membrane protein [Leptospirillum
           ferrodiazotrophum]
          Length = 253

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 120/212 (56%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
            Q+  +G     VV++ +F TG V+A Q      +F AE     ++++   RE+G ++T+
Sbjct: 42  EQLLRIGADSTLVVVVTAFFTGMVLALQAWIGFRKFNAEGLVGAVVTLSMTRELGPVITS 101

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+ GRSGSA+ AE+GSM+++E+IDA+ T+ +D V  L++PR++A +++LPLLT LA+  
Sbjct: 102 LMVTGRSGSAMAAELGSMRVSEQIDALETLAVDPVDYLVTPRLYASLVALPLLTALADLV 161

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            I G  +V  K   +   ++F        L +  +G++K+ F    + + A + GF    
Sbjct: 162 GIGGGYVVAVKLLGLSPHLYFQEISHYVDLHDFISGIVKSVFFGGLLALWACRTGFVASG 221

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
            +  +G+ VT  VV     ++++D     + F
Sbjct: 222 GAAGVGRAVTFAVVSGSMSILVVDYFLTAWLF 253


>gi|78222485|ref|YP_384232.1| hypothetical protein Gmet_1271 [Geobacter metallireducens GS-15]
 gi|78193740|gb|ABB31507.1| protein of unknown function DUF140 [Geobacter metallireducens
           GS-15]
          Length = 255

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/254 (29%), Positives = 139/254 (54%), Gaps = 15/254 (5%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF---LLSLIRQMYYVGVSGVP 169
            +GK+++ F N+   +  +L          C + + F+     +LS+  QM  +G   +P
Sbjct: 4   RVGKRVIAF-NEIVGEMVML---------LCQTVWFFREAPRNILSIFTQMSIIGYETLP 53

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           +  +++F  G V+A Q   +L ++G +     ++ +  +RE+G ++T+ ++AGR+GSA+ 
Sbjct: 54  MASVMAFFVGMVLALQTGAELQKYGTQNIIGGIVGLSMVRELGPVMTSFLVAGRAGSAMA 113

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV--IW 287
           AEIG MK+ EEIDA++T+ ++ VR L  PR+ A +I +P L I A+F  I+G +++  + 
Sbjct: 114 AEIGVMKVYEEIDALKTLDINPVRYLAMPRLIACLICVPALVIYADFVGILGGALLSHLH 173

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
               I ++ ++   ++   L  I  GL+KA    C IG+V+   GF     +  + +  T
Sbjct: 174 PKIFISYSTYYDSLNTALKLKEIGAGLLKATVFGCIIGVVSCYTGFKTTGGARGIAQSTT 233

Query: 348 TCVVQSISIVIIID 361
             VV S  +++  D
Sbjct: 234 RAVVLSFMLILAAD 247


>gi|83594240|ref|YP_427992.1| hypothetical protein Rru_A2908 [Rhodospirillum rubrum ATCC 11170]
 gi|83577154|gb|ABC23705.1| Protein of unknown function DUF140 [Rhodospirillum rubrum ATCC
           11170]
          Length = 275

 Score =  121 bits (303), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/221 (34%), Positives = 131/221 (59%), Gaps = 3/221 (1%)

Query: 148 KFKG---FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMS 204
           +F+G    L +++ Q   +G+  +P+V++++F  G ++A QG + L  FGAE   +  ++
Sbjct: 50  RFRGQPVRLGAIVEQAMEMGIRALPIVLVMNFTIGMMLAIQGIYSLRMFGAEQQVVLGVA 109

Query: 205 ILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALI 264
              +RE   L+T +++AGRSGSAI A +G+M IN+EIDA+  MG+  VR L++P + A +
Sbjct: 110 FSVVREFAPLITGILVAGRSGSAIAARLGTMTINQEIDALTVMGIVPVRYLVAPPLIAAL 169

Query: 265 ISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAI 324
           + +PL+T L    A++GAS+ +     +  + FF +      L ++  GL K+   A  I
Sbjct: 170 VMVPLMTFLGMLVALLGASLTVRIDLGMSLSAFFHQTLDILRLIDLTHGLGKSALFALQI 229

Query: 325 GIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +V +  G +V   +  +GK  T  VVQ+IS +I+ D +FA
Sbjct: 230 VLVGVVNGVSVSGGAEGVGKMTTRSVVQAISAIIVTDMVFA 270


>gi|320107063|ref|YP_004182653.1| hypothetical protein AciPR4_1853 [Terriglobus saanensis SP1PR4]
 gi|319925584|gb|ADV82659.1| protein of unknown function DUF140 [Terriglobus saanensis SP1PR4]
          Length = 259

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 75/215 (34%), Positives = 119/215 (55%), Gaps = 2/215 (0%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           QM  +G   +P+VIL  F TG V+A Q A  L QFGA   +  L+++  ++E+G +LT +
Sbjct: 44  QMDSIGFGSLPIVILAGFFTGCVLALQSATALQQFGAVSKTGSLVALSMVKELGPVLTGL 103

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           M++GR+ S I +E+GSM++ E+IDA+R +G D VR L+ PRI A +I L  L+IL+    
Sbjct: 104 MVSGRNASGIASELGSMRVTEQIDAMRALGTDPVRKLVLPRIAATVIMLAFLSILSAAMG 163

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I G ++V      +  + +F   +++    ++  GL+K  F    I  V    G      
Sbjct: 164 IAGGALVSVALLGLNSSAYFHSSYASLVYGDVVQGLVKPVFFGFIIASVGCYFGMTTKGG 223

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           +  +GK  T  VV S   +I++D  F +    IGI
Sbjct: 224 TQGVGKSTTQAVVISSVCIIVVD--FLLTRLMIGI 256


>gi|296532685|ref|ZP_06895378.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Roseomonas cervicalis ATCC 49957]
 gi|296266987|gb|EFH12919.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Roseomonas cervicalis ATCC 49957]
          Length = 278

 Score =  120 bits (301), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/259 (30%), Positives = 140/259 (54%), Gaps = 3/259 (1%)

Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           IG   V  + D  +    LG  +  T        + +  +  L+R +   G+   P+ +L
Sbjct: 22  IGAWAVAVLRDVRAATGFLGEAVVMTLSLLPRPRRLR--VGDLLRHLDEAGLRAFPLTLL 79

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
           +  + G ++A Q +  + Q+GAEI+   L+ I  LRE+G L+ A+++AGR+GSA  AE+G
Sbjct: 80  LGLLIGVILAFQSSIPMRQYGAEIYIPSLVGISLLRELGPLIAAIILAGRTGSAFAAELG 139

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           +M +NEE+DA+R MG+D + +L+ PR+ A ++ +P+LT+L N S +IG   V+      P
Sbjct: 140 TMTVNEEVDALRIMGIDPMVMLVLPRLIAAMLVMPVLTLLMNLSGLIGMGTVM-GALGFP 198

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
            A+  ++     TL  +  GL K+      +  +  + G + G    ++G   T  VV  
Sbjct: 199 AALVINQLSYWLTLGTLLGGLGKSVVFGLVVAGIGCRAGLSAGRGPRAVGDAATAAVVGG 258

Query: 354 ISIVIIIDSLFAIFYFAIG 372
           I   +++D LFA+ ++ +G
Sbjct: 259 IVSTVVLDGLFAVLFYRLG 277


>gi|308272145|emb|CBX28752.1| UPF0393 membrane protein RBE_1340 [uncultured Desulfobacterium sp.]
          Length = 288

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 121/211 (57%), Gaps = 5/211 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q++++G   V V+ L    TG V+  QG   L +FG+  F   ++++  +RE+G +L
Sbjct: 70  ILQQIHFIGSKSVFVICLTGAFTGMVLGLQGYHTLVKFGSAGFLGAVVALSLIRELGPVL 129

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A+M+ GR+GSAI AE+G M+I+EEIDA+ TM ++ +R L+SP++ A +IS+PLLT L +
Sbjct: 130 AAIMVTGRAGSAIAAEVGIMRISEEIDALDTMDINPLRFLVSPKLAAALISMPLLTALFD 189

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              IIG  I       I   ++FSR  ++  +A++  G IK+   A  I  V   +G+  
Sbjct: 190 VVGIIGGYISGSLLLGISGGIYFSRIETSVEMADVTGGFIKSLVFAAVIVTVCCFQGYYT 249

Query: 336 GVHSNSLGKK-----VTTCVVQSISIVIIID 361
                  G K      T+ VV S   ++I D
Sbjct: 250 HTRKEGFGAKGVSLSTTSAVVISCVTILITD 280


>gi|149200416|ref|ZP_01877432.1| ABC-type transport system, permease component [Lentisphaera
           araneosa HTCC2155]
 gi|149136485|gb|EDM24922.1| ABC-type transport system, permease component [Lentisphaera
           araneosa HTCC2155]
          Length = 265

 Score =  120 bits (300), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 78/261 (29%), Positives = 134/261 (51%), Gaps = 2/261 (0%)

Query: 108 KNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG 167
           KNL    G+  V F  +S +    +G V         + +K K    S +  M   G   
Sbjct: 2   KNLVSSFGRNFVGFFQESKNILAFIGEVTEELIFGIRNPHKIK--WKSTLYYMDGCGREA 59

Query: 168 VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSA 227
             +V LI F+ G ++  Q A Q+ QFG +I+  +L+ +  ++E+G L+ A++  GR+GSA
Sbjct: 60  TGIVALICFLMGLILGFQSAVQMKQFGTDIYVANLVGLSIVKELGPLMVAMIATGRAGSA 119

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
             AE+G+M++NEEIDA+ TMG    R LI P++ A+++ +P+LT++ +   I+G   V  
Sbjct: 120 FAAELGTMRVNEEIDALTTMGFVPPRFLIIPKLIAMMVVMPILTLIGDLLGILGGFFVGV 179

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
               +PF  + ++        ++   + KA   A  I +V    G      +  +GK  T
Sbjct: 180 VQLKLPFIAYLNQTIKAIHYLDVMESMAKAFAFAIIISMVGCYRGMNSSSDAQGVGKAAT 239

Query: 348 TCVVQSISIVIIIDSLFAIFY 368
           + VV  I ++I+ D+L  I +
Sbjct: 240 SSVVSGIFLIIVADTLMTIIF 260


>gi|170691590|ref|ZP_02882755.1| protein of unknown function DUF140 [Burkholderia graminis C4D1M]
 gi|170143795|gb|EDT11958.1| protein of unknown function DUF140 [Burkholderia graminis C4D1M]
          Length = 389

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/215 (35%), Positives = 127/215 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y  G   +P+  L++F+ G V++   A QL  FGA  + ++++ +  +RE+G +L+A+
Sbjct: 174 NIYNAGTKALPITALVAFLIGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAI 233

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     LI PR+ AL +++PLL +  +  A
Sbjct: 234 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGLRLILPRVIALGVAMPLLVMWTDIIA 293

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G ++       I  + F         +AN++ GL K       I I     GF +  +
Sbjct: 294 LTGGAVAAKIVLGIDMSYFARALPGVVPVANLWIGLGKGVAFGMLIAIAGCHFGFRIKAN 353

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           S SLG+  TT VV SI+IVI+ D++FAI +  +G+
Sbjct: 354 SQSLGEGTTTSVVTSITIVILADAVFAILFQNVGL 388


>gi|189426230|ref|YP_001953407.1| hypothetical protein Glov_3181 [Geobacter lovleyi SZ]
 gi|189422489|gb|ACD96887.1| protein of unknown function DUF140 [Geobacter lovleyi SZ]
          Length = 261

 Score =  119 bits (299), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 130/230 (56%), Gaps = 4/230 (1%)

Query: 136 ISNTGEFCA----SSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           + N G+F      S  +  G  + +++Q+ ++G   + V++L +  TG V+  QG + L+
Sbjct: 24  LGNCGQFLVYALYSILRRPGRPVHILKQVSFIGAKSLFVIVLTAAFTGMVLGLQGYYTLT 83

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           +FG+E      +++  +RE+G +L+A+M+ GR+GSAI AEIG M+I+E+IDA+ TM LD 
Sbjct: 84  KFGSEGMLGTAVALSLIRELGPVLSALMVTGRAGSAITAEIGIMRISEQIDALETMALDP 143

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
            + LISP+  A +IS+PLL  + +   I G  +V  K   +    +FS  + +    +++
Sbjct: 144 YKYLISPKFIAAMISMPLLCAIFDVVGIYGGWMVGVKLLGVNPGAYFSEMYKSVEWKDVY 203

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           +G +K+      I  +   +G+  G  +  + +  T  VV +  ++++ D
Sbjct: 204 SGFVKSYSFGIIIAWIGCYKGYYAGHGAEGVSRATTESVVLTSVLILVWD 253


>gi|281356267|ref|ZP_06242760.1| protein of unknown function DUF140 [Victivallis vadensis ATCC
           BAA-548]
 gi|281317636|gb|EFB01657.1| protein of unknown function DUF140 [Victivallis vadensis ATCC
           BAA-548]
          Length = 272

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 136/272 (50%), Gaps = 26/272 (9%)

Query: 105 NSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ----- 159
            S K L   +    +   +D C               FC  S +     L  IR      
Sbjct: 7   RSLKQLCIEVADSAIALRDDLCL--------------FCTFSRQLGKATLDAIRHPRKIR 52

Query: 160 ---MYY----VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
              +YY     G   +P++ L+ F+ G ++A Q   QL +FG E + ++L+  + + E+ 
Sbjct: 53  RYDVYYYMDNCGSDAMPIIALLGFLIGVILAFQAIVQLRRFGVESYVVNLVGTVIVTELA 112

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            L+TAV++AGR+GS+  AE+G+MK +EEIDA+ TMG D  R L+ P++ AL++ +P LTI
Sbjct: 113 PLVTAVVLAGRTGSSFAAELGTMKADEEIDAMVTMGFDPGRFLLFPKMLALLLIMPGLTI 172

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +++   I G  +++     +    + ++        ++  GL+K+   A  +  +   +G
Sbjct: 173 ISDVCGIAGGMVIVCSMLQVSTGEYLTKTFEIIQPIDLAQGLVKSFVFAVIVAGIGCMKG 232

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
                ++  +G+  T+ VV SI ++++ D++ 
Sbjct: 233 LNAERNAQGVGRSATSAVVTSIFLIVVTDAIL 264


>gi|124516678|gb|EAY58186.1| putative integral membrane protein [Leptospirillum rubarum]
          Length = 255

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 139/256 (54%), Gaps = 7/256 (2%)

Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           +G+K +     S S   ++  V + TG F   ++ +  FL+ L++    VG    PVV++
Sbjct: 7   VGRKCIGLF--SISGDLLITTVTALTGMF-RPAFLWWNFLVQLVK----VGADSTPVVLV 59

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
            +  TG V+A Q      +F AE     ++S+   RE+G ++T +M++GRSGS++ AE+G
Sbjct: 60  TALFTGMVLALQAWIGFQKFNAEGMVGAVVSLSLTRELGPVITGLMVSGRSGSSMAAELG 119

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           +M++ E+IDA+ ++ +  +  L++PR +A +I+LPLLT++A+F  I+G   V      +P
Sbjct: 120 TMRVTEQIDALESLAVSPLVYLVTPRFYAGLIALPLLTVMADFVGIVGGYFVAVNLLGLP 179

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
             V+         L + ++GL+KA      + I +   G+     +  +G+ VT  VV S
Sbjct: 180 SNVYVKGIARYVNLHDFYSGLVKACIFGAVLSIFSCYMGYHARGGAAGVGQSVTKAVVSS 239

Query: 354 ISIVIIIDSLFAIFYF 369
              ++++D     + F
Sbjct: 240 SMAILVLDYFLTAWLF 255


>gi|299136991|ref|ZP_07030174.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX8]
 gi|298601506|gb|EFI57661.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX8]
          Length = 259

 Score =  119 bits (298), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 119/215 (55%), Gaps = 2/215 (0%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           QM  +GV  +P+V+L  F TG V+A Q A  L +FGA   +  L+++  ++E+G +LT +
Sbjct: 44  QMDSIGVGSLPIVVLTGFFTGCVLALQAAVSLKEFGAINMTGKLVALSMVKELGPVLTGL 103

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           M++GR+ S + +E+GSMK+ E+IDA+R +G D +R L++PR+ A +  L  LTI+++   
Sbjct: 104 MVSGRNASGMASELGSMKVTEQIDAMRALGTDPIRKLVTPRLVATVFMLFFLTIISDACG 163

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
             G ++V      +    FF   + +    ++  GL+K  F    I  +    G      
Sbjct: 164 TGGGALVAVVLLRLNGPAFFHTAYMSLVGGDVVEGLVKPLFSGFIIATIGCYYGLRTTGG 223

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           +  +GK  T  VV S  ++I++D  F +    IGI
Sbjct: 224 TQGVGKATTQAVVASSVLIILVD--FLVTQLMIGI 256


>gi|322435258|ref|YP_004217470.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX9]
 gi|321162985|gb|ADW68690.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX9]
          Length = 259

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/205 (33%), Positives = 115/205 (56%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           QM  +GV  +P+V+L  F TG V+A Q A  L QFG+   +  L+++  ++E+G +LT +
Sbjct: 44  QMDSIGVGSLPIVVLTGFFTGCVLALQSATALKQFGSISLTGSLVALSMVKELGPVLTGL 103

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           M++GR+ S + +E+GSM + E+IDA+R +G D +R L++PRI A ++ L  LTIL++   
Sbjct: 104 MVSGRNASGMASELGSMMVTEQIDAMRALGTDPIRKLVTPRIIATVVMLFFLTILSDAVG 163

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I G ++V      +  + +    + +    ++  GL K  F A  I  V    G      
Sbjct: 164 IAGGALVSVTILGLNLSSYLHTSYQSLLYGDVVQGLTKPLFSAFIIATVGCFFGLKTKGG 223

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSL 363
           +  +GK  T  VV S   +I++D L
Sbjct: 224 TQGVGKATTQAVVYSSVFIIVVDFL 248


>gi|120602860|ref|YP_967260.1| hypothetical protein Dvul_1816 [Desulfovibrio vulgaris DP4]
 gi|120563089|gb|ABM28833.1| protein of unknown function DUF140 [Desulfovibrio vulgaris DP4]
          Length = 267

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 125/220 (56%), Gaps = 5/220 (2%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L  ++ Q+Y +G   + V++LI   TG V+  QG + L +FG+E      +++  +RE+G
Sbjct: 46  LPKIVNQVYVIGYKSLFVILLIGIFTGMVLGLQGYYTLVKFGSEGLLGAAVALTLIRELG 105

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            +LTA+M+ GR+GS++ AEIG M+I ++IDA+  M ++ +  L+SPRI A +++ PLLT 
Sbjct: 106 PVLTAIMVTGRAGSSMAAEIGVMRITDQIDALDVMDINPMGYLVSPRIAASLVAFPLLTA 165

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           L +   IIG  +       I   V+F R  ++  LA++  G +K+   A  +  V+  +G
Sbjct: 166 LFDVIGIIGGYVTGVMLLGINEGVYFHRIATSVELADVTGGFMKSLLFALIVSTVSCYQG 225

Query: 333 FAVGVHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
           +   +  + +G +      T+ VV S  +V++ D +   F
Sbjct: 226 YFTHMRRDGMGPEGVSNSTTSAVVMSCVLVLVADYVLTSF 265


>gi|196231158|ref|ZP_03130018.1| protein of unknown function DUF140 [Chthoniobacter flavus Ellin428]
 gi|196224988|gb|EDY19498.1| protein of unknown function DUF140 [Chthoniobacter flavus Ellin428]
          Length = 264

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 119/214 (55%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
            Q    GV  VP+V L+SF  G  +A      L+ +G E      ++I   RE+G L+T 
Sbjct: 48  EQADRTGVGSVPLVALVSFFLGLTMALLTGHVLAPYGQETLVPAAVAIGFTRELGPLITG 107

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+A R G+A  AE+G+M + EE++AI  MGL  +R+L+SPR+ A  + +P L++++N  
Sbjct: 108 IMVAARVGAAFTAELGTMVVAEEVEAIEAMGLGPLRLLVSPRVLAAFLLMPCLSVVSNMM 167

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           A+ G +++    +DIP   F+        + +I  G++K+      IG++A  +G  V  
Sbjct: 168 ALSGGALISRWAFDIPMQGFWQSSLENLFIRDIVAGVLKSFLFGLLIGLIACYKGLTVRG 227

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            +  +G   T+ VV +I+ VI  D++F I   A+
Sbjct: 228 GAAGVGTATTSSVVTAITTVIGFDTVFNIVLVAL 261


>gi|148263112|ref|YP_001229818.1| hypothetical protein Gura_1039 [Geobacter uraniireducens Rf4]
 gi|146396612|gb|ABQ25245.1| protein of unknown function DUF140 [Geobacter uraniireducens Rf4]
          Length = 256

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 118/206 (57%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q+ ++G     V+ L +  TG V+  QG + L++FG+E      +++  +RE+G +L
Sbjct: 43  ILKQIRFIGAKSFFVIFLTASFTGMVLGLQGYYTLAKFGSEGMLGSAVALSLIRELGPVL 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GSAI AEIG M+I E+IDA+ TM L+  + L+SP++ A IISLPLL  + +
Sbjct: 103 TALMVTGRAGSAISAEIGIMRITEQIDALETMALEPCKYLVSPKLLAAIISLPLLCAIFD 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G  +V  K   +    +F     +    ++++G+IK+      I  +   +G+  
Sbjct: 163 VVGIYGGYLVGVKLLGVNPGAYFHEMEKSVEWKDVYSGIIKSVSFGVIIAWICCYKGYFA 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
           G  +  + +  T  VV S  +V+I D
Sbjct: 223 GHGAEGVSRATTAAVVMSSVMVLIWD 248


>gi|46579657|ref|YP_010465.1| hypothetical protein DVU1246 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449072|gb|AAS95724.1| membrane protein, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233455|gb|ADP86309.1| protein of unknown function DUF140 [Desulfovibrio vulgaris RCH1]
          Length = 267

 Score =  118 bits (296), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 70/220 (31%), Positives = 125/220 (56%), Gaps = 5/220 (2%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L  ++ Q+Y +G   + V++LI   TG V+  QG + L +FG+E      +++  +RE+G
Sbjct: 46  LPKIVNQVYVIGYKSLFVILLIGIFTGMVLGLQGYYTLVKFGSEGLLGAAVALTLIRELG 105

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            +LTA+M+ GR+GS++ AEIG M+I ++IDA+  M ++ +  L+SPRI A +++ PLLT 
Sbjct: 106 PVLTAIMVTGRAGSSMAAEIGVMRITDQIDALDVMDINPMGYLVSPRIAASLVAFPLLTA 165

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           L +   IIG  +       I   V+F R  ++  LA++  G +K+   A  +  V+  +G
Sbjct: 166 LFDVIGIIGGYVTGVMLLGINEGVYFHRIATSVELADVTGGFMKSLLFALIVSTVSCYQG 225

Query: 333 FAVGVHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
           +   +  + +G +      T+ VV S  +V++ D +   F
Sbjct: 226 YFTHMRRDGMGPEGVSNSTTSAVVMSCVLVLVADYVLTSF 265


>gi|303246386|ref|ZP_07332665.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
 gi|302492096|gb|EFL51971.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
          Length = 268

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 111/190 (58%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q+Y++GV  + V++LI   TG V+  QG + L +FG+E      +++  +RE+G +L
Sbjct: 50  IVQQVYFIGVKSIFVIVLIGLFTGMVLGLQGYYTLVKFGSEGLLGAAVALSIIRELGPVL 109

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GS+I AEIG M+I+E+IDA+ TMG++ +R LI+PR+ A +I  PLLT + +
Sbjct: 110 TAIMLTGRAGSSIAAEIGIMRISEQIDALTTMGINPMRFLIAPRLAASLICFPLLTAIFD 169

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G  +       I   V+F R  +   LA++  G  K+   A  +  +   EG+  
Sbjct: 170 VVGIGGGYLTGVVLLGINPGVYFDRIDAAVELADVTGGFEKSIVFALLVAAICCYEGYFT 229

Query: 336 GVHSNSLGKK 345
                  G K
Sbjct: 230 HTRREGFGAK 239


>gi|15605864|ref|NP_213241.1| hypothetical protein aq_355 [Aquifex aeolicus VF5]
 gi|2983037|gb|AAC06647.1| hypothetical protein aq_355 [Aquifex aeolicus VF5]
          Length = 245

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/205 (34%), Positives = 112/205 (54%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I Q+ YV     PVV++ S  TG VIA Q      +F AE     +++I   RE+G +LT
Sbjct: 33  ISQLTYVAAETTPVVLVTSLFTGGVIALQTYSTFHRFNAEYLIGAVVAISMGRELGPVLT 92

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           ++M+  R GSA+ A IG+M+I ++IDA+  M ++ +  L++PRI+A    +PLLT+L++ 
Sbjct: 93  SLMVVARVGSAMTASIGTMRITQQIDALEVMAINPISFLVTPRIFATTFGVPLLTVLSDV 152

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           + I G   V  K + +   +++ +        +I  GL KA F    IG V+   GF   
Sbjct: 153 AGIFGGWFVATKLFGVNEYLYWQKMVDLTEFHDIVGGLYKATFFGFIIGAVSCYYGFYTK 212

Query: 337 VHSNSLGKKVTTCVVQSISIVIIID 361
             +  +GK  T  VV S  +++I D
Sbjct: 213 GGTAGVGKATTNSVVTSSMLILISD 237


>gi|206603562|gb|EDZ40042.1| Putative integral membrane protein [Leptospirillum sp. Group II
           '5-way CG']
          Length = 255

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/211 (30%), Positives = 118/211 (55%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           Q+  VG    PVV++ +  TG V+A Q      +F AE     ++S+   RE+G ++T +
Sbjct: 45  QLVKVGADSTPVVLVTALFTGMVLALQAWIGFQKFNAEGMVGAVVSLSLTRELGPVITGL 104

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           M++GRSGS++ AE+G+M++ E+IDA+ ++ +  +  L++PR +A +I+LPLLT++A+F  
Sbjct: 105 MVSGRSGSSMAAELGTMRVTEQIDALESLAVSPLVYLVTPRFYAGLIALPLLTVMADFVG 164

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I+G   V      +P  V+         L + ++GL+KA      + I +   G+     
Sbjct: 165 IVGGYFVAVNLLGLPSNVYVKGIARYVNLHDFYSGLVKACIFGAVLSIFSCYMGYHARGG 224

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           +  +G+ VT  VV S   ++++D     + F
Sbjct: 225 AAGVGQSVTKAVVSSSMAILVLDYFLTAWLF 255


>gi|116749878|ref|YP_846565.1| hypothetical protein Sfum_2450 [Syntrophobacter fumaroxidans MPOB]
 gi|116698942|gb|ABK18130.1| protein of unknown function DUF140 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 266

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/212 (35%), Positives = 115/212 (54%), Gaps = 1/212 (0%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
           QM  VGV  +P+V L+SFV G ++  Q A+QL +FGA  ++  L  +   RE+  LLTA+
Sbjct: 53  QMDEVGVKSIPIVALVSFVIGIILVLQTAYQLEKFGAINYAASLAGVALTREMAPLLTAI 112

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGR  +A  AE+G+M + EEI A+  M ++ V  L+ PR  A+++ LP LT+LA+   
Sbjct: 113 VVAGRVSAAFTAELGTMLVTEEILALEVMAINPVAYLVVPRFIAMLVMLPCLTVLADLIG 172

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           +IG   V      I  +++         L +I TGL K+   A  I +V     F V   
Sbjct: 173 MIGGYAVGTTAVGIRSSLYIQNTIDALLLKDILTGLTKSVVFAGIIAMVGCYMAFVVRGG 232

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLF-AIFYF 369
           +  +GK     VV S+  +I+ D  F  +FY 
Sbjct: 233 AEGVGKATMISVVTSLISIILADCFFTTVFYL 264


>gi|87311113|ref|ZP_01093237.1| probable permease of ABC transporter [Blastopirellula marina DSM
           3645]
 gi|87286204|gb|EAQ78114.1| probable permease of ABC transporter [Blastopirellula marina DSM
           3645]
          Length = 280

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 108/207 (52%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           +L+   Y VGV  +PVV L     G V+A Q  FQ  Q G E     ++++  +RE+G +
Sbjct: 49  TLVPNFYQVGVMSLPVVALTGTFIGMVLAVQSYFQFRQLGLETRLGAVINMTLVRELGPV 108

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           L A M+AGR GSA+ AE+G+M++ E+IDA+ +MG + +  L+ PR  A +I +P LT++A
Sbjct: 109 LAATMLAGRVGSAMAAELGTMRVTEQIDALDSMGTNPIHYLVVPRFLACVILIPALTVMA 168

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           +F   +G          I    +           +IF GLIK+ F    I IV+   GF 
Sbjct: 169 DFMGFVGGYFYSVNILGIDQHYYMYNSEQFVQSWDIFYGLIKSVFFGGTIAIVSCHRGFH 228

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               +  +G+  T   V S   ++ ID
Sbjct: 229 CEAGAEGVGRAATAAFVYSFVFILAID 255


>gi|78355070|ref|YP_386519.1| transporter [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78217475|gb|ABB36824.1| transporter, putative [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 250

 Score =  117 bits (294), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 126/214 (58%), Gaps = 1/214 (0%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
            Q+   G   + +V +I+  TG ++A Q A QL + GA  +  +++S+  ++E+G LLTA
Sbjct: 36  HQLAETGTRSLGIVSVIAACTGMILALQAAQQLEKVGALSYVANMVSVTIVKELGPLLTA 95

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +++AGRSG+A  AEI +M+I EEIDA+  +G+  VR L+ P++ A++I LP+LT+ A+  
Sbjct: 96  IILAGRSGAAFCAEISTMQIYEEIDALEVIGISPVRYLVVPKLCAMLIMLPVLTLWADLV 155

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            II   +       + F+ + ++        ++ + ++KA     AI ++   +GF    
Sbjct: 156 GIISGGLFAALGLGLSFSGYLNQAVYFLGTGDVVSSVVKAAGFGTAITLICCWQGFMAQG 215

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLF-AIFYFA 370
            +  +G++ T  VVQSI +VI++D  F AI Y A
Sbjct: 216 GAADVGRRTTKAVVQSIFMVILLDLFFTAINYLA 249


>gi|303246825|ref|ZP_07333102.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
 gi|302491842|gb|EFL51722.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
          Length = 254

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 117/206 (56%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            M ++G   +P++ +IS   G ++A Q A QL + GA  +  +L+    + E+G LLT +
Sbjct: 41  HMAWIGADSLPIISIISACVGIILALQSATQLEKVGAMSYVANLVGYSIITELGPLLTCL 100

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGR+G+A  AEI +M+I+EEIDA+  MG+D VR L+ P+  A+ +  PLLT+  +   
Sbjct: 101 ILAGRAGAAFTAEIATMRISEEIDALEVMGVDPVRFLVWPKFAAMCVMAPLLTLWGDCIG 160

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           I    I       +    +F +     T+ ++ +GL+K+      I I++  +GF     
Sbjct: 161 ISAGGIFSALALGLSGKAYFLQTAGFLTMRDLLSGLVKSAGFGVTITIISCWQGFLAREG 220

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLF 364
           +  +G++ T  VVQSI ++I++D  F
Sbjct: 221 AADVGRRTTRAVVQSIFLMILLDLFF 246


>gi|53802513|ref|YP_112711.1| ABC transporter permease [Methylococcus capsulatus str. Bath]
 gi|53756274|gb|AAU90565.1| putative ABC transporter, permease protein [Methylococcus
           capsulatus str. Bath]
          Length = 406

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 130/214 (60%)

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           ++  G   + +  L+ F+ G V++   + QL  FGA+++ ++++ +  +RE+G LL A++
Sbjct: 192 IHETGGRALGITALVGFLIGVVVSYLSSLQLKTFGAQVYIVNILGMSIIRELGPLLAAIL 251

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           +AGRSGS++ A IG M++ +E+DA+  MG+     LI P++ AL+++LPLL +  +  A+
Sbjct: 252 VAGRSGSSMTARIGVMRVTQELDALAAMGISQSLRLILPKVVALVVALPLLVVWTDVVAL 311

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
            G ++      +I +  FF +  S   +AN   GL KA      + ++A   G  +  ++
Sbjct: 312 AGGAVSAHLELEIGYHQFFQKLPSAVPVANFAIGLGKAAVFGLFVALIACHYGLRIAPNT 371

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            SLG + T  VV SI++VI++D++FAI + ++GI
Sbjct: 372 ESLGNETTNSVVVSITLVILVDAVFAILFRSVGI 405


>gi|207727753|ref|YP_002256147.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum MolK2]
 gi|206590994|emb|CAQ56606.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum MolK2]
          Length = 374

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 104/373 (27%), Positives = 185/373 (49%), Gaps = 16/373 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITE---IDTIGAELIMY 60
           +G +V   +G+W +  ++E A   V +  + I++     +   +TE   ID  GA+L+  
Sbjct: 15  DGRSVAYLSGDWTTLALAERAG--VRSARRQIRAGLDNANAWCLTEVGRIDHFGAQLLW- 71

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +  G    + +    +Q   +I    R      K + +   N    L    G  ++ 
Sbjct: 72  ---RAWGNRWPEHLDARADQR-RMIDRVARLDPGGWKKRIAPRINPVTVL----GGAMLD 123

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F         ++G ++ +   F  + ++  G    +   +Y  G   + +  L+ F+ G 
Sbjct: 124 FAGHLRIGVAMVGQLMFDLLRFARAPHR--GPWREISANIYSTGYKALGITALVGFLIGI 181

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V++   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE
Sbjct: 182 VLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEE 241

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F + 
Sbjct: 242 LDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITS 301

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI++VI+ 
Sbjct: 302 LPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITVVILA 361

Query: 361 DSLFAIFYFAIGI 373
           D++FAI +  +GI
Sbjct: 362 DAVFAILFKDVGI 374


>gi|223940418|ref|ZP_03632271.1| protein of unknown function DUF140 [bacterium Ellin514]
 gi|223890913|gb|EEF57421.1| protein of unknown function DUF140 [bacterium Ellin514]
          Length = 259

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 125/233 (53%), Gaps = 1/233 (0%)

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           LG +   T E  +S +  KG   + I Q+Y++GV    VV++    TG V+  Q  +Q  
Sbjct: 16  LGRISLLTKEALSSLFSLKGSWGNFIYQLYFIGVKSQSVVLITGAFTGMVLCAQTYYQFH 75

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           Q   +  ++ ++S+    E+G +LTA+M+AGR G+A+ AEIG+MK+ E++DA+RT+    
Sbjct: 76  QVKLDTATLAVVSVSMCSELGPVLTALMVAGRVGAAMAAEIGTMKVTEQVDALRTLATHP 135

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           V  L+ PR+ A ++SLPLLT  A    II   +V      I     ++        +++ 
Sbjct: 136 VDYLVVPRLTASVVSLPLLTAEAIAVGIISGYMVGVYLLGIDPVYSYTNMLKYTNSSDVM 195

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           TG+IK+      I I+   +G   G  +  +G+  T  VV + SI I+I + F
Sbjct: 196 TGIIKSVIFGVIIAIIGCYKGMTCGEGAEGVGRATTEAVVYA-SITILISNFF 247


>gi|222109464|ref|YP_002551728.1| hypothetical protein Dtpsy_0244 [Acidovorax ebreus TPSY]
 gi|221728908|gb|ACM31728.1| protein of unknown function DUF140 [Acidovorax ebreus TPSY]
          Length = 372

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 127/214 (59%)

Query: 159 QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAV 218
            +Y +G + +P+  L+ F+ G V+A   + QL QFGAE F ++++ I  +RE+G +L A+
Sbjct: 158 HLYRMGATALPITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAI 217

Query: 219 MIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSA 278
           ++AGRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL +++PL+ +    +A
Sbjct: 218 LVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRALALALAMPLVALWTTLAA 277

Query: 279 IIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVH 338
           + G  +       I  A F     +   ++N++  + K+      I ++    G  V  +
Sbjct: 278 LAGGMLAADLTMGISSAYFAQALPAAVNVSNLWLAMSKSVVFGVFIALIGCHWGLRVKPN 337

Query: 339 SNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           + SLG+  T  VV +I++VII+D+LFA+ +  +G
Sbjct: 338 TQSLGEGTTASVVSAITMVIIVDALFAVAFKNVG 371


>gi|67458472|ref|YP_246096.1| ABC transporter permease protein [Rickettsia felis URRWXCal2]
 gi|75537058|sp|Q4UNC7|Y080_RICFE RecName: Full=Probable ABC transporter permease protein RF_0080
 gi|67004005|gb|AAY60931.1| ABC transporter permease protein [Rickettsia felis URRWXCal2]
          Length = 259

 Score =  116 bits (291), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 145/267 (54%), Gaps = 15/267 (5%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG--FLLSLIRQMYYVGVS 166
           N+   +GK+ +KF     S +            F A S   +   +L  +IRQ+ ++G  
Sbjct: 4   NIANSVGKRTIKFAQSVGSFSLF---------SFAAVSSIIRPPLYLSLIIRQLLFIGFH 54

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMIAGRSG 225
            +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +L  +M+AGR G
Sbjct: 55  SLPVVAMTTFFSGAVLALQSYTGFSRFSAE-SSIATVVVLSLTRELGPVLAGLMVAGRVG 113

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           ++I AEI +M++ E++DA+ T+  D ++ L+ PR+ A II++P L ++ +   ++G  +V
Sbjct: 114 ASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVIAAIITMPCLVLIGDIIGVMGGYLV 173

Query: 286 -IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
            ++K      A   S FH    + ++ +GL+KA      I I++   G+  G  +  +G+
Sbjct: 174 GVYKLDFNSTAYLTSTFHYLEPI-DVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGR 232

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYFAI 371
             T+ VV S  +++I + L    +F +
Sbjct: 233 ATTSAVVNSSILILISNYLITELFFKV 259


>gi|315125511|ref|YP_004067514.1| ABC transporter membrane protein [Pseudoalteromonas sp. SM9913]
 gi|315014024|gb|ADT67362.1| ABC transporter membrane protein [Pseudoalteromonas sp. SM9913]
          Length = 259

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 1/199 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VG   + ++++     G V+A QG   L  +GAE     L+++  LRE+G ++
Sbjct: 43  LVRQLYMVGSQSLLIIVVSGLFIGMVLALQGYTVLVDYGAEDSLGPLVALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L ++ +
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLRRIIAPRFWAGLISMPMLALIFS 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
             AIIGA +V   +  +    F+S   S  +   +I  GLIK+   A  +  +A+ +G+ 
Sbjct: 163 AVAIIGAHLVGVDWLGVDTGSFWSIMQSQVSFEKDILNGLIKSIVFAIVVTWIALYKGYD 222

Query: 335 VGVHSNSLGKKVTTCVVQS 353
               S  + K  T  VV S
Sbjct: 223 CVPTSEGISKATTETVVHS 241


>gi|121592684|ref|YP_984580.1| hypothetical protein Ajs_0250 [Acidovorax sp. JS42]
 gi|120604764|gb|ABM40504.1| protein of unknown function DUF140 [Acidovorax sp. JS42]
          Length = 372

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 74/223 (33%), Positives = 130/223 (58%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           +G    +   +Y +G + +P+  L+ F+ G V+A   + QL QFGAE F ++++ I  +R
Sbjct: 149 RGPWRDISGHLYRMGATALPITALVGFLIGVVLAYLMSLQLRQFGAEAFIVNILGISLIR 208

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G +L A+++AGRSGSAI A+IG M++ EE+DA+R MG+     L+ PR  AL +++PL
Sbjct: 209 ELGPMLGAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRALALALAMPL 268

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAM 329
           + +    +A+ G  +       I  A F     +   ++N++  + K+      I ++  
Sbjct: 269 VALWTTLAALAGGMLAADLTMGISSAYFAQALPAAVNVSNLWLAMSKSVVFGVFIALIGC 328

Query: 330 KEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             G  V  ++ SLG+  T  VV +I++VII+D+LFA+ +  +G
Sbjct: 329 HWGLRVKPNTQSLGEGTTASVVSAITMVIIVDALFAVAFKNVG 371


>gi|302341646|ref|YP_003806175.1| hypothetical protein Deba_0204 [Desulfarculus baarsii DSM 2075]
 gi|301638259|gb|ADK83581.1| protein of unknown function DUF140 [Desulfarculus baarsii DSM 2075]
          Length = 244

 Score =  116 bits (291), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 120/214 (56%), Gaps = 1/214 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++QM +VG   + VV+L    TG V A Q  +  S FGAE      +++   RE+G +L
Sbjct: 31  VLKQMEFVGNKSINVVMLTGAFTGGVFALQSYYGFSLFGAESLVGSTVALALTRELGPVL 90

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           T++M+ GR+GSA+ AEIG+M++ E+IDA+  M ++ V+ L+ PR+ A +I LP LTI+AN
Sbjct: 91  TSLMVTGRAGSAMAAEIGTMRVTEQIDALYVMAVNPVQYLVLPRVLAAVIMLPALTIVAN 150

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  I+G   V      I   VF ++        +I  GL+K+      + ++   +GF  
Sbjct: 151 FIGILGGYAVGVGMLGINEGVFVAKIIEYVEFDDIGMGLVKSAIFGLILSLIGCYKGFYT 210

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID-SLFAIFY 368
              +  +G+  T  VV +  +++  D +L AI +
Sbjct: 211 SGGAEGVGRATTEAVVLASVLILAADYALTAIMF 244


>gi|328954039|ref|YP_004371373.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454363|gb|AEB10192.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 377

 Score =  116 bits (290), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 99/369 (26%), Positives = 178/369 (48%), Gaps = 20/369 (5%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM---YFMEKYHGK 68
           +G+W        AD V   +  S+   + + D   +   DT     +M    F  + +  
Sbjct: 22  SGDWLLGGELPAADRVQQRLEGSLGVRNLVFDTRELAHWDTGLLTFLMSLATFCSQQNIY 81

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQR----SFFYNSFKNLHYHIGKKIVKFIND 124
           +   G+    ++L  L S    KK  ++  +R    +F  N   N     G+ +++FI D
Sbjct: 82  LDRDGLPPGAKRLLELASAVPEKKDAHKVEERLSFLAFLGNETVNFFQSAGE-LLEFIGD 140

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           +     +L L+            +++   L LI  M  VGV  +P+V LI F+ G ++A 
Sbjct: 141 AV--IAVLRLIRGQA--------QYRRADLGLI--MQAVGVQALPIVSLICFLVGLILAF 188

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            GA QL  FGA+I+  DL+ I  +R +  ++T +++AGR+G A  A++G+M++N+EIDA+
Sbjct: 189 IGAIQLKLFGAQIYVADLVGIAMVRLMAAIMTGIVMAGRTGGAFAAQLGTMQVNQEIDAL 248

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +T+G+  +  L+ PR+ AL + +PLL + AN   I+G   V      I F  ++++  + 
Sbjct: 249 KTLGISPMEFLVLPRMLALALMMPLLCLYANVMGILGGMAVGVGMLGIGFIQYYNQTAAA 308

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L N+  GL         + +     G   G  ++++G   T+ VV +I  +I+  +  
Sbjct: 309 VGLWNLGIGLFSGTVFGVIVALAGCMRGMQCGRSASAVGDAATSAVVTAIVGIIVSTAAI 368

Query: 365 AIFYFAIGI 373
            I    +GI
Sbjct: 369 TILCNFLGI 377


>gi|187734672|ref|YP_001876784.1| protein of unknown function DUF140 [Akkermansia muciniphila ATCC
           BAA-835]
 gi|187424724|gb|ACD04003.1| protein of unknown function DUF140 [Akkermansia muciniphila ATCC
           BAA-835]
          Length = 266

 Score =  116 bits (290), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/272 (30%), Positives = 144/272 (52%), Gaps = 19/272 (6%)

Query: 110 LHYH----IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           + +H    IG+  ++ ++   S    +GL++      C  S +F+  +  L+ Q+  +GV
Sbjct: 1   MQFHVATMIGRAALRLVDRLGS----IGLLLYQVAS-CMWSGQFR--MRVLVEQIAKIGV 53

Query: 166 SGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSG 225
              PVVI+    TGAV+  Q  FQL     E     ++++   RE+G ++T +M+AGR G
Sbjct: 54  QSQPVVIITGAFTGAVLEAQTLFQLQTVRMETMGGAVVAVGMFRELGPVITGLMLAGRVG 113

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           SA+ AEIG+MK+ E++DA+++M +D V  L+ PRI A++IS+P+L + A    I  A IV
Sbjct: 114 SAMAAEIGTMKVTEQVDALKSMNVDPVDYLVKPRIQAMLISMPILMMEAVLVGIASAYIV 173

Query: 286 IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF-----AVGVHSN 340
               +++  A +        T+ +I   L+KA      I  ++ +EG      AVGV  +
Sbjct: 174 SVTAFNVDQAYWMHFMSKFVTMGDIIVALVKALAFGLIISTISCREGLNTTNGAVGVGKS 233

Query: 341 SLGKKVTTCVVQSIS---IVIIIDSLFAIFYF 369
           ++   V   V   I+   + +I++S F + + 
Sbjct: 234 TMQAMVYASVALLIANFILTMILNSFFPMGFM 265


>gi|323699476|ref|ZP_08111388.1| protein of unknown function DUF140 [Desulfovibrio sp. ND132]
 gi|323459408|gb|EGB15273.1| protein of unknown function DUF140 [Desulfovibrio desulfuricans
           ND132]
          Length = 267

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 71/211 (33%), Positives = 119/211 (56%), Gaps = 5/211 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           ++RQ+Y++GV  V V+ LI   TG V+  Q  + LS FGA+ F    +++  +RE+  +L
Sbjct: 49  IVRQIYFIGVQSVSVIALIGLFTGMVMGMQLYYALSVFGADGFLGTGVALSMVRELAPVL 108

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GSA+ AEIG M+I+E+IDA+  M ++ +R L++P++ A +IS P+LT   N
Sbjct: 109 TAIMLTGRAGSAMTAEIGVMRISEQIDALTIMDINPMRYLVAPKMAACLISFPILTAFFN 168

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
             A+ G  +   K       V++SR   +    +I  G IK+      +  +   EG+  
Sbjct: 169 LIALWGGWLTGVKLLGANAGVYWSRVSGSLDWDDIEGGFIKSIVFGLLVCTICCFEGYNT 228

Query: 336 GVHSNSLG-----KKVTTCVVQSISIVIIID 361
            + S   G     +  T+ VV+S  I++  D
Sbjct: 229 HLRSGHAGPEGVSQSTTSAVVKSCVIILAAD 259


>gi|119776212|ref|YP_928952.1| hypothetical protein Sama_3080 [Shewanella amazonensis SB2B]
 gi|119768712|gb|ABM01283.1| putative membrane protein [Shewanella amazonensis SB2B]
          Length = 260

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 124/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L++Q+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVKQLYVVGVQSLIIILVSGLFIGMVLALQGYTILVDFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAVDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  IV  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIWGGHIVGVEWKGIDNGAFWSILQASVEWRQDIVNCLIKSLVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + K  T+ VVQS   V+ +D L     F 
Sbjct: 219 LYRGYEVVPNPEGISKATTSTVVQSSLAVLALDFLLTALMFG 260


>gi|163788065|ref|ZP_02182511.1| ABC transporter, permease [Flavobacteriales bacterium ALC-1]
 gi|159876385|gb|EDP70443.1| ABC transporter, permease [Flavobacteriales bacterium ALC-1]
          Length = 260

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 76/223 (34%), Positives = 121/223 (54%)

Query: 139 TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIF 198
           TG F    +K       L+ Q Y +G   + +V +  F+ G V+  Q    L +FGA  +
Sbjct: 25  TGRFFKELFKRPFEFKELLNQCYSMGNKSLLLVGITGFIIGLVLTLQTRPTLMEFGAVSW 84

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISP 258
              ++SI  +REIG +LTA++ AGR GS I AEIGSMK+ E+IDA+   G +  + L+  
Sbjct: 85  MPSMVSISIVREIGPILTALVCAGRIGSGIGAEIGSMKVTEQIDAMEVSGTNPFKYLVVT 144

Query: 259 RIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAP 318
           R+ A+ + LPLL I+ +  A++G+ +V     D+ F ++F++        +I    IK+ 
Sbjct: 145 RVLAVTLMLPLLVIIGDAVALLGSYLVESVKGDVSFVLYFNQVFDALKFGDIMPATIKSF 204

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           F   AIGIV   +G+     +  +GK   T VV +  ++ IID
Sbjct: 205 FFGLAIGIVGCYKGYYCKKGTAGVGKAANTAVVFTSLLLFIID 247


>gi|320354123|ref|YP_004195462.1| hypothetical protein Despr_2023 [Desulfobulbus propionicus DSM
           2032]
 gi|320122625|gb|ADW18171.1| protein of unknown function DUF140 [Desulfobulbus propionicus DSM
           2032]
          Length = 272

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 76/224 (33%), Positives = 121/224 (54%), Gaps = 10/224 (4%)

Query: 147 YKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSIL 206
           ++F+     LI+Q+ ++G   + V+   +  TG V+  QG + L +FGAE      +S+ 
Sbjct: 48  FRFR----ELIKQVGFIGAGSLTVIFFTALSTGMVLGLQGYYSLHKFGAEGMLGSAVSLS 103

Query: 207 QLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
            + E+G +LTA+M+AGR+GSA+ AEIG M+I+E+IDA+  M +D  R  ISP++ A +IS
Sbjct: 104 LIMELGPVLTALMVAGRAGSAMCAEIGIMRISEQIDALECMAIDPFRYFISPKLLATLIS 163

Query: 267 LPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
           +PLLT   +   I G  +   K   +    FFS    + T  ++  G+IK+   A  +  
Sbjct: 164 VPLLTAFFDVIGITGGYLAGVKLMGVNSGAFFSGMEQSVTNHDVRLGVIKSFVFALLVAW 223

Query: 327 VAMKEGFAV------GVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           +    G+ V      G  + S+ K  T  VV S   V+I D L 
Sbjct: 224 ICTGRGYFVQTIRGAGFGAESVSKVTTQAVVMSSISVLIFDYLL 267


>gi|120600243|ref|YP_964817.1| hypothetical protein Sputw3181_3451 [Shewanella sp. W3-18-1]
 gi|146291827|ref|YP_001182251.1| hypothetical protein Sputcn32_0722 [Shewanella putrefaciens CN-32]
 gi|120560336|gb|ABM26263.1| protein of unknown function DUF140 [Shewanella sp. W3-18-1]
 gi|145563517|gb|ABP74452.1| protein of unknown function DUF140 [Shewanella putrefaciens CN-32]
 gi|319425062|gb|ADV53136.1| ABC phospholipid transporter, inner membrane subunit, MlaE
           [Shewanella putrefaciens 200]
          Length = 261

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 124/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVRQIYVVGVQSMVIIVVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  +V  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIYGGHLVGVEWKGIDSGAFWSILQASVEWQKDILNCLIKSGVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + +  T+ VVQS   V+ +D L     F 
Sbjct: 219 LYRGYQVIPNPEGISRATTSTVVQSSLAVLALDFLLTALMFG 260


>gi|317152440|ref|YP_004120488.1| hypothetical protein Daes_0725 [Desulfovibrio aespoeensis Aspo-2]
 gi|316942691|gb|ADU61742.1| protein of unknown function DUF140 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 268

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 117/210 (55%), Gaps = 5/210 (2%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +RQ+Y++GV  V V+ LI   TG V+  Q  + LS FGA+ F    +++  +RE+  +L 
Sbjct: 51  VRQIYFIGVQSVTVIALIGLFTGMVMGMQLYYALSVFGADGFLGTGVALSMVRELAPVLA 110

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+M+ GR+GSA+ AEIG M+I+E+IDA+  MG++ +R L++P++ A +IS P+L    N 
Sbjct: 111 AIMLTGRAGSAMTAEIGVMRISEQIDALTIMGINPMRYLVAPKMAACLISFPILNAFFNL 170

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
            A+ G  +   K       V+++R   +   ++I  G IK+   A  +  +   EG+   
Sbjct: 171 IALWGGWLTGVKLLGANEGVYWARVQGSLDWSDIQGGFIKSMVFAVLVCTICCFEGYYTH 230

Query: 337 VHSNSLG-----KKVTTCVVQSISIVIIID 361
             S   G     +  T  VV+S  I++  D
Sbjct: 231 TRSGHAGPEGVSQSTTNAVVKSCVIILAAD 260


>gi|320353203|ref|YP_004194542.1| hypothetical protein Despr_1079 [Desulfobulbus propionicus DSM
           2032]
 gi|320121705|gb|ADW17251.1| protein of unknown function DUF140 [Desulfobulbus propionicus DSM
           2032]
          Length = 371

 Score =  115 bits (289), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 99/363 (27%), Positives = 177/363 (48%), Gaps = 21/363 (5%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAI-VDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
           G W          ++V A++ SI++ + +  DL+   E DT     ++ F++      + 
Sbjct: 23  GAWTLRTDPPPPTELVGALDSSIRTLAFLSTDLA---EWDT----RLLVFLKATTAAARN 75

Query: 72  QGVSTHIEQLFSLISFTHRKKIKNQKPQR-SFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
            G++  +E L           +    P++ ++  N  + L   IG+  +     +   A 
Sbjct: 76  GGIAVDLEGLPP--GVRRLLALSEAVPEKVTYGKNVRELLVTRIGRLTLALSGQAREAAA 133

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYY----VGVSGVPVVILISFVTGAVIAQQG 186
             G +I       A    FK       R  +Y     GV  +P+V LI+ + G +++  G
Sbjct: 134 FTGEIILACMALAAGKKPFK------WRDFFYFIQSCGVESLPIVSLIAVLVGVILSFVG 187

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL  FGA+I+  +L+ +  + E+G L++ V+IAGR G+A  A++G+M++NEEIDA+RT
Sbjct: 188 AVQLQMFGAQIYVANLVGLGMVLEMGALMSGVIIAGRIGAAYAAQLGTMQVNEEIDALRT 247

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG+  V  L+ PR+ AL++ LPLL + A+   I+G S++     D+    +  +   T  
Sbjct: 248 MGISPVGFLVLPRMLALMLMLPLLCVYADIMGILGGSVIGVTMLDLSLIEYLEQTRKTLR 307

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L     G++KA      IG      G   G  + ++G+  T+ VV SI ++++ DS+   
Sbjct: 308 LGQCGQGILKASIFGVLIGYAGCLRGMQCGRSALAVGEATTSAVVTSIVLIVVSDSIITF 367

Query: 367 FYF 369
             +
Sbjct: 368 LLY 370


>gi|91203173|emb|CAJ72812.1| similar to ABC-type transport system permease protein [Candidatus
           Kuenenia stuttgartiensis]
          Length = 258

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 122/209 (58%), Gaps = 1/209 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++++   G     +V +I+  TG V++ Q  + L  +GAE++   ++S+  +RE+G +L
Sbjct: 42  LLKEIDNFGAGSFLLVNIIALFTGMVMSLQTIYGLRMYGAEMYVGSVVSLSIVRELGPVL 101

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           T++M+  R GS I AEIGSM++ E+IDA+R +G   ++ L+SP+I+A +I+LPLLT+ A+
Sbjct: 102 TSIMVGARIGSGIAAEIGSMQVTEQIDAMRALGASPIKKLVSPKIFAGLITLPLLTVTAD 161

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  I G  I+     DI    + +   +T T+++  +G+ K  F    I ++    G   
Sbjct: 162 FIGIFGGLIIATFELDIDHIFYINSILTTITISDFISGIGKTVFFGLLIAVIGCYFGLKT 221

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
              +  +G+  T  VV +ISI I+I   F
Sbjct: 222 SGGTTGVGRSTTISVV-TISISILIADFF 249


>gi|15892052|ref|NP_359766.1| ABC transporter permease protein [Rickettsia conorii str. Malish 7]
 gi|34580917|ref|ZP_00142397.1| ABC transporter permease protein [Rickettsia sibirica 246]
 gi|229586334|ref|YP_002844835.1| ABC transporter permease protein [Rickettsia africae ESF-5]
 gi|81528535|sp|Q92JD8|Y129_RICCN RecName: Full=Probable ABC transporter permease protein RC0129
 gi|15619171|gb|AAL02667.1| ABC transporter permease protein [Rickettsia conorii str. Malish 7]
 gi|28262302|gb|EAA25806.1| ABC transporter permease protein [Rickettsia sibirica 246]
 gi|228021384|gb|ACP53092.1| ABC transporter permease protein [Rickettsia africae ESF-5]
          Length = 259

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 140/266 (52%), Gaps = 13/266 (4%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG--FLLSLIRQMYYVGVS 166
           N+   +GK+ VKF     S +            F A S   +   +L  +IRQ+ ++G  
Sbjct: 4   NIANSVGKRTVKFAQSVGSFSLF---------SFAAVSSIIRPPLYLSLIIRQLLFIGFH 54

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMIAGRSG 225
            +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +L  +M+AGR G
Sbjct: 55  SLPVVAMTTFFSGAVLALQSYIGFSRFSAES-SIATVVVLSLTRELGPVLAGLMVAGRVG 113

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           ++I AEI +M++ E+IDA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V
Sbjct: 114 ASIAAEIATMRVTEQIDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLV 173

Query: 286 IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKK 345
                D   A + +         ++ +GL+KA      I I++   G+  G  +  +G+ 
Sbjct: 174 GVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRA 233

Query: 346 VTTCVVQSISIVIIIDSLFAIFYFAI 371
            T+ VV S  +++I + L    +F +
Sbjct: 234 TTSAVVNSSILILISNYLITELFFKV 259


>gi|146281424|ref|YP_001171577.1| toluene tolerance ABC efflux transporter, permease [Pseudomonas
           stutzeri A1501]
 gi|145569629|gb|ABP78735.1| toluene tolerance ABC efflux transporter, permease [Pseudomonas
           stutzeri A1501]
          Length = 265

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 129/222 (58%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
            GF L L++Q+Y VGV  + +V++     G V+A QG   LS +G+E     ++++  LR
Sbjct: 43  NGFSL-LVKQLYSVGVLSLAIVVVSGIFIGMVLALQGYNILSSYGSEQAVGQMVALTLLR 101

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +I+PR+WA  ISLPL
Sbjct: 102 ELGPVVTALLFAGRAGSALAAEIGNMKSTEQLSSLEMIGVDPLKYIIAPRLWAGFISLPL 161

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           LT++ N   I G ++V   +  +    F++   ++    +++  G+IK+   A  +  +A
Sbjct: 162 LTLIFNVVGIWGGAMVAVDWLGVYEGSFWANMQNSVDFHSDVLNGVIKSVVFALVVTWIA 221

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           + +G+     S  + +  T  VV +   V+ +D +     F 
Sbjct: 222 VFQGYDCEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|195952743|ref|YP_002121033.1| protein of unknown function DUF140 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932355|gb|ACG57055.1| protein of unknown function DUF140 [Hydrogenobaculum sp. Y04AAS1]
          Length = 246

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 120/213 (56%), Gaps = 1/213 (0%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           + ++ Y+G   VPVV+  S  TG V+A Q    L +F +E     L+++   RE+G +LT
Sbjct: 33  VDRVIYIGADTVPVVVTTSLFTGGVLALQTYSTLHKFNSEYLIGALVALSMGRELGPVLT 92

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           ++M+  R GSAI A IG+MK+ E+IDA+ T+ ++    + SP ++A ++ LPLLTIL++ 
Sbjct: 93  SLMVVARVGSAITASIGTMKVTEQIDALETLAINPYAYITSPILFACMVDLPLLTILSDI 152

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           S IIG  +V    + +   +++ +        +I+ GL KA      I  V+   GF   
Sbjct: 153 SGIIGGYLVSTIIFHVNGHMYWDKTKEIVDFYDIYGGLYKAFVYGIVIATVSNYFGFKTS 212

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDS-LFAIFY 368
             +  +G+  T+ VV S  +++I+D  L AI Y
Sbjct: 213 GGNQGVGRATTSSVVISSMLILILDYFLTAIIY 245


>gi|117919131|ref|YP_868323.1| hypothetical protein Shewana3_0679 [Shewanella sp. ANA-3]
 gi|117611463|gb|ABK46917.1| protein of unknown function DUF140 [Shewanella sp. ANA-3]
          Length = 261

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 124/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVRQIYVVGVQSMVIIVVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  +V  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIYGGHLVGVEWKGIDGGAFWSILQASVEWRQDIVNCLIKSGVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + +  T+ VVQS   V+ +D L     F 
Sbjct: 219 LYRGYQVVPNPEGISRATTSTVVQSSLAVLALDFLLTALMFG 260


>gi|327479601|gb|AEA82911.1| toluene tolerance ABC efflux transporter, permease [Pseudomonas
           stutzeri DSM 4166]
          Length = 265

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 129/222 (58%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
            GF L L++Q+Y VGV  + +V++     G V+A QG   LS +G+E     ++++  LR
Sbjct: 43  NGFSL-LVKQLYSVGVLSLAIVVVSGIFIGMVLALQGYNILSSYGSEQAVGQMVALTLLR 101

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +I+PR+WA  ISLPL
Sbjct: 102 ELGPVVTALLFAGRAGSALAAEIGNMKSTEQLSSLEMIGVDPLKYIIAPRLWAGFISLPL 161

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           LT++ N   I G ++V   +  +    F++   ++    +++  G+IK+   A  +  +A
Sbjct: 162 LTLIFNVVGIWGGAMVAVDWLGVYEGSFWANMQNSVDFHSDVLNGVIKSVVFALVVTWIA 221

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           + +G+     S  + +  T  VV +   V+ +D +     F 
Sbjct: 222 VFQGYDCEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|224827292|ref|ZP_03700385.1| protein of unknown function DUF140 [Lutiella nitroferrum 2002]
 gi|224600505|gb|EEG06695.1| protein of unknown function DUF140 [Lutiella nitroferrum 2002]
          Length = 261

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 69/214 (32%), Positives = 121/214 (56%), Gaps = 1/214 (0%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           IR++Y+ GV  + ++++     G V+  QG   LS+FG+      L+++  LRE+G +L 
Sbjct: 48  IREVYFAGVLSLIIIVVSGLFVGMVLGLQGYNTLSRFGSADALGALVALSLLRELGPVLA 107

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++ A RSGSA+ AEIG MK  E++DA+  M ++ +  +++PR WA +IS+P+L  L N 
Sbjct: 108 ALLFASRSGSAMTAEIGLMKATEQLDAMSVMAVNPIARVVAPRFWAGVISMPVLAALFNV 167

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFAV 335
           + I G   V  +   +    F+S+  ++  L N +  GLIK+ F   A+ ++A+ EG+  
Sbjct: 168 TGIFGGYFVGVQLIGLDEGTFWSQMQNSVDLHNDVINGLIKSLFFGIAVTLIAVFEGYDA 227

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              +  +    T  VV S  +++ +D +   F F
Sbjct: 228 TPTAAGVSSATTRTVVTSALVILALDFVLTAFMF 261


>gi|85858832|ref|YP_461034.1| organic solvents resistance ABC transporter permease [Syntrophus
           aciditrophicus SB]
 gi|85721923|gb|ABC76866.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Syntrophus aciditrophicus
           SB]
          Length = 259

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 72/207 (34%), Positives = 115/207 (55%), Gaps = 1/207 (0%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
           +QM +VGV  + VV+L    TG V+A QG      F AE      +++   RE+G +LT+
Sbjct: 48  KQMEFVGVKSIFVVVLTGAFTGMVMALQGYHGFKMFSAESLVGATVALGMTRELGPVLTS 107

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           +M+  R+GSA+ AE+G+M++ E+IDA+  M  + ++ LI PR+ A I+ LPLLT++++F 
Sbjct: 108 LMVTARAGSAMAAELGTMRVTEQIDALYVMAANPIQHLIVPRMIASILMLPLLTVVSDFV 167

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            I+G   V     +I   VF         L +I+ GLIKA      + ++   +GF    
Sbjct: 168 GILGGYFVGVSVLNINEGVFVKNITRIVELGDIYNGLIKAACFGLILSLIGCYKGFHARG 227

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +  +G+  T  VV S SI I++   F
Sbjct: 228 GAEGVGRATTEAVVLS-SISILVGDYF 253


>gi|15603974|ref|NP_220489.1| hypothetical protein RP096 [Rickettsia prowazekii str. Madrid E]
 gi|81554918|sp|Q9ZE51|Y096_RICPR RecName: Full=Probable ABC transporter permease protein RP096
 gi|3860665|emb|CAA14566.1| unknown [Rickettsia prowazekii]
 gi|292571688|gb|ADE29603.1| ABC transporter permease protein [Rickettsia prowazekii Rp22]
          Length = 259

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 131/231 (56%), Gaps = 22/231 (9%)

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-RE 210
           +L  +IRQ+ ++G   +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE
Sbjct: 40  YLSLIIRQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAE-NSIATVVVLSLTRE 98

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G +L  +++AGR G++I AEI +M++ E++DA+ T+  D ++ L+ PR+ A II++P L
Sbjct: 99  LGPVLAGLIVAGRVGASIAAEIATMRVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCL 158

Query: 271 TILANFSAIIGASIV-IWKYYDIPFAVFFSRFHSTATLANIF---------TGLIKAPFM 320
            ++ +   ++G  +V I+K            F+STA L + F         +GLIKA   
Sbjct: 159 VLIGDIIGVMGGYLVGIYKL----------DFNSTAYLTSTFQYLEPIDVISGLIKATVF 208

Query: 321 ACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
              I I++   G+  G  +  +G+  T+ VV S  +++I + L    +F +
Sbjct: 209 GFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV 259


>gi|325294995|ref|YP_004281509.1| hypothetical protein Dester_0809 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065443|gb|ADY73450.1| protein of unknown function DUF140 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 260

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 122/216 (56%), Gaps = 4/216 (1%)

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           +FK +L     Q+  +G   +PV+ + S  TG VIA +      +F AE     +++I  
Sbjct: 39  RFKHYLY----QLASIGTGSLPVIAITSLFTGGVIALETYEAFHRFNAEYMIGGVVAISM 94

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
            RE+G +LTA++I  RSGSA+ AEIG+MK+ E+IDA+R M ++ ++ LI+PR++  +I++
Sbjct: 95  ARELGPVLTALLITARSGSAMAAEIGTMKVTEQIDALRMMAVNPIKYLITPRVYTSVIAV 154

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIV 327
            LLTI+++    IG  IV    ++I   ++     + A + +++ GLIKA      I  +
Sbjct: 155 TLLTIISDIVGYIGGYIVSVVVFNINKTLYIRYTQNLAEMNDVYHGLIKAAIFGFLIATI 214

Query: 328 AMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           +   G+     +  +G+  T  VV S   ++I D L
Sbjct: 215 SCLYGYFTKGGAKGVGESTTKAVVVSSISILIFDYL 250


>gi|77361458|ref|YP_341033.1| ABC transporter membrane protein [Pseudoalteromonas haloplanktis
           TAC125]
 gi|76876369|emb|CAI87591.1| putative transport protein (ABC superfamily, membrane)
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 260

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 121/215 (56%), Gaps = 1/215 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LIRQ+Y VG   + ++++     G V+A QG   L  +GAE     L+++  LRE+G ++
Sbjct: 44  LIRQLYMVGSQSLLIIVVSGLFIGMVLALQGYTVLVGYGAEDSLGPLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D ++ +I+PR WA +IS+PLL ++ +
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLKRIIAPRFWAGLISMPLLALIFS 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
             AIIGA +V   +  +    F+S   S  +   +I  G+IK+   A  +  +A+ +G+ 
Sbjct: 164 AVAIIGAHLVGVDWLGVDTGSFWSIMQSQVSFQQDILNGIIKSVVFAIVVTWIALYKGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
               S  + K  T  VV S   V+  D L     F
Sbjct: 224 CVPTSEGISKATTETVVHSSLAVLGFDFLLTAVMF 258


>gi|90580197|ref|ZP_01236004.1| hypothetical protein VAS14_19736 [Vibrio angustum S14]
 gi|90438499|gb|EAS63683.1| hypothetical protein VAS14_19736 [Vibrio angustum S14]
          Length = 260

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 122/216 (56%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VGV  + ++++     G V++ QG   L+ FGAE     ++++  LRE+G ++
Sbjct: 44  LIKQLYSVGVLSIAIILVSGLFIGMVLSLQGYLVLADFGAETSLGQMVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PLL ++ +
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVIAPRFWAGVISMPLLALMFS 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              + GA IV   +  I +  F+S   S+   + +I   +IKA   A  +  +A+  G+ 
Sbjct: 164 VVGLWGAQIVGVDWKGIDYGSFWSVMQSSVNFSYDIGNSIIKAVAFAITVTWIAVFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV S   V+ +D +     F 
Sbjct: 224 AVPTSEGISRATTRTVVNSSLAVLGLDFILTALMFG 259


>gi|113969024|ref|YP_732817.1| hypothetical protein Shewmr4_0680 [Shewanella sp. MR-4]
 gi|114048831|ref|YP_739381.1| hypothetical protein Shewmr7_3342 [Shewanella sp. MR-7]
 gi|113883708|gb|ABI37760.1| protein of unknown function DUF140 [Shewanella sp. MR-4]
 gi|113890273|gb|ABI44324.1| protein of unknown function DUF140 [Shewanella sp. MR-7]
          Length = 261

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 124/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVRQIYVVGVQSMVIIVVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  +V  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIYGGHLVGVEWKGIDGGAFWSILQASVEWRQDIVNCLIKSGVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + +  T+ VVQS   V+ +D L     F 
Sbjct: 219 LYRGYQVVPNPEGISRATTSTVVQSSLAVLALDFLLTALMFG 260


>gi|226939556|ref|YP_002794629.1| ABC transport system permease protein [Laribacter hongkongensis
           HLHK9]
 gi|226714482|gb|ACO73620.1| putative ABC transport system permease protein [Laribacter
           hongkongensis HLHK9]
          Length = 371

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/206 (35%), Positives = 123/206 (59%), Gaps = 1/206 (0%)

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           M   G   +P+V+LI F+ G ++A Q       FGA +  ++ + I  LRE+G L+TA++
Sbjct: 158 MASAGTQALPIVLLIGFLMGTILAFQMGLVAQGFGAGLLVVNGIGIAMLRELGPLMTAIV 217

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
            AGRSG+A  AE+G+ K+NEEI A+ T G+D V  L+ PR+ A ++ LPLLT+LA+   +
Sbjct: 218 FAGRSGAAFAAELGTQKVNEEIYALHTFGIDPVAFLVLPRLVAAVLVLPLLTVLADVIGL 277

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
           +G ++V+  +   P   F+ +  +T +L +++ GL K+      I  +  ++G + G   
Sbjct: 278 LGGALVMQAFSVTPMQ-FYHQTLATVSLTDLYFGLGKSMVFGLFIAQIGCRQGLSAGQGP 336

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFA 365
            ++G   T  VV S+  +++ID LFA
Sbjct: 337 TAVGVAATRAVVSSLIWIVVIDGLFA 362


>gi|51473253|ref|YP_067010.1| ABC transporter permease protein [Rickettsia typhi str. Wilmington]
 gi|81390296|sp|Q68XW4|Y041_RICTY RecName: Full=Probable ABC transporter permease protein RT0041
 gi|51459565|gb|AAU03528.1| ABC transporter permease protein [Rickettsia typhi str. Wilmington]
          Length = 259

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 129/221 (58%), Gaps = 24/221 (10%)

Query: 154 LSLI-RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REI 211
           LSLI RQ+ ++G   +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+
Sbjct: 41  LSLIMRQLLFIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAE-NSIATVVVLSLTREL 99

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
           G +L  +++AGR G++I AEI +MK+ E++DA+ T+  D ++ L+ PR+ A II++P L 
Sbjct: 100 GPVLAGLIVAGRVGASIAAEIATMKVTEQVDALYTLSTDPIKYLVCPRVIAAIITMPCLV 159

Query: 272 ILANFSAIIGASIV-IWKYYDIPFAVFFSRFHSTATLANIF---------TGLIKAPFMA 321
           ++ +   ++G  +V I+K            F+STA L + F         +GL+KA    
Sbjct: 160 LIGDVIGVMGGYLVGIYKL----------NFNSTAYLTSTFQYLELIDVISGLVKATVFG 209

Query: 322 CAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
             I I++   G+  G  +  +G+  T+ VV S SI+I+I +
Sbjct: 210 FIISIISCYSGYYSGKGAKGVGRATTSAVVNS-SILILISN 249


>gi|157828003|ref|YP_001494245.1| ABC transporter permease protein [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165932699|ref|YP_001649488.1| ABC transporter permease [Rickettsia rickettsii str. Iowa]
 gi|157800484|gb|ABV75737.1| ABC transporter permease protein [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165907786|gb|ABY72082.1| ABC transporter permease protein [Rickettsia rickettsii str. Iowa]
          Length = 259

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 140/266 (52%), Gaps = 13/266 (4%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG--FLLSLIRQMYYVGVS 166
           N+   +GK+ VKF     S +            F A S   +   +L  +IRQ+ ++G  
Sbjct: 4   NIANSVGKRTVKFAQSVGSFSLF---------SFAAVSSIIRPPLYLSLIIRQLLFIGFH 54

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMIAGRSG 225
            +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +L  +M+AGR G
Sbjct: 55  SLPVVAMTTFFSGAVLALQSYIGFSRFSAES-SIATVVVLSLTRELGPVLAGLMVAGRVG 113

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           ++I AEI +M++ E++DA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V
Sbjct: 114 ASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLV 173

Query: 286 IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKK 345
                D   A + +         ++ +GL+KA      I I++   G+  G  +  +G+ 
Sbjct: 174 GVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRA 233

Query: 346 VTTCVVQSISIVIIIDSLFAIFYFAI 371
            T+ VV S  +++I + L    +F +
Sbjct: 234 TTSAVVNSSILILISNYLITELFFKV 259


>gi|24375440|ref|NP_719483.1| hypothetical protein SO_3953 [Shewanella oneidensis MR-1]
 gi|24350284|gb|AAN56927.1|AE015826_12 conserved hypothetical protein TIGR00056 [Shewanella oneidensis
           MR-1]
          Length = 261

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 124/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVRQIYVVGVQSMVIIVVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  +V  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIYGGHLVGVEWKGIDSGAFWSILQASVEWRQDIVNCLIKSGVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + +  T+ VVQS   V+ +D L     F 
Sbjct: 219 LYRGYQVIPNPEGISRATTSTVVQSSLAVLALDFLLTALMFG 260


>gi|328953206|ref|YP_004370540.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328453530|gb|AEB09359.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 256

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 138/261 (52%), Gaps = 7/261 (2%)

Query: 108 KNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG 167
           K+L   +G+  + FI ++      L       G F    YK      +L++Q+Y +GV  
Sbjct: 2   KDLLRTLGRATIDFIQEAGRMQLFL---FQTLGLFFLPPYK----PFNLVKQVYVIGVRS 54

Query: 168 VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSA 227
             +++L +  TG V+  QG + L +FGAE      +++  +RE+G +LTA+M+ GR+GSA
Sbjct: 55  SSIILLTAMFTGMVLGLQGYYTLRKFGAESALGSAVALSLIRELGPVLTALMVTGRAGSA 114

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
           I AEIG M+I E++DA+ TM ++ ++ ++ P++ A +I++PLLT   +F  I+G  +V  
Sbjct: 115 ITAEIGIMRITEQLDALDTMAINPMQYVVMPKVIAGLIAVPLLTAFFDFVGIVGGYLVGV 174

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
               +    +FS    +    ++  G +K+      + +VA  +G+     +  + +  T
Sbjct: 175 VMLGVSSGSYFSGMIQSVETLDVNGGFVKSIVFGLTVTLVACYKGYFTSHGAEGVSQSTT 234

Query: 348 TCVVQSISIVIIIDSLFAIFY 368
             VV +  +++  D +   F+
Sbjct: 235 EAVVLAAILILGWDYVLTSFF 255


>gi|152999232|ref|YP_001364913.1| hypothetical protein Shew185_0693 [Shewanella baltica OS185]
 gi|160873845|ref|YP_001553161.1| hypothetical protein Sbal195_0723 [Shewanella baltica OS195]
 gi|217971905|ref|YP_002356656.1| hypothetical protein Sbal223_0714 [Shewanella baltica OS223]
 gi|304411204|ref|ZP_07392819.1| protein of unknown function DUF140 [Shewanella baltica OS183]
 gi|307306499|ref|ZP_07586242.1| protein of unknown function DUF140 [Shewanella baltica BA175]
 gi|151363850|gb|ABS06850.1| protein of unknown function DUF140 [Shewanella baltica OS185]
 gi|160859367|gb|ABX47901.1| protein of unknown function DUF140 [Shewanella baltica OS195]
 gi|217497040|gb|ACK45233.1| protein of unknown function DUF140 [Shewanella baltica OS223]
 gi|304350397|gb|EFM14800.1| protein of unknown function DUF140 [Shewanella baltica OS183]
 gi|306910790|gb|EFN41218.1| protein of unknown function DUF140 [Shewanella baltica BA175]
 gi|315266072|gb|ADT92925.1| protein of unknown function DUF140 [Shewanella baltica OS678]
          Length = 261

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 123/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVRQIYVVGVQSMVIILVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  IV  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIYGGHIVGVEWKGIDSGAFWSILQASVEWRQDIVNCLIKSGVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + +  T  VVQS   V+ +D L     F 
Sbjct: 219 LYRGYQVIPNPEGISRATTQTVVQSSLAVLALDFLLTALMFG 260


>gi|126175856|ref|YP_001052005.1| hypothetical protein Sbal_3661 [Shewanella baltica OS155]
 gi|125999061|gb|ABN63136.1| protein of unknown function DUF140 [Shewanella baltica OS155]
          Length = 261

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 123/222 (55%), Gaps = 2/222 (0%)

Query: 150 KGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLR 209
           KGF L L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LR
Sbjct: 40  KGFPL-LVRQIYVVGVQSMVIILVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLR 98

Query: 210 EIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPL 269
           E+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PL
Sbjct: 99  ELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPL 158

Query: 270 LTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVA 328
           L ++     I G  IV  ++  I    F+S   ++     +I   LIK+   A  +  +A
Sbjct: 159 LALMFTAVGIYGGHIVGVEWKGIDSGAFWSILQASVEWRQDIVNCLIKSGVFAVVVTWIA 218

Query: 329 MKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +  G+ V  +   + +  T  VVQS   V+ +D L     F 
Sbjct: 219 LYRGYQVIPNPEGISRATTQTVVQSSLAVLALDFLLTALMFG 260


>gi|89075259|ref|ZP_01161686.1| hypothetical protein SKA34_22619 [Photobacterium sp. SKA34]
 gi|89048940|gb|EAR54508.1| hypothetical protein SKA34_22619 [Photobacterium sp. SKA34]
          Length = 260

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 122/216 (56%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VGV  + ++I+     G V++ QG   L+ FGAE     ++++  LRE+G ++
Sbjct: 44  LIKQLYSVGVLSIAIIIVSGLFIGMVLSLQGYLVLAGFGAETSLGQMVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PLL ++ +
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVIAPRFWAGVISMPLLALMFS 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              + GA +V   +  I +  F+S   S+   + +I   +IKA   A  +  +A+  G+ 
Sbjct: 164 VVGLWGAQVVGVDWKGIDYGSFWSVMQSSVNFSYDIGNSIIKAVAFAITVTWIAVFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV S   V+ +D +     F 
Sbjct: 224 AVPTSEGISRATTRTVVNSSLAVLGLDFILTALMFG 259


>gi|253995674|ref|YP_003047738.1| hypothetical protein Mmol_0301 [Methylotenera mobilis JLW8]
 gi|253982353|gb|ACT47211.1| protein of unknown function DUF140 [Methylotenera mobilis JLW8]
          Length = 267

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/268 (28%), Positives = 143/268 (53%), Gaps = 8/268 (2%)

Query: 105 NSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVG 164
           N F      +G +++  I    + A +  L I+ +GE       F+ F L+L R++Y+ G
Sbjct: 7   NMFSRFLSGVGNRMIARIWRLGAGARLFMLAIAYSGE------SFRRFHLTL-REVYFTG 59

Query: 165 VSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRS 224
           V  + ++I+ +F  G V+A QG   L ++G+      L+++  +RE+G ++TA++ AGR+
Sbjct: 60  VMSLLIIIVSAFFVGMVLALQGYNTLQKYGSSEAIGVLVALALVRELGPVVTALLFAGRA 119

Query: 225 GSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASI 284
           G+AI AEIG MK  E++ A+  M ++ +  +++PR WA +IS+P+L  L +   ++G  +
Sbjct: 120 GTAITAEIGLMKTTEQLSAMEMMAVNPIARVVAPRFWAGVISMPILAALFSMVGVLGGYL 179

Query: 285 VIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           V      +    F+S+  +   + A+I  G+IK+     A  ++A+ EGF     +  + 
Sbjct: 180 VAVPLIGVDDGAFWSQMQANVDVRADIINGVIKSVVFGVACTMIALFEGFDAPPTAEGVS 239

Query: 344 KKVTTCVVQSISIVIIIDSLFAIFYFAI 371
              T  VV S   V+ +D +   F   +
Sbjct: 240 HATTRTVVISSLTVLFLDFVLTSFMLVV 267


>gi|157825268|ref|YP_001492988.1| ABC transporter permease protein [Rickettsia akari str. Hartford]
 gi|157799226|gb|ABV74480.1| ABC transporter permease protein [Rickettsia akari str. Hartford]
          Length = 259

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/280 (28%), Positives = 148/280 (52%), Gaps = 41/280 (14%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEF-------CASSYKFKGFLLSLIRQMY 161
           N+   +GK+ +K     C+Q         + G F        +S+ +   +L  +IRQ+ 
Sbjct: 4   NIANLVGKRTIK-----CAQ---------SVGSFSLFSFAAVSSTIRPPLYLSLIIRQLL 49

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMI 220
           ++G   +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +L  +M+
Sbjct: 50  FIGFHSLPVVAMTTFFSGAVLALQSYTGFSRFSAE-NSIATVVVLSLTRELGPVLAGLMV 108

Query: 221 AGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAII 280
           +GR G++I AEI +M++ E++DA+ T+  D ++ L+ PR+ A I+++P L ++ +   ++
Sbjct: 109 SGRVGASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVIATIVTMPCLVLIGDIIGVM 168

Query: 281 GASIVIWKYYDIPFAVFFSRFHSTATLA---------NIFTGLIKAPFMACAIGIVAMKE 331
           G  +V          V+   F+STA L          ++ +GL+KA      I I++   
Sbjct: 169 GGYLV---------GVYKLDFNSTAYLTSTLHYLEPIDVISGLVKAGVFGFIISIISCYS 219

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
           G+  G  +  +G+  T+ VV S  I++I + L    +F +
Sbjct: 220 GYYSGKGAKGVGRATTSAVVNSSIIILISNYLITELFFKV 259


>gi|51246140|ref|YP_066024.1| toluene ABC-transporter, permease protein [Desulfotalea
           psychrophila LSv54]
 gi|50877177|emb|CAG37017.1| related to toluene ABC-transporter, permease protein [Desulfotalea
           psychrophila LSv54]
          Length = 262

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 133/244 (54%), Gaps = 20/244 (8%)

Query: 136 ISNTGEFC-------ASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
           ++N G FC          ++    +  ++  ++++G   + VVIL  F TG V+A QG +
Sbjct: 17  VTNLGRFCLFLLTGIGQIFQKPFQIFRIVENIWFIGTKSMAVVILTGFFTGMVLALQGYY 76

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L++FG+       +++  +RE+G +LTA+MI  R+GSA+ AEIG+M+I+E++DA++TM 
Sbjct: 77  ALAKFGSAGMLGSAVALTLIRELGPVLTAIMITARAGSAMAAEIGTMRISEQLDALQTMD 136

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           ++ V+ + SPR+ A II  PLLT + +   I G  + I     +   ++  R H +  + 
Sbjct: 137 INPVKFVFSPRLIASIICFPLLTSIFDVVGIFGG-LFIATTLKVNGYIYMYRVHESVVME 195

Query: 309 NIFTGLIKAPFMA-------CAIGIVA--MKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           +I +G+IK+   A       C  G  A   KEG   G  S ++    T  VV S  +++I
Sbjct: 196 DIRSGIIKSLVFAVVVVSTCCFKGYYAHIQKEG---GFGSRAVSLATTNAVVSSSVLILI 252

Query: 360 IDSL 363
            D L
Sbjct: 253 YDYL 256


>gi|291287315|ref|YP_003504131.1| hypothetical protein Dacet_1405 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884475|gb|ADD68175.1| protein of unknown function DUF140 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 256

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 120/214 (56%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+ ++G + + V+IL    TG V A Q      +FGAE     ++++   RE+G +L
Sbjct: 43  LIKQIEFIGANSLSVIILTGSFTGMVFAFQSYIGFHKFGAEQIVGTVVALGMARELGPVL 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           +A+M+A R+GSAI AEIG+MK+ E++DA+  + +D V+ L  PRI A +I +P+L  +A 
Sbjct: 103 SAIMVAARAGSAITAEIGTMKVTEQVDALNALAVDPVQYLFVPRILAGLIVMPMLNAIAV 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F  ++G  +V      I   ++ +  +     ++ F+G++KA      + +V   +G+  
Sbjct: 163 FCGMVGGFLVSITVLGINKTLYLNYMYQYIEFSDFFSGMVKAFVFGGIVTLVGCYKGYMT 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              +  +GK  T  VV +  ++++ D +   F F
Sbjct: 223 TGGAEGVGKSTTESVVLACILILVFDYILTAFMF 256


>gi|52425767|ref|YP_088904.1| hypothetical protein MS1712 [Mannheimia succiniciproducens MBEL55E]
 gi|52307819|gb|AAU38319.1| unknown [Mannheimia succiniciproducens MBEL55E]
          Length = 260

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 69/217 (31%), Positives = 121/217 (55%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L  F  G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LIKQLYVLGVQSLLIILLSGFFIGMVLGLQGYVILVDFAAEANVGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +I++P+LT+L  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVIAMPVLTVLFT 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              IIG  ++  ++  I    F+S   +     +++ G IK+   A  +  +A+  G+  
Sbjct: 164 AVGIIGGHLIGVEWKGIDSGSFWSVMQNAVRTLDLWDGFIKSLVFAFTVTWIALFNGYDC 223

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
              S  + +  T  VV +  +V+ +D +     F  G
Sbjct: 224 IPTSEGISQATTRTVVNASLLVLGLDFVLTAIMFGAG 260


>gi|118579001|ref|YP_900251.1| hypothetical protein Ppro_0562 [Pelobacter propionicus DSM 2379]
 gi|118501711|gb|ABK98193.1| protein of unknown function DUF140 [Pelobacter propionicus DSM
           2379]
          Length = 256

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 65/206 (31%), Positives = 118/206 (57%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q+ ++G   + V+ L +  TG V+  QG + L++FG+E      +++  +RE+G +L
Sbjct: 43  VLKQLSFIGAKSLFVIFLTAAFTGMVLGLQGYYTLTKFGSEGMLGTAVALSLIRELGPVL 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GSAI AEIG M+I E+IDA+ TM LD  + LI+P++ A +I+LPLL  + +
Sbjct: 103 TALMVTGRAGSAIAAEIGIMRITEQIDALETMALDPFKYLITPKLIAAMIALPLLCAIFD 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G  +V  K   +    +FS    +    ++++G  K+      I  +   +G+  
Sbjct: 163 TIGIYGGWLVGVKLLGVNPGAYFSEMEKSVVWRDVYSGFAKSFSFGVIIAWIGCYKGYFA 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
           G  +  + K  T  VV +  ++++ D
Sbjct: 223 GHGAEGVSKATTEAVVLTSVLILVWD 248


>gi|294139194|ref|YP_003555172.1| hypothetical protein SVI_0423 [Shewanella violacea DSS12]
 gi|293325663|dbj|BAJ00394.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 258

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 123/224 (54%), Gaps = 2/224 (0%)

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           + KGF L  ++Q+Y VGV  + ++++     G V+A QG   L  FG E     ++++  
Sbjct: 35  RLKGFSL-FVKQLYVVGVQSMVLILISGLFIGMVLALQGYNILVGFGTEESLGPMVALSL 93

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           LRE+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA ++SL
Sbjct: 94  LRELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVVSL 153

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGI 326
           PLLT++     I G  +V  ++  I    F+S   ++     +I   LIK+      +  
Sbjct: 154 PLLTLMFTAVGIYGGHLVGVEWKGIDSGSFWSILQASVEWRQDIVNCLIKSFLFGIVVTW 213

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +A+  G+ V  +   + K  T  VVQS   V+ +D L     F 
Sbjct: 214 IALYRGYQVTPNPEGISKATTQTVVQSSLAVLALDFLLTALMFG 257


>gi|294669772|ref|ZP_06734838.1| hypothetical protein NEIELOOT_01672 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308338|gb|EFE49581.1| hypothetical protein NEIELOOT_01672 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 258

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 144/263 (54%), Gaps = 10/263 (3%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGV 168
           NL   +G K + FI    S    L  +++++G    S  +F+   LS +RQ+Y+ GV  V
Sbjct: 2   NLIRTVGAKTLGFIQALGSVCLFLLQILAHSGT---SLLRFR---LS-VRQVYFAGVLSV 54

Query: 169 PVVILISFVTGAVIAQQGAFQLSQF-GAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSA 227
            ++ +     G V+  QG  QL++F  A+I    + + L LRE+G +L A++ A  +G A
Sbjct: 55  LIIAVSGLFVGMVLGLQGYTQLAKFKSADILGYMVAASL-LRELGPVLAAILFASSAGGA 113

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
           + +EIG MK  E+++A+  M ++ V  +++PR WA + S+PLL  + N + I GA +V  
Sbjct: 114 MTSEIGLMKATEQLEAMNVMAINPVARVVAPRFWAGVFSMPLLASIFNVAGIYGAYLVGV 173

Query: 288 KYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
           ++  +   +F+S+  +  +   ++  GLIK+ F   A+ ++A+ +GF     S  + +  
Sbjct: 174 QWLGLDGGIFWSQMQNNISFGYDVLNGLIKSAFFGVAVTLIAVHQGFHALPTSEGILRAS 233

Query: 347 TTCVVQSISIVIIIDSLFAIFYF 369
           T  VV S  +V+ ID +   F F
Sbjct: 234 TRTVVSSALVVLAIDFILTAFMF 256


>gi|119469173|ref|ZP_01612157.1| putative transport protein (ABC superfamily, membrane)
           [Alteromonadales bacterium TW-7]
 gi|119447425|gb|EAW28693.1| putative transport protein (ABC superfamily, membrane)
           [Alteromonadales bacterium TW-7]
          Length = 259

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 116/199 (58%), Gaps = 1/199 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VG   + ++++     G V+A QG   L  +GAE     L+++  LRE+G ++
Sbjct: 43  LVRQLYMVGSQSLLIIMVSGLFIGMVLALQGYTVLVGYGAEDSLGPLVALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D ++ +I+PR WA  IS+PLL I+ +
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLKRIIAPRFWAGFISMPLLAIIFS 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
             AIIGA +V   +  +    F+S   S  +  A++  G+IK+   A  +  +A+ +G+ 
Sbjct: 163 AVAIIGAHLVGVDWLGVDTGSFWSIMQSQVSFQADVLNGIIKSFVFAIVVTWIALYKGYD 222

Query: 335 VGVHSNSLGKKVTTCVVQS 353
               S  + K  T  VV S
Sbjct: 223 CVPTSEGISKATTETVVHS 241


>gi|39996998|ref|NP_952949.1| transporter [Geobacter sulfurreducens PCA]
 gi|39983886|gb|AAR35276.1| transporter, putative [Geobacter sulfurreducens PCA]
 gi|298506015|gb|ADI84738.1| transporter membrane protein of unknown function DUF140 [Geobacter
           sulfurreducens KN400]
          Length = 257

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 117/211 (55%), Gaps = 2/211 (0%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L S+  QM  +G   VP+  +++F  G V+A Q   +L ++G +     ++ +  +RE+G
Sbjct: 39  LPSIFNQMAIIGYETVPIASVMAFFVGMVLALQTGVELQKYGTQNIIGGIVGLSMVRELG 98

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            ++T+ ++AGR GSA+ AEIG MK+ EEIDA++T+ ++ VR L  PR+ A ++ +P L I
Sbjct: 99  PVMTSFLVAGRVGSAMAAEIGVMKVYEEIDALKTLDINPVRYLAMPRLIACLVCVPALVI 158

Query: 273 LANFSAIIGASIVIWKYYD--IPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
            AN   I+G +I+   +    I ++ ++    +   L  +  GL+KA      I +VA  
Sbjct: 159 FANAVGIVGGAIMSHLHPKIFISYSTYYDSLKTALKLKEVGAGLVKATVFGGIIALVACY 218

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            GF     +  + +  T  VV S  ++++ D
Sbjct: 219 TGFKTSGGARGIAQATTRAVVLSFMLILVAD 249


>gi|257465526|ref|ZP_05629897.1| permease [Actinobacillus minor 202]
 gi|257451186|gb|EEV25229.1| permease [Actinobacillus minor 202]
          Length = 260

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 118/206 (57%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VGV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++
Sbjct: 43  LIKQLYVVGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFAAETSLGTLVSLSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L ++  
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPILAVIFT 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S   ++ + +++  G IK+   A A+  +A+  G+  
Sbjct: 163 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSASDLINGFIKSIIFAFAVVWIALFNGYDS 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + +  T  VV +  +++ +D
Sbjct: 223 TATSEGISQATTKTVVNASLVILGLD 248


>gi|219870961|ref|YP_002475336.1| resistance to organic solvents ABC transporter permease
           [Haemophilus parasuis SH0165]
 gi|219691165|gb|ACL32388.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Haemophilus parasuis
           SH0165]
          Length = 257

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 121/216 (56%), Gaps = 4/216 (1%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I+Q++ +GV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++T
Sbjct: 43  IKQLHVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVSLSLLRELGPVVT 102

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA II++P+L ++   
Sbjct: 103 ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGIIAMPILAVIFTA 162

Query: 277 SAIIGASI--VIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
             I G S+  V WK  D+    F+S   ST T+ ++  G IK+   A A+  +A+  G+ 
Sbjct: 163 IGIWGGSLVGVDWKGVDV--GSFWSVMQSTVTMGDLLNGFIKSIVFAFAVVWIALFNGYD 220

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +  +++ +D +     F 
Sbjct: 221 ALPTSEGISQATTRTVVHASLVILGLDFILTAIMFG 256


>gi|254513828|ref|ZP_05125889.1| ABC transporter permease protein [gamma proteobacterium NOR5-3]
 gi|219676071|gb|EED32436.1| ABC transporter permease protein [gamma proteobacterium NOR5-3]
          Length = 369

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 175/338 (51%), Gaps = 19/338 (5%)

Query: 42  VDLSAITEIDT-IGAELIMYFMEKYHGKIKLQ--GVSTHIEQLFSLISFTHRKKIKNQKP 98
           VD++++T  D  + A+L+      Y G+ +L+  G      QLF L +            
Sbjct: 45  VDVTSVTVWDPRLEAKLLHLQRLAYAGQRQLELLGTPDSQTQLFKLATAVAPYAGTAATS 104

Query: 99  QRSFFYNSFKNLHYHIGKKIVK---FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
              F   + ++    IG  +++   F+  + S   +L  ++  +G       + + F+ S
Sbjct: 105 SGLFTLKNLRSTLADIGDDLLESLEFLGATTS--AVLRTLLGRSG------MRRREFIES 156

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L +     G   + ++ L S + G ++A  GA QL QFGA +F  DL++I  LRE+G L+
Sbjct: 157 LAQ----AGPQAMGIITLTSVLVGMILAYLGAAQLQQFGAAVFVADLVAIGMLREMGALM 212

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+++AGR+G+A  A++ +M+ NEEIDAI T+G++ +  L+ PR+ AL++ +PLL + A+
Sbjct: 213 TAIVMAGRTGAAYAAQLSTMQTNEEIDAITTLGINPLEFLVVPRMLALLLMMPLLVVYAD 272

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I+G ++V       P   + S+  S  T+ +   G++K    A  I I   + G   
Sbjct: 273 ALGIVGGAVVAGGMGVTPLQ-YISQLDSAITITHFLVGVVKGLIFALLIAIAGCRAGMNA 331

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G +S ++G+  T  VV ++  +I+ D+   I    +GI
Sbjct: 332 GRNSEAVGRATTEAVVTAVVYLIVADAAINILCQLLGI 369


>gi|114332197|ref|YP_748419.1| hypothetical protein Neut_2236 [Nitrosomonas eutropha C91]
 gi|114309211|gb|ABI60454.1| protein of unknown function DUF140 [Nitrosomonas eutropha C91]
          Length = 381

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 94/383 (24%), Positives = 193/383 (50%), Gaps = 34/383 (8%)

Query: 2   SENGITVFRFAGNWK----SPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAEL 57
           +E G +  +  G++     +P +  +A ++    ++         DL+ I ++D  GA +
Sbjct: 18  TEAGNSCLQLTGSYTLVSLNPSLPAVARELAQLASQP----GLYWDLTNIHQLDYAGAVM 73

Query: 58  IMY-FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKP-QRSFFYNSFKNLHYHIG 115
           +   + E+    + L+      EQ+F  +     K +   +P QR +F          +G
Sbjct: 74  LWQIWGEQRPDHLLLR---PEQEQMFQRL----EKVVSLPEPTQRKWFLPVSL-----LG 121

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCAS-----SYKFKGFLLSLIRQMYYVGVSGVPV 170
           +++++F +      H+ G+ IS +G+         ++  +  +  +   +Y  G   + +
Sbjct: 122 QQLLRFFD------HLAGM-ISLSGQIVLDIVYLMTHPSRIPVREISANLYRTGAQALGI 174

Query: 171 VILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVA 230
             ++ F+ G V++   + QL   GA+I+ ++++ +  +RE+G +L A+++AGRSGSA+ A
Sbjct: 175 TAIVGFLIGIVLSYLSSEQLHMLGADIYIVNILGMSIIRELGPMLAAILVAGRSGSAMTA 234

Query: 231 EIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYY 290
           ++G M++ EE+DA+  MG+     L+  +I  L ++LPL+ +  +  A++G  +      
Sbjct: 235 QLGVMRVTEELDALTVMGIPHSLRLVLSKIIGLSLALPLIVLWTSSVALLGGLLAADLQV 294

Query: 291 DIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCV 350
            +      +       +AN++ GL K      AI ++A   G  +  ++ SLG+  T  V
Sbjct: 295 GLSIRYAVTTLPDAVPIANLWLGLGKGVVCGMAIALIACHFGLRIKPNTESLGEGTTNSV 354

Query: 351 VQSISIVIIIDSLFAIFYFAIGI 373
           V SI+ VIIID++FA+ + +IGI
Sbjct: 355 VTSITAVIIIDAIFAVAFSSIGI 377


>gi|240948315|ref|ZP_04752701.1| permease [Actinobacillus minor NM305]
 gi|240297354|gb|EER47895.1| permease [Actinobacillus minor NM305]
          Length = 258

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 120/215 (55%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VGV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++
Sbjct: 43  LIKQLYVVGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFAAETSLGTLVSLSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L ++  
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPILAVIFT 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S   ++ + +++  G IK+   A A+  +A+  G+  
Sbjct: 163 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSASDLINGFIKSIIFAFAVVWIALFNGYDS 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
              S  + +  T  VV +  +++ +D +     F 
Sbjct: 223 TATSEGISQATTKTVVNASLVILGLDFILTAIMFG 257


>gi|239904657|ref|YP_002951395.1| putative ABC transporter permease protein [Desulfovibrio magneticus
           RS-1]
 gi|239794520|dbj|BAH73509.1| putative ABC transporter permease protein [Desulfovibrio magneticus
           RS-1]
          Length = 256

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 66/208 (31%), Positives = 119/208 (57%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I  + +VG   + +V +I+   G +++ Q A QL + GA  +  +L+    + E+G LLT
Sbjct: 41  ISHLAWVGADSLAIVSVIAACVGIILSLQAAIQLEKVGAMSYVANLVGFSLVTELGPLLT 100

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            ++++GR+G+A  AEI +M+I+EEIDA+  MG+D VR L+ P+  A+ +  PLLT+ A+ 
Sbjct: 101 CLILSGRAGAAFTAEIATMRISEEIDALAVMGIDPVRFLVWPKFVAMAVMAPLLTLWADA 160

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
             I    I       +   V+F++        ++ +GL+K+     AI +++  +GF   
Sbjct: 161 VGITAGGIFSSLALGLSGKVYFNQIAYFLGFKDLLSGLVKSAGFGVAITVISCWQGFLAR 220

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +  +G++ T  VVQSI ++I++D  F
Sbjct: 221 EGAADVGRRTTAAVVQSIFVMILLDLFF 248


>gi|167854684|ref|ZP_02477464.1| hypothetical protein HPS_01292 [Haemophilus parasuis 29755]
 gi|167854221|gb|EDS25455.1| hypothetical protein HPS_01292 [Haemophilus parasuis 29755]
          Length = 258

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 121/216 (56%), Gaps = 4/216 (1%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I+Q++ +GV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++T
Sbjct: 44  IKQLHVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVSLSLLRELGPVVT 103

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA II++P+L ++   
Sbjct: 104 ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGIIAMPILAVIFTA 163

Query: 277 SAIIGASI--VIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
             I G S+  V WK  D+    F+S   ST T+ ++  G IK+   A A+  +A+  G+ 
Sbjct: 164 IGIWGGSLVGVDWKGVDV--GSFWSVMQSTVTMGDLLNGFIKSIVFAFAVVWIALFNGYD 221

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +  +++ +D +     F 
Sbjct: 222 ALPTSEGISQATTRTVVHASLVILGLDFILTAIMFG 257


>gi|315635512|ref|ZP_07890778.1| ABC superfamily ATP binding cassette transporter, permease protein
           [Arcobacter butzleri JV22]
 gi|315480270|gb|EFU70937.1| ABC superfamily ATP binding cassette transporter, permease protein
           [Arcobacter butzleri JV22]
          Length = 285

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 85/135 (62%), Gaps = 4/135 (2%)

Query: 142 FCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSID 201
           F  S  +FK     +++ +       + +V + SF+ G VIA QG+ QL +FGA IF ++
Sbjct: 143 FNPSKIRFKA----MLKYIETSAFDALLIVAVTSFLVGVVIAYQGSVQLEKFGANIFIVE 198

Query: 202 LMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIW 261
           ++SI   REI  L+TA++IAGRS S+  AEIG+MKI EEIDA++TM  +    L  PRI+
Sbjct: 199 MISITMFREIAPLVTAIVIAGRSASSYTAEIGAMKITEEIDAMKTMNFEPTLFLTLPRIF 258

Query: 262 ALIISLPLLTILANF 276
           AL ISLPLL     +
Sbjct: 259 ALCISLPLLVFFCRY 273


>gi|238650558|ref|YP_002916410.1| ABC transporter permease protein [Rickettsia peacockii str. Rustic]
 gi|238624656|gb|ACR47362.1| ABC transporter permease protein [Rickettsia peacockii str. Rustic]
          Length = 259

 Score =  114 bits (284), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 140/266 (52%), Gaps = 13/266 (4%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG--FLLSLIRQMYYVGVS 166
           N+   +GK+ VKF     S +            F A S   +   +L  +IRQ+ ++G  
Sbjct: 4   NIANSVGKRTVKFAQSVGSFSLF---------SFAAVSSIIRPPLYLSLIIRQLLFIGFH 54

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMIAGRSG 225
            +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +L  +M+AGR G
Sbjct: 55  SLPVVAMTTFFSGAVLALQSYIGFSRFSAES-SIATVVVLSLTRELGPVLAGLMVAGRVG 113

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           ++I AEI +M++ E++DA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V
Sbjct: 114 ASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLV 173

Query: 286 IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKK 345
                D   A + +         ++ +GL+KA      I I++   G+  G  +  +G+ 
Sbjct: 174 GVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRA 233

Query: 346 VTTCVVQSISIVIIIDSLFAIFYFAI 371
            T+ VV +  +++I + L    +F +
Sbjct: 234 TTSAVVNASILILISNYLITELFFKV 259


>gi|302185305|ref|ZP_07261978.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. syringae 642]
          Length = 265

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CDPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|78357340|ref|YP_388789.1| hypothetical protein Dde_2297 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219745|gb|ABB39094.1| Protein of unknown function DUF140 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 270

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 123/217 (56%), Gaps = 5/217 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +++Q+Y++G   + V+ LI   TG V+  QG + L +FG+E      +++  +RE+G +L
Sbjct: 52  VVQQVYFIGSKSLFVIALIGIFTGMVLGLQGYYTLVKFGSEGLLGAAVALTLIRELGPVL 111

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GSA+ AEIG M+I+++IDA+  M +  +  L++PR+ A +I  P+LT L N
Sbjct: 112 TAIMVTGRAGSAMAAEIGVMRISDQIDALEVMDVPPMGYLVTPRLLASLIVFPMLTALFN 171

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              IIG  +       I   V+F R  S+   +++  G +K    A  + I++  +G+  
Sbjct: 172 TIGIIGGYLTGVVLLGINSGVYFYRIDSSVGWSDVSGGFLKTMVFAVIVSIISCYQGYFT 231

Query: 336 GVHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
            +  + +G +      T+ VV S  +V++ D +   F
Sbjct: 232 HMRKDGMGPEGVSNSTTSAVVMSCVLVLVSDYVLTSF 268


>gi|330446812|ref|ZP_08310463.1| mlaE [Photobacterium leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491003|dbj|GAA04960.1| mlaE [Photobacterium leiognathi subsp. mandapamensis svers.1.1.]
          Length = 260

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 127/232 (54%), Gaps = 2/232 (0%)

Query: 140 GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFS 199
           G   +     K F L L++Q+Y VGV  + ++++     G V++ QG   L+ FGAE   
Sbjct: 29  GALVSKPQPVKMFPL-LMKQLYSVGVLSMAIILVSGLFIGMVLSLQGYIVLADFGAETSL 87

Query: 200 IDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPR 259
             ++++  LRE+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR
Sbjct: 88  GQMVALSLLRELGPVVTALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVIAPR 147

Query: 260 IWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAP 318
            WA +IS+PLL ++ +   + GA IV   +  I +  F+S   S+   + +I   +IKA 
Sbjct: 148 FWAGVISMPLLALMFSVVGLWGAQIVGVDWKGIDYGSFWSVMQSSVNFSYDIGNSIIKAV 207

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             A  +  +A+  G+     S  + +  T  VV S   V+ +D +     F 
Sbjct: 208 VFAITVTWIAVFNGYDAVPTSEGISRATTRTVVNSSLAVLGLDFILTALMFG 259


>gi|126663828|ref|ZP_01734823.1| ABC transporter, permease [Flavobacteria bacterium BAL38]
 gi|126624092|gb|EAZ94785.1| ABC transporter, permease [Flavobacteria bacterium BAL38]
          Length = 261

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/221 (32%), Positives = 120/221 (54%), Gaps = 4/221 (1%)

Query: 141 EFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSI 200
           EF    Y+FK FL    RQ Y++G   + +V +  F+ G V   Q    L +FGA  +  
Sbjct: 32  EFWKPPYEFKEFL----RQCYFIGNRSLFLVGVTGFIIGLVFTLQSRPTLQEFGAVSWMA 87

Query: 201 DLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRI 260
            ++S+  +REIG ++TA++ AGR GS I AE+GSMK+ E+IDA+   G +  + L+  RI
Sbjct: 88  SMVSVSIIREIGPIITALICAGRIGSGIGAELGSMKVTEQIDAMEVSGTNPFKYLVITRI 147

Query: 261 WALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFM 320
            A  + LPLL I  +  AI G+ +V     ++ F ++F++  +    +++    +K  F 
Sbjct: 148 LATSLMLPLLVIFGDVLAIYGSYLVENVKDNVSFQLYFNQVFNILEFSDLIPATLKTFFF 207

Query: 321 ACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             AIG++   +G+     +  +GK     VV +  ++ +ID
Sbjct: 208 GFAIGLIGCYKGYYCKKGTAGVGKAANEAVVYTSMLLFVID 248


>gi|330950264|gb|EGH50524.1| hypothetical protein PSYCIT7_02422 [Pseudomonas syringae Cit 7]
          Length = 265

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|283779915|ref|YP_003370670.1| hypothetical protein Psta_2136 [Pirellula staleyi DSM 6068]
 gi|283438368|gb|ADB16810.1| protein of unknown function DUF140 [Pirellula staleyi DSM 6068]
          Length = 289

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 121/223 (54%), Gaps = 13/223 (5%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           +L+   Y VGV  +PV+ L     G V+A Q  F     G E     ++++  +RE+G +
Sbjct: 61  TLLPNFYQVGVLSLPVIALTGTFIGMVLAVQSYFTFRDLGLETRMGAVINMTLVRELGPV 120

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           L A M+AGR G A+ AE+G+M++ E+IDA+ +MG D +  L+ PR  A +  +P LTI+A
Sbjct: 121 LAATMLAGRVGCAMAAELGTMRVTEQIDALESMGADPIYYLVVPRFLACLFLIPTLTIMA 180

Query: 275 NFSAIIGASIVIWKYYDIPFAV--FFSRFHSTATLAN--IFTGLIKAPFMACAIGIVAMK 330
           +F  ++G     + Y  +  ++      ++S   + N  +F+G++K+ F   AI +V+  
Sbjct: 181 DFMGVVGG----YFYSTVVLSIDKHHYWYNSEQFVGNFDLFSGILKSLFFGAAIAVVSCY 236

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIID-----SLFAIFY 368
            GF     +  +G+  T   V S  ++++ID      L+ ++Y
Sbjct: 237 RGFHCTPGAEGVGRAATAAFVHSFVLILVIDLFLGKMLYTLYY 279


>gi|83309431|ref|YP_419695.1| ABC-type transport system [Magnetospirillum magneticum AMB-1]
 gi|82944272|dbj|BAE49136.1| ABC-type transport system [Magnetospirillum magneticum AMB-1]
          Length = 271

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 117/212 (55%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L  ++ Q   +G+  +P+V ++S   G ++A QG + L  FGAE      +++  +RE G
Sbjct: 54  LAPVVAQAMEIGIGALPIVTVLSATIGIMLAIQGIYTLRLFGAESRVSLGVAMSVVREFG 113

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            L+T +++AGRSGSA+ A +G+M+IN+EIDA+  MG+  VR L+ P + A++  LP LT+
Sbjct: 114 PLITGILVAGRSGSALAARLGTMRINQEIDALTVMGVSPVRFLVVPPLLAMMAMLPALTL 173

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
            ++   +  A + I          +         L +I+ GL K+   +  I +V +  G
Sbjct: 174 WSDLVGLFAAGLYIAPQLGSSMGAYVDEMTDLVRLNDIWHGLGKSAIFSVLITVVGVVNG 233

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +V   +  +G+  T  VV +IS ++I D +F
Sbjct: 234 ASVTGGAEGVGRMTTRSVVHAISAIVITDMIF 265


>gi|91206155|ref|YP_538510.1| ABC transporter permease protein [Rickettsia bellii RML369-C]
 gi|157826543|ref|YP_001495607.1| ABC transporter permease protein [Rickettsia bellii OSU 85-389]
 gi|122425169|sp|Q1RGU3|Y1340_RICBR RecName: Full=Probable ABC transporter permease protein RBE_1340
 gi|91069699|gb|ABE05421.1| ABC transporter permease protein [Rickettsia bellii RML369-C]
 gi|157801847|gb|ABV78570.1| ABC transporter permease protein [Rickettsia bellii OSU 85-389]
          Length = 259

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 125/217 (57%), Gaps = 2/217 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVL 214
           +I+Q+ ++G   +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +
Sbjct: 44  IIKQLLFIGFYSLPVVAMTTFFSGAVLALQSYTGFSRFSAE-SSIATVVVLSLTRELGPV 102

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           L  +M+AGR G++I AEIG+M++ E++DA+ T+  D ++ L+ P++ A II++P L ++ 
Sbjct: 103 LAGLMVAGRVGASIAAEIGTMRVTEQVDALYTLSTDSIKYLVFPKVIAAIITMPCLVLIG 162

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           +   ++G  +V     D   + + +         ++ +GL+KA      I I++   G+ 
Sbjct: 163 DVIGVMGGYLVGVYKLDFNSSTYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYY 222

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            G  +  +G+  T+ VV S  +++I + L    +F +
Sbjct: 223 SGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV 259


>gi|66047367|ref|YP_237208.1| hypothetical protein Psyr_4140 [Pseudomonas syringae pv. syringae
           B728a]
 gi|289676091|ref|ZP_06496981.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. syringae FF5]
 gi|63258074|gb|AAY39170.1| Protein of unknown function DUF140 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330895265|gb|EGH27603.1| hypothetical protein PSYJA_00595 [Pseudomonas syringae pv. japonica
           str. M301072PT]
 gi|330937995|gb|EGH41776.1| hypothetical protein PSYPI_04838 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330969694|gb|EGH69760.1| hypothetical protein PSYAR_04288 [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 265

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|88861156|ref|ZP_01135790.1| putative transport protein (ABC superfamily, membrane)
           [Pseudoalteromonas tunicata D2]
 gi|88816878|gb|EAR26699.1| putative transport protein (ABC superfamily, membrane)
           [Pseudoalteromonas tunicata D2]
          Length = 259

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 70/199 (35%), Positives = 117/199 (58%), Gaps = 1/199 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VG   + ++++     G V+A QG   L  +GAE     L+++  LRE+G ++
Sbjct: 43  LIKQLYMVGFLSLMIIVVSGLFIGMVLALQGYTVLVDYGAEDSLGPLVALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D ++ +I+PR WA IIS+PLL ++ +
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLKRIIAPRFWAGIISMPLLALIFS 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
             AI+GA +V   +  I    F+S   +  +   +I  G+IK+   A  +  +A+ +G+ 
Sbjct: 163 AVAILGAHLVGVDWLGIDSGSFWSVMQAQVSFEKDILNGMIKSLVFAFVVTWIALYKGYF 222

Query: 335 VGVHSNSLGKKVTTCVVQS 353
               S  + K  T  VVQS
Sbjct: 223 CIPTSEGISKATTETVVQS 241


>gi|23016441|ref|ZP_00056197.1| COG0767: ABC-type transport system involved in resistance to
           organic solvents, permease component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 271

 Score =  113 bits (282), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 118/212 (55%)

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
           L  ++ Q   +G+  +P+V ++S   G ++A QG + L  FGAE      +++  +RE G
Sbjct: 54  LAPVVAQAMEIGIGALPIVTVLSATIGIMLAIQGIYTLRLFGAESRVSLGVAMSVVREFG 113

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
            L+T +++AGRSGSA+ A +G+M+IN+EIDA+  MG+  VR L+ P + A+++ LP LT+
Sbjct: 114 PLITGILVAGRSGSALAARLGTMRINQEIDALTVMGVSPVRFLVVPPLLAMMVMLPALTL 173

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
            ++   +  A + I          +         L +++ GL K+   +  I +V +  G
Sbjct: 174 WSDLVGLFAAGLYIAPQLGSSMGAYVDEMTDLVRLNDVWHGLGKSAIFSVLITLVGVVNG 233

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +V   +  +G+  T  VV +IS +++ D +F
Sbjct: 234 ASVTGGAEGVGRLTTRSVVHAISAIVVTDMIF 265


>gi|317484538|ref|ZP_07943446.1| hypothetical protein HMPREF0179_00797 [Bilophila wadsworthia 3_1_6]
 gi|316924199|gb|EFV45377.1| hypothetical protein HMPREF0179_00797 [Bilophila wadsworthia 3_1_6]
          Length = 388

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 65/204 (31%), Positives = 114/204 (55%)

Query: 164 GVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGR 223
           GV  +P+V LIS + G ++A  G  QL  FGAEI+   L+++   R +G ++T +++AGR
Sbjct: 179 GVDALPIVSLISLLVGLILAFVGVIQLKMFGAEIYVSSLVAVSMTRIMGAIMTGIILAGR 238

Query: 224 SGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGAS 283
           +G++  A IG+M++NEEIDA+ T+G+     LI PR+ AL    PLL + ++F  I+G  
Sbjct: 239 TGASYAAVIGTMQVNEEIDALTTLGVAPSDYLIMPRVLALTAMTPLLVLYSDFMGIMGGF 298

Query: 284 IVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLG 343
           IV      +    +++       + N++ G++        I I    +G   G ++ ++G
Sbjct: 299 IVGVGILGLDPMEYYTFTQKGFNINNLWVGMVHGAVYGMLIAITGCYQGLRCGRNAEAVG 358

Query: 344 KKVTTCVVQSISIVIIIDSLFAIF 367
           K  T+ VV SI  +++  ++  I 
Sbjct: 359 KATTSAVVYSIVGIVLSTAVLTIL 382


>gi|294788757|ref|ZP_06753998.1| putative membrane protein [Simonsiella muelleri ATCC 29453]
 gi|294483239|gb|EFG30925.1| putative membrane protein [Simonsiella muelleri ATCC 29453]
          Length = 258

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 123/217 (56%), Gaps = 3/217 (1%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQF-GAEIFSIDLMSILQLREIGVL 214
           +IRQMY+ GV  + ++ +     G V+  QG  QL++F  A++    + + L LRE+G +
Sbjct: 42  MIRQMYFSGVLSILIIAVSGLFVGMVLGLQGYTQLAKFKAADVLGFMVAAAL-LRELGPV 100

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           L A++ A  SG A+ +EIG MK  E+++A+  M ++ V  +++PR WA ++S+PLL  + 
Sbjct: 101 LAAILFASSSGGAMTSEIGLMKTTEQLEAMNVMAINPVARVVAPRFWAGVVSMPLLASIF 160

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGF 333
           N + I G  +V  ++  +   VF+S   ++ T + ++  GLIK+     A+ ++A+ +GF
Sbjct: 161 NVAGIWGGYLVGVQWLGLDSGVFWSHMQNSMTFSYDVLNGLIKSMIFGTAVSLIAVYQGF 220

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
                +  + +  T  VV S   V+ +D +   F FA
Sbjct: 221 HCRPTAEGILRASTRTVVSSALTVLALDFILTAFMFA 257


>gi|239947145|ref|ZP_04698898.1| membrane protein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921421|gb|EER21445.1| membrane protein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 261

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 142/266 (53%), Gaps = 9/266 (3%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGV 168
           N+   +GK+ +KF     S +  +   +S       S  +   +L  +IRQ+ ++G   +
Sbjct: 4   NIANSVGKRTIKFAQSVGSFSLFIFAAVS-------SIIRPPLYLSLIIRQLLFIGFHSL 56

Query: 169 PVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMIAGRSGSA 227
            VV + +F +GAV+A Q     S+F AE  SI  + IL L RE+G +L  +M+AGR G++
Sbjct: 57  SVVAMTTFFSGAVLALQSYTGFSRFSAE-SSIATVVILSLTRELGPVLAGLMVAGRVGAS 115

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
           I AEI +M++ E++DA+ T+  D ++ L+ PR+ A II++P L ++ +   ++G  +V  
Sbjct: 116 IAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVIAAIITMPCLVLIGDIIGVMGGYLVGV 175

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
              D   A + +         ++ +GL+KA      I I++   G+  G  +  +G+  T
Sbjct: 176 YKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATT 235

Query: 348 TCVVQSISIVIIIDSLFAIFYFAIGI 373
           + VV S  +++I + L    +F + I
Sbjct: 236 SAVVNSSILILISNYLITELFFKVQI 261


>gi|313891881|ref|ZP_07825486.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
 gi|313119875|gb|EFR43062.1| conserved hypothetical protein [Dialister microaerophilus UPII
           345-E]
          Length = 253

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 116/212 (54%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
           +Q   +GV+  P+V L    TG V + Q   +L ++GAE  +  +++I   RE+G +L  
Sbjct: 42  KQCLLLGVNSFPIVFLTLLFTGMVFSAQIVGELVKYGAEFTAGSIVAIGLGRELGPVLCG 101

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           V++AGR G+AI AE+G+M++ E+IDA+R M +D V  L+ PR+ A +I LP+L + A  +
Sbjct: 102 VVLAGRVGAAITAELGTMRVTEQIDALRCMAVDPVEYLVLPRVIACMIMLPILDVFAVTT 161

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            + G  IV     +I   +++    S    ++++ G+IK  F    I +     G     
Sbjct: 162 GVGGGMIVASVTGNISSHMYWDSITSFCVASDLYIGMIKTVFFGMIIALTGCDRGLTCET 221

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
            +  +GK  T  VV S+ ++ I++ + +   F
Sbjct: 222 GAEGVGKATTQSVVYSMIMIFIVNYILSTILF 253


>gi|238899004|ref|YP_002924686.1| putative ABC transporter, permease protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|229466764|gb|ACQ68538.1| putative ABC transporter, permease protein [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 261

 Score =  112 bits (281), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 120/218 (55%), Gaps = 6/218 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVL 214
           LI+Q+Y VGV  + ++++     G V+  QG   L+ +GAE  S+ ++  L L RE+G +
Sbjct: 45  LIKQLYRVGVQSILIIVISGLFIGMVLGLQGYLTLTTYGAE-GSLGMLVALSLFRELGPV 103

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           ++A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +ISLPLL  L 
Sbjct: 104 VSALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLRRVIAPRFWAGVISLPLLAALF 163

Query: 275 NFSAIIGASIVI--WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
               I G+S+V   WK  D  F  F+S  H +   +++     K+   A  I  +++  G
Sbjct: 164 ISVGIFGSSMVAIDWKGIDAGF--FWSAMHDSVMPSDVINCFFKSVSFAVIITWISVFNG 221

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +     S  +    T  VV S   V+ +D L  +  F 
Sbjct: 222 YDATPTSEGISLATTRTVVNSSLAVLAVDFLLTVLMFG 259


>gi|297537487|ref|YP_003673256.1| hypothetical protein M301_0292 [Methylotenera sp. 301]
 gi|297256834|gb|ADI28679.1| protein of unknown function DUF140 [Methylotenera sp. 301]
          Length = 268

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 141/259 (54%), Gaps = 8/259 (3%)

Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           IG ++V+ I    + A +  L I  +GE       FK F L++ R++Y  GV  + ++I+
Sbjct: 17  IGHRMVERIWRLGAGARLFFLTIVYSGE------SFKRFHLTM-REIYSTGVMSLLIIIV 69

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
            +F  G V+A QG   L ++G+      L+S+  +RE+G ++TA++ AGR+G+AI AEIG
Sbjct: 70  SAFFVGMVLALQGYNTLQKYGSSEAIGVLVSLSLVRELGPVVTALLFAGRAGTAITAEIG 129

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
            MK  E++ A+  M ++ +  +++PR WA +IS+P+L  L +   I+G  IV      + 
Sbjct: 130 LMKTTEQLSAMEMMAVNPIARVVAPRFWAGVISMPILATLFSMVGILGGYIVAVPLIGVD 189

Query: 294 FAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQ 352
              F+S+  ++    ++I  G+IK+     A  ++A+ EGF     +  + +  T  VV 
Sbjct: 190 EGAFWSQMQASVDFQSDIVNGIIKSLVFGVACTMIALFEGFDAPPTAEGVSRATTRTVVI 249

Query: 353 SISIVIIIDSLFAIFYFAI 371
           S   V+ +D +   F   I
Sbjct: 250 SSLTVLGLDFVLTSFMLVI 268


>gi|298488498|ref|ZP_07006528.1| permease component of an ABC superfamily transporter [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156839|gb|EFH97929.1| permease component of an ABC superfamily transporter [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 265

 Score =  112 bits (281), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  IS+P+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISMPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CDPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|86159557|ref|YP_466342.1| hypothetical protein Adeh_3136 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776068|gb|ABC82905.1| protein of unknown function DUF140 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 386

 Score =  112 bits (280), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 110/211 (52%)

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
           + G   +P+V L+SF+ G ++A  G  QL  FGAE F  D++ I  +R++  L+T V +A
Sbjct: 175 HSGAEALPIVALVSFLVGIILAFVGITQLRFFGAEAFVADIVGIAIVRDMAALITGVTLA 234

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GRSG A  A++ +M + +EIDA+RT+G+  V  L+ PR+ AL   +PLLT+ A+ S I+G
Sbjct: 235 GRSGGAFAAQLATMNVTQEIDALRTLGISPVEYLVVPRVLALTAMMPLLTLFADASGILG 294

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNS 341
            ++V       P A +  +        ++  GL+K       I +     G      +  
Sbjct: 295 GAMVGTTMLHQPLAGYLHQTALALVPGDLAGGLVKGATYGLLIALTGAFRGMQAERSAER 354

Query: 342 LGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           +G+  T  VV  I  +I    ++   +F  G
Sbjct: 355 VGEAATQAVVTGIVAIISACGVYQYVFFLFG 385


>gi|157964160|ref|YP_001498984.1| ABC transporter permease protein [Rickettsia massiliae MTU5]
 gi|157843936|gb|ABV84437.1| ABC transporter permease protein [Rickettsia massiliae MTU5]
          Length = 264

 Score =  112 bits (280), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 77/266 (28%), Positives = 139/266 (52%), Gaps = 13/266 (4%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKG--FLLSLIRQMYYVGVS 166
           N+   +GK+ +KF     S +            F A S   +   +L  +IRQ+  +G  
Sbjct: 9   NIANSVGKRTIKFAQSVGSFSLF---------SFAAVSSIIRPPLYLSLIIRQLLLIGFH 59

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVLLTAVMIAGRSG 225
            +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +L  +M+AGR G
Sbjct: 60  SLPVVAMTTFFSGAVLALQSYTGFSRFSAE-SSIATVVVLSLTRELGPVLAGLMVAGRVG 118

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           ++I AEI +M++ E++DA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V
Sbjct: 119 ASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLV 178

Query: 286 IWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKK 345
                D   A + +         ++ +GL+KA      I I++   G+  G  +  +G+ 
Sbjct: 179 GVYKLDFNSAAYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRA 238

Query: 346 VTTCVVQSISIVIIIDSLFAIFYFAI 371
            T+ VV S  +++I + L    +F +
Sbjct: 239 TTSAVVNSSILILISNYLITELFFKV 264


>gi|71736723|ref|YP_276266.1| toluene tolerance proteinTtg2B [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257483485|ref|ZP_05637526.1| toluene tolerance proteinTtg2B, putative [Pseudomonas syringae pv.
           tabaci ATCC 11528]
 gi|289627577|ref|ZP_06460531.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. aesculi str. NCPPB3681]
 gi|289647003|ref|ZP_06478346.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. aesculi str. 2250]
 gi|71557276|gb|AAZ36487.1| toluene tolerance proteinTtg2B, putative [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|330869989|gb|EGH04698.1| toluene tolerance proteinTtg2B [Pseudomonas syringae pv. aesculi
           str. 0893_23]
 gi|330987098|gb|EGH85201.1| toluene tolerance proteinTtg2B [Pseudomonas syringae pv. lachrymans
           str. M301315]
          Length = 265

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  IS+P+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISMPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|113476613|ref|YP_722674.1| hypothetical protein Tery_3053 [Trichodesmium erythraeum IMS101]
 gi|110167661|gb|ABG52201.1| protein of unknown function DUF140 [Trichodesmium erythraeum
           IMS101]
          Length = 249

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/198 (35%), Positives = 108/198 (54%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I QM  VG   + +V+L +   G V   Q A +L  FG       ++++   RE+G +LT
Sbjct: 26  IEQMAIVGPESLLIVLLTASFVGMVFTIQVARELVAFGTANMVGGMLALTLSRELGPVLT 85

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           AV++AGR GSA  AEIG+MK+ E+IDA+  +  D V  L+ PR+ A  + +P+LT+L   
Sbjct: 86  AVVVAGRVGSAFAAEIGTMKVTEQIDALYILKTDPVDYLVIPRVIACGVMMPILTLLCLV 145

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
           +AI G  I+    YDIP +++     S  TL ++ +GL K+      I ++    G    
Sbjct: 146 AAIFGGLIIAVNLYDIPQSMYIDSVRSFLTLWDLCSGLTKSVVFGVLIAVIGTSWGLTTT 205

Query: 337 VHSNSLGKKVTTCVVQSI 354
             +  +GK  TT VV S+
Sbjct: 206 GGAKGVGKSTTTAVVTSL 223


>gi|297621446|ref|YP_003709583.1| putative permease component of ABC transporter [Waddlia
           chondrophila WSU 86-1044]
 gi|297376747|gb|ADI38577.1| putative permease component of ABC transporter [Waddlia
           chondrophila WSU 86-1044]
          Length = 274

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/212 (33%), Positives = 118/212 (55%), Gaps = 1/212 (0%)

Query: 156 LIR-QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           LIR QMY +GV  +PVV +  F TG V+A Q  FQL+  G    +  +++   + E+G +
Sbjct: 46  LIRNQMYEIGVLSLPVVAITGFSTGMVLAAQSFFQLADKGLASATGLMVAKAMMVELGPV 105

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA M+ GR G+++ AE+G+MK+ E+IDA+++M ++ +  LI+PR  A  + LPLLT+ +
Sbjct: 106 LTAFMVTGRVGASMCAELGTMKVTEQIDALKSMTVNPLGYLIAPRFIAGTLMLPLLTVFS 165

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I G  ++   +Y +P   F        T  + F+GL+KA      I  ++  +G  
Sbjct: 166 TVMGIGGGYMIAVWFYKMPSNTFLDPLPINITNFDFFSGLVKAISFGIVIVTISCYKGMT 225

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
               +  +G+  T  VV   S+++I + L  +
Sbjct: 226 TRGGAAGVGRATTNSVVICYSVILIGNFLLTV 257


>gi|320330045|gb|EFW86032.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. glycinea str. race 4]
          Length = 265

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  IS+P+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISMPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|332038535|gb|EGI74978.1| uncharacterized ABC transporter, permease component YrbE
           [Pseudoalteromonas haloplanktis ANT/505]
          Length = 259

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 69/199 (34%), Positives = 115/199 (57%), Gaps = 1/199 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VG   + ++++     G V+A QG   L  +GAE     L+++  LRE+G ++
Sbjct: 43  LVRQLYMVGSQSLLIIMVSGLFIGMVLALQGYTVLVGYGAEDSLGPLVALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D ++ +I+PR WA  IS+PLL ++ +
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLKRIIAPRFWAGFISMPLLALIFS 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
             AIIGA +V   +  +    F+S   S  +   +I  G+IK+   A  +  +A+ +G+ 
Sbjct: 163 AVAIIGAHLVGVDWLGVDTGSFWSIMQSQVSFQQDILNGIIKSFVFAIVVTWIALYKGYD 222

Query: 335 VGVHSNSLGKKVTTCVVQS 353
               S  + K  T  VV S
Sbjct: 223 CVPTSEGISKATTETVVHS 241


>gi|331011542|gb|EGH91598.1| toluene tolerance proteinTtg2B [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 265

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  IS+P+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISMPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|330888613|gb|EGH21274.1| toluene tolerance proteinTtg2B [Pseudomonas syringae pv. mori str.
           301020]
          Length = 230

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 13  LVRQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILTKYGSEQAVGQMVALTLLRELGPVV 72

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  IS+P+L ++ +
Sbjct: 73  TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISMPILAMIFS 132

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              + GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 133 VVGVWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 192

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 193 CDPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 228


>gi|213966604|ref|ZP_03394755.1| membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|301383114|ref|ZP_07231532.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. tomato Max13]
 gi|302058647|ref|ZP_07250188.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. tomato K40]
 gi|302133824|ref|ZP_07259814.1| putative ABC transport system permease protein [Pseudomonas
           syringae pv. tomato NCPPB 1108]
 gi|213928454|gb|EEB61998.1| membrane protein [Pseudomonas syringae pv. tomato T1]
 gi|330877179|gb|EGH11328.1| hypothetical protein PSYMP_16986 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964018|gb|EGH64278.1| hypothetical protein PSYAC_05120 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016694|gb|EGH96750.1| hypothetical protein PLA106_11700 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 265

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVKQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILAKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CDPTSEGISRATTKTVVYASLAVLGLDFILTALMFG 263


>gi|224369296|ref|YP_002603460.1| ABC-type transporter involved in resistance to organic solvents,
           permease protein [Desulfobacterium autotrophicum HRM2]
 gi|223692013|gb|ACN15296.1| ABC-type transporter involved in resistance to organic solvents,
           permease protein [Desulfobacterium autotrophicum HRM2]
          Length = 269

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 67/212 (31%), Positives = 116/212 (54%), Gaps = 6/212 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           +I  ++++G+  + V+IL    TG V+  QG + L +FG+E      +++  +RE+G +L
Sbjct: 50  IIEHIWFIGMKSMMVIILTGIFTGMVLGLQGYYTLVRFGSEGMLGSAVALTLIRELGPVL 109

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+  R+GSA+ AE+G M+I+++IDA+ TM ++ VR L +PRI A +IS PLLT L +
Sbjct: 110 TAIMVTARAGSAMAAELGVMRISQQIDALDTMDINPVRYLFTPRIIAAVISFPLLTALFD 169

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G  +       I   ++  R   +  + ++  G +K+   +  +  V    G+  
Sbjct: 170 VIGIFGGYLTGSLMLGINSGIYLFRVEESVLMTDVTGGFVKSLVFSLVVTTVCCSRGYFT 229

Query: 336 GVH-SNSLGKK-----VTTCVVQSISIVIIID 361
            +H     G K      TT VV S  +V++ D
Sbjct: 230 HLHRGGGFGAKGVSFSTTTAVVNSCVLVLVCD 261


>gi|297171834|gb|ADI22824.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [uncultured
           Oceanospirillales bacterium HF0500_29K23]
          Length = 260

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 126/218 (57%), Gaps = 5/218 (2%)

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           +F+G    L+ Q++++GV    VV+L    TG V+  Q   Q  +   +   + ++++  
Sbjct: 34  RFRG--RDLVEQLHFIGVKSQSVVLLTGAFTGMVMCAQFYIQFHKVKMDSAVMSVVTVAM 91

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
            RE+G +LT++MIAGR G+A+ A++G+MK+ E+IDA+RT+    V  L++PR+ A++ISL
Sbjct: 92  ARELGAVLTSLMIAGRVGAAMAAQLGTMKVTEQIDALRTLATSPVDYLVAPRLLAMLISL 151

Query: 268 PLLTILA-NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
           PLLT  A   S + G  + ++     P  ++ +    T ++ +I+ GLIKA   A  I  
Sbjct: 152 PLLTAEAIAISMVSGMLVAVYLLGLDPVFLWSNMVFYTGSV-DIWMGLIKAFIFAGIIAT 210

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           VA  +G   G  +  +GK  T  VV + SI I++ + F
Sbjct: 211 VACHKGMHCGQGAEGVGKATTEAVVAA-SISILVSNFF 247


>gi|197335795|ref|YP_002155152.1| toluene tolerance protein Ttg2B, putative [Vibrio fischeri MJ11]
 gi|197317285|gb|ACH66732.1| toluene tolerance protein Ttg2B, putative [Vibrio fischeri MJ11]
          Length = 264

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 124/232 (53%), Gaps = 2/232 (0%)

Query: 140 GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFS 199
           G   A     K F L L++Q+Y VGV  + ++++     G VI+ QG   L  +GAE   
Sbjct: 33  GAIFAKPQPIKMFPL-LLKQLYSVGVLSLVIIVVSGLFIGMVISLQGYIILVDYGAETSL 91

Query: 200 IDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPR 259
             L+S+  LRE+G ++TA++ AGR+GSA+ AEIG MK  E+I ++  M +D +R +I+PR
Sbjct: 92  GQLVSLSLLRELGPVVTALLFAGRAGSALTAEIGLMKTTEQISSMEMMAVDPLRQIIAPR 151

Query: 260 IWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAP 318
           +WA IIS+P+L ++     I G  IV  ++  I +  F+S   S+  +  +I   LIK  
Sbjct: 152 LWAGIISMPILAVIFMAVGIWGGQIVGVEWKGIDYGSFWSVMQSSVDVRYDIVNSLIKCV 211

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             A  +  +A+  G+     S  +    T  VV S   V+ ID +     F 
Sbjct: 212 VFAFIVTWIALFNGYDATPTSEGISLATTRTVVHSSLAVLGIDFVLTALMFG 263


>gi|59711002|ref|YP_203778.1| toluene ABC transporter membrane protein [Vibrio fischeri ES114]
 gi|59479103|gb|AAW84890.1| predicted toluene transporter subunit: membrane component of ABC
           superfamily [Vibrio fischeri ES114]
          Length = 264

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 124/232 (53%), Gaps = 2/232 (0%)

Query: 140 GEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFS 199
           G   A     K F L L++Q+Y VGV  + ++++     G VI+ QG   L  +GAE   
Sbjct: 33  GAIFAKPQPIKMFPL-LLKQLYSVGVLSLVIIVVSGLFIGMVISLQGYIILVDYGAETSL 91

Query: 200 IDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPR 259
             L+S+  LRE+G ++TA++ AGR+GSA+ AEIG MK  E+I ++  M +D +R +I+PR
Sbjct: 92  GQLVSLSLLRELGPVVTALLFAGRAGSALTAEIGLMKTTEQISSMEMMAVDPLRQIIAPR 151

Query: 260 IWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAP 318
           +WA IIS+P+L ++     I G  IV  ++  I +  F+S   S+  +  +I   LIK  
Sbjct: 152 LWAGIISMPVLAVIFMAVGIWGGQIVGVEWKGIDYGSFWSVMQSSVDVRYDIINSLIKCV 211

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             A  +  +A+  G+     S  +    T  VV S   V+ ID +     F 
Sbjct: 212 VFAFIVTWIALFNGYDATPTSEGISLATTRTVVHSSLAVLGIDFVLTALMFG 263


>gi|170717850|ref|YP_001784909.1| hypothetical protein HSM_1589 [Haemophilus somnus 2336]
 gi|168825979|gb|ACA31350.1| protein of unknown function DUF140 [Haemophilus somnus 2336]
          Length = 261

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 120/218 (55%), Gaps = 1/218 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 43  LIKQLYVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +ISPR WA +IS+P+L ++  
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVISPRFWAGVISMPILAVIFT 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ +   ++  G IK+   A A+  +A+  G+ 
Sbjct: 163 AIGIWGGSLVGVDWKGVDAGSFWSVMQNSVSWGYDLLNGCIKSLCFAIAVVWIALFNGYD 222

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               S  + K  T  VV +  +V+ +D +     F  G
Sbjct: 223 CIPTSEGISKATTKTVVHASLVVLGLDFVLTALMFGAG 260


>gi|242277698|ref|YP_002989827.1| hypothetical protein Desal_0221 [Desulfovibrio salexigens DSM 2638]
 gi|242120592|gb|ACS78288.1| protein of unknown function DUF140 [Desulfovibrio salexigens DSM
           2638]
          Length = 270

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 117/210 (55%), Gaps = 5/210 (2%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           ++++Y++GV  + V+ LI   TG V+  Q  + LS+FG+E F    +++  +RE+G +LT
Sbjct: 53  VKELYFIGVKSITVISLIGLFTGMVVGLQTQYALSKFGSEGFLGAAVALSLVRELGPVLT 112

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+M+ GR+GS++ AEIG M+I+E+IDA+  M ++ +  L+SP++ A +IS P+LT   + 
Sbjct: 113 AIMLTGRAGSSMTAEIGVMRISEQIDALELMDINPINYLVSPKLVASLISFPILTAFFDL 172

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV- 335
             I+G  +           V++ R H+     +I  G  K+   A  +  V   +G+   
Sbjct: 173 IGIVGGYLSGVMLMGGNAGVYWHRVHTALGWDDISAGFNKSLVFAVLVCTVCCFQGYFTH 232

Query: 336 ----GVHSNSLGKKVTTCVVQSISIVIIID 361
               G     + +  TT VV S  +V++ D
Sbjct: 233 HRKDGKGPEGVSQATTTAVVMSCVLVLVAD 262


>gi|237798606|ref|ZP_04587067.1| hypothetical protein POR16_07195 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021459|gb|EGI01516.1| hypothetical protein POR16_07195 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 265

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LIKQLYSVGVMSLVIIVVSGVFIGMVLALQGFSILAKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CDPTSEGISRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|157803278|ref|YP_001491827.1| ABC transporter permease protein [Rickettsia canadensis str.
           McKiel]
 gi|157784541|gb|ABV73042.1| ABC transporter permease protein [Rickettsia canadensis str.
           McKiel]
          Length = 259

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 127/226 (56%), Gaps = 20/226 (8%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGVL 214
           +IRQ+ ++G   +PVV + +F +GAV+A Q     S+F AE  SI  + +L L RE+G +
Sbjct: 44  IIRQLLFIGFYSLPVVTMTTFFSGAVLALQSYNGFSRFSAES-SIATVVVLSLTRELGPV 102

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           L  +M+AGR G++I AEI +M++ E++DA+ T+  D ++ L+ PR+   ++++P L ++ 
Sbjct: 103 LVGLMVAGRVGASIAAEIATMRVTEQVDALYTLSTDPIKYLVFPRVITAMLTMPCLVLIG 162

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF---------TGLIKAPFMACAIG 325
           +   ++G  +V          V+   F+STA L + F         +GL+KA      I 
Sbjct: 163 DVIGVMGGYLV---------GVYKLGFNSTAYLTSTFQYLEPIDVISGLVKAGVFGFIIS 213

Query: 326 IVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
           I++   G+  G  +  +G+  T+ VV S  +++I + L    +F +
Sbjct: 214 IISCYSGYYSGKGAKGVGRATTSAVVNSSILILISNYLITELFFKV 259


>gi|170728557|ref|YP_001762583.1| hypothetical protein Swoo_4232 [Shewanella woodyi ATCC 51908]
 gi|169813904|gb|ACA88488.1| protein of unknown function DUF140 [Shewanella woodyi ATCC 51908]
          Length = 260

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/228 (33%), Positives = 123/228 (53%), Gaps = 2/228 (0%)

Query: 144 ASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLM 203
           A   + KGF L  ++Q+Y VGV  + ++ +     G V+A QG   L  FG E     ++
Sbjct: 33  ARKPRAKGFPL-FVKQLYVVGVQSMVLIFVSGLFIGMVLALQGYNILVGFGTEESLGPMV 91

Query: 204 SILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWAL 263
           ++  LRE+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA 
Sbjct: 92  ALSLLRELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAG 151

Query: 264 IISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMAC 322
           ++SLPLL ++     I G  IV  ++  I    F+S   ++     +I   LIK+   A 
Sbjct: 152 VVSLPLLALIFTAVGIYGGHIVGVEWKGIDSGSFWSILQASVEWRQDIVNCLIKSLVFAV 211

Query: 323 AIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
            +  +A+  G+ V  +   + K  T  VVQS   V+ +D L     F 
Sbjct: 212 VVTWIALYRGYQVIPNPEGISKATTQTVVQSSLAVLALDFLLTALMFG 259


>gi|46447386|ref|YP_008751.1| hypothetical protein pc1752 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46401027|emb|CAF24476.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 240

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 117/207 (56%), Gaps = 1/207 (0%)

Query: 156 LIR-QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           LIR Q++ +GV  +PVV +  F TG V+A Q  FQLS  G    +  +++   L E+G +
Sbjct: 12  LIRDQLFDIGVMSLPVVAITGFSTGMVLAAQSFFQLSDKGLASATGLMVAKAMLVELGPV 71

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA M+ GR G+A+ AE+G+M++ E+IDA+RTM ++ +  L++PR  A +I +PLLT+ +
Sbjct: 72  LTAFMVTGRVGAAMCAELGTMRVTEQIDAMRTMSVNPLGYLVAPRFLAGMIMMPLLTVFS 131

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
               I G  ++   +Y +P + F           +  +G++KA      I  ++  +G  
Sbjct: 132 AIMGIFGGYLIAVYFYKMPASSFIDPLPLHINTFDFISGMVKAFVFGIIIVTISCYKGMK 191

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               +  +G+  T  VV   S+++II+
Sbjct: 192 TRGGAAGVGRSTTNSVVICYSVILIIN 218


>gi|330958007|gb|EGH58267.1| hypothetical protein PMA4326_05446 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 265

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVKQLYSVGVMSLVIIVVSGIFIGMVLALQGFSILAKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CDPTSEGISRATTKTVVYASLAVLGLDFILTALMFG 263


>gi|33151499|ref|NP_872852.1| permease [Haemophilus ducreyi 35000HP]
 gi|33147719|gb|AAP95241.1| probable permease [Haemophilus ducreyi 35000HP]
          Length = 259

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 117/215 (54%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + ++IL     G V+A QG   L  F AE     L+S+  LRE+G ++
Sbjct: 44  LIKQLYILGVQSLLIIILSGLFIGMVLALQGYVVLVDFAAESSLGTLISLSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEI  MK  E++ ++  M +D +R +I+PR WA +IS+P+L ++  
Sbjct: 104 TALLFAGRAGSALTAEIALMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPILAVIFT 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S    +    ++  G IK+   A A+  +A+  G+  
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQHSVNGQDLINGFIKSIIFAIAVVWIALFNGYDS 223

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
              S  + +  T  VV +  IV+ +D +     F 
Sbjct: 224 TATSEGISQATTRTVVHASLIVLGLDFILTAMMFG 258


>gi|113461315|ref|YP_719384.1| ABC transporter permease [Haemophilus somnus 129PT]
 gi|112823358|gb|ABI25447.1| permease component, possible ABC transporter [Haemophilus somnus
           129PT]
          Length = 261

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 121/218 (55%), Gaps = 1/218 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 43  LIKQLYVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +ISPR WA +IS+P+L ++  
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVISPRFWAGVISMPILAVIFT 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S++   +  +    F+S   ++ + + ++  G IK+   A A+  +A+  G+ 
Sbjct: 163 AIGIWGGSLIGVDWKGVDAGSFWSVMQNSVSWSYDLLNGFIKSLCFAIAVVWIALFNGYD 222

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               S  + K  T  VV +  +V+ +D +     F  G
Sbjct: 223 CIPTSEGISKATTKTVVHASLVVLGLDFVLTALMFGAG 260


>gi|261868147|ref|YP_003256069.1| ABC transporter permease [Aggregatibacter actinomycetemcomitans
           D11S-1]
 gi|261413479|gb|ACX82850.1| conserved ABC-type transport system protein, permease component
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 261

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 120/207 (57%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q++ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LIKQLHVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +I++P+L+I+  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVIAMPILSIIFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   S+ T + +I  G IK+ F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQSSVTWSHDILNGFIKSLFFAIAVVWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  + K  T  VV +  +++ +D
Sbjct: 224 CIPTSEGISKATTRTVVHASLVILGLD 250


>gi|325273317|ref|ZP_08139589.1| hypothetical protein G1E_09861 [Pseudomonas sp. TJI-51]
 gi|324101550|gb|EGB99124.1| hypothetical protein G1E_09861 [Pseudomonas sp. TJI-51]
          Length = 265

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 124/216 (57%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LIRQ+Y VGV  + +V++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LIRQLYSVGVLSLAIVVVSGVFIGMVLALQGYSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLPLL ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPLLALIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S V   +  +    F++   ++ +   ++  GLIK+   A     +A+ +G+ 
Sbjct: 168 VVGIWGGSWVAVDWLGVYEGSFWANMQNSVSFTDDVLNGLIKSLVFAFVATWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTKTVVYASLAVLGLDFILTALMFG 263


>gi|255020159|ref|ZP_05292228.1| hypothetical protein ACA_0896 [Acidithiobacillus caldus ATCC 51756]
 gi|254970301|gb|EET27794.1| hypothetical protein ACA_0896 [Acidithiobacillus caldus ATCC 51756]
          Length = 260

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 119/215 (55%), Gaps = 1/215 (0%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +RQ+Y  GV  + ++++ +F TG V+  QG + L +FGA      L+++  LRE+G +LT
Sbjct: 46  LRQVYGFGVLSLALMVVAAFFTGMVLGFQGYYALVRFGATSALGTLVALSLLRELGPVLT 105

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++ AGR+GSA+ AEI +MK  E++ A+  M +D +  ++SPR+WA + ++P+L ++ + 
Sbjct: 106 ALLFAGRAGSALTAEIATMKATEQLSAMEMMAVDPLAWVVSPRLWAAVFTVPILCVIFDL 165

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFAV 335
             I G  ++      +    F+S+  S  +   +I  GL KA      +  +A  +G++ 
Sbjct: 166 VGIFGGYLIAVPVLGVDSGTFWSQMQSNVSFRGDILNGLFKALCFGLVVAWIAAWQGYSA 225

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
              +  +G   T  VV +   V+ +D +     F+
Sbjct: 226 KPTAEGVGNATTRSVVAASLAVLGLDFILTALLFS 260


>gi|256828811|ref|YP_003157539.1| protein of unknown function DUF140 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577987|gb|ACU89123.1| protein of unknown function DUF140 [Desulfomicrobium baculatum DSM
           4028]
          Length = 263

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 126/213 (59%), Gaps = 10/213 (4%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           ++  +Y++G   + ++IL++F TG V+  QG + L +F AE      +++  +RE+G +L
Sbjct: 46  ILYDIYFIGFKSLNIIILVAFFTGMVLGLQGYYTLIKFSAEGMLGVAVALSLVRELGPVL 105

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GS+I AEIG M+I+E+IDA+ TM +D VR L++P+I A +I  PLLT + +
Sbjct: 106 TAIMLIGRAGSSISAEIGIMRISEQIDALSTMDVDPVRYLVTPKIIASLICFPLLTAIFD 165

Query: 276 FSAIIGA--SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
              I+G   S V+         +FFS+  S+  L+++  G IK+   A  +  ++   G+
Sbjct: 166 CVGILGGYFSSVLLSSRS---GIFFSKIQSSLLLSDVTGGFIKSFVFAFIVITISCYCGY 222

Query: 334 AVGVHSNSLGKK-----VTTCVVQSISIVIIID 361
               + +S G +      T+ VVQS   V++ D
Sbjct: 223 YTHQNQSSAGAEGVSNSTTSAVVQSCVYVLVSD 255


>gi|218885955|ref|YP_002435276.1| hypothetical protein DvMF_0852 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756909|gb|ACL07808.1| protein of unknown function DUF140 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 267

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/217 (31%), Positives = 121/217 (55%), Gaps = 5/217 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           ++ Q++ +G   + V++LI   TG V+  QG + L +FG+E      +++  +RE+G +L
Sbjct: 49  ILNQVFVIGSKSLFVILLIGVFTGMVLGLQGYYTLVKFGSEGLLGAAVALSLIRELGPVL 108

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+M+ GR+GS++ AEIG M+I ++IDA+  M ++ +  L++PRI A +IS PLLT + +
Sbjct: 109 TAIMVTGRAGSSMAAEIGVMRITDQIDALDVMDINPMAYLVAPRIAASLISFPLLTAIFD 168

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I+G  +       I   V+F R  ++  +A+I  G +K+   A  +  V+  +G+  
Sbjct: 169 VVGILGGYVTGVTLLGINEGVYFYRIQTSVEMADITGGFMKSVLFAVIVATVSCYQGYFT 228

Query: 336 -----GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
                GV    +    T+ VV S   V++ D +   F
Sbjct: 229 HMRRDGVGPEGVSNSTTSAVVLSCVFVLVADYVLTSF 265


>gi|28871581|ref|NP_794200.1| hypothetical protein PSPTO_4446 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|28854833|gb|AAO57895.1| membrane protein, putative [Pseudomonas syringae pv. tomato str.
           DC3000]
          Length = 265

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 126/216 (58%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVKQLYSVGVMSLVIIVVSGMFIGMVLALQGFSILAKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLP+L ++ +
Sbjct: 108 TALLFAGRAGSALSAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPILAMIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN-IFTGLIKAPFMACAIGIVAMKEGFA 334
              I GAS V   +  +    F+S   ++ +  N +  G+IK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGASWVAIDWLGVYDGSFWSNMQNSVSFTNDVLNGVIKSVVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CDPTSEGISRATTKTVVYASLAVLGLDFILTALMFG 263


>gi|94986675|ref|YP_594608.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94730924|emb|CAJ54287.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 266

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 117/210 (55%), Gaps = 5/210 (2%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           IRQ+Y +G   + V+ LI   TG V+  QG + L +FG+  F    +S+  +RE+G +LT
Sbjct: 48  IRQIYVIGTKSLFVISLIGLFTGMVLGLQGYYVLIKFGSVGFLGSAVSLTLIRELGPVLT 107

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+MI  R+GS++ AEIG M+I ++IDA+  M +  +  L+SPRI A +IS PLLT + + 
Sbjct: 108 AIMIIARAGSSMTAEIGVMRITDQIDALEVMDIPGIGYLVSPRIVASLISFPLLTAVFDV 167

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV- 335
             IIG  +       +    +FS   S+ TL++I  G IKA   A  + ++   +G+   
Sbjct: 168 IGIIGGYLTGVCLLGVNEGAYFSSIESSTTLSDINEGSIKALTFAILVILICCYKGYNAH 227

Query: 336 ----GVHSNSLGKKVTTCVVQSISIVIIID 361
               G    ++    T+ VV S  +V+I D
Sbjct: 228 RRRDGRGPEAVANATTSAVVVSCVLVLIAD 257


>gi|163749276|ref|ZP_02156525.1| hypothetical protein KT99_08438 [Shewanella benthica KT99]
 gi|161330995|gb|EDQ01921.1| hypothetical protein KT99_08438 [Shewanella benthica KT99]
          Length = 260

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/228 (32%), Positives = 123/228 (53%), Gaps = 2/228 (0%)

Query: 144 ASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLM 203
           A   + KG  L  ++Q+Y VGV  + ++++     G V+A QG   L  FG E     ++
Sbjct: 33  AHKPRLKGLPL-FVKQLYVVGVQSMVLILISGLFIGMVLALQGYNILVGFGTEESLGPMV 91

Query: 204 SILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWAL 263
           ++  LRE+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA 
Sbjct: 92  ALSLLRELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAG 151

Query: 264 IISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMAC 322
           ++SLPLLT++     I G  IV  ++  I    F+S   ++     +I   LIK+     
Sbjct: 152 VVSLPLLTLMFTAIGIYGGYIVGVEWKGIDGGSFWSILQASVEWREDIVNCLIKSFLFGI 211

Query: 323 AIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
            +  +A+  G+ V  +   + K  T  VVQS   V+ +D L     F 
Sbjct: 212 VVTWIALYRGYQVVPNPEGISKATTQTVVQSSLAVLALDFLLTAIMFG 259


>gi|226943414|ref|YP_002798487.1| organic solvent tolerance ABC efflux transporter, permease
           [Azotobacter vinelandii DJ]
 gi|226718341|gb|ACO77512.1| organic solvent tolerance ABC efflux transporter, permease
           component [Azotobacter vinelandii DJ]
          Length = 265

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 127/221 (57%), Gaps = 2/221 (0%)

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
           GF L L++Q++ +GV  +P++++     G V+A QG   L  +G+E     L+++  LRE
Sbjct: 44  GFQL-LVKQIHSIGVLSLPIIVVSGLFIGMVLALQGYNILVSYGSEQAVGQLVALTLLRE 102

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G ++T ++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +I+PR+WA  +S+PLL
Sbjct: 103 LGPVVTGLLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIIAPRLWAGFLSMPLL 162

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAM 329
             + N   I GA++V   +  +    F++   S+  L  ++  G IK+   A  +  +A+
Sbjct: 163 AAIFNVVGIWGAAMVAVDWLGVYDGSFWASMQSSVDLYDDVVNGAIKSIAFAFVVTWIAV 222

Query: 330 KEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
            +G+     S  +G+  T  VV +   V+ +D +     F 
Sbjct: 223 FQGYDCEPTSEGIGRATTRTVVYASLAVLGLDFILTALMFG 263


>gi|269104097|ref|ZP_06156794.1| uncharacterized ABC transporter permease component YrbE
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163995|gb|EEZ42491.1| uncharacterized ABC transporter permease component YrbE
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 260

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 120/216 (55%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V++ QG   L  FGAE     ++++  LRE+G ++
Sbjct: 44  LLKQLYSVGVLSIAIILVSGLFIGMVLSLQGYIVLVDFGAETSLGQMVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PLL ++  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVIAPRFWAGVISMPLLAMMFT 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V   +  I +  ++S   S+  +  +I  GL+KA   A  +  +A+  G+ 
Sbjct: 164 AVGIWGGQLVGVDWKGIDYGSYWSVMQSSVDVWYDIGNGLLKAVVFAITVTWIAVFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV S   V+ +D +     F 
Sbjct: 224 AVPTSEGISRATTRTVVNSSLAVLGLDFVLTALMFG 259


>gi|91791861|ref|YP_561512.1| hypothetical protein Sden_0497 [Shewanella denitrificans OS217]
 gi|91713863|gb|ABE53789.1| protein of unknown function DUF140 [Shewanella denitrificans OS217]
          Length = 265

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 121/216 (56%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y +GV  + ++I+     G V+A QG   L  FG E     ++++  LRE+G ++
Sbjct: 49  LLKQIYVLGVRSMIIIIVSGLFIGMVMALQGYNVLVGFGTEESLGPMVALSLLREMGPVV 108

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PLL ++ +
Sbjct: 109 TALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQVIAPRFWAGVISMPLLAVMFS 168

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V  ++  I    F+S   ++     +I   LIK+   A  +  +A+  G+ 
Sbjct: 169 LVGIYGGHLVGVEWKGIDSGTFWSILQASIEWRQDIVNCLIKSTVFAVVVTWIALYRGYE 228

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           V  +   + +  T+ VVQ+   V+ +D L     F 
Sbjct: 229 VNPNPEGISRATTSTVVQASLAVLGLDFLLTAIMFG 264


>gi|315633782|ref|ZP_07889072.1| toluene efflux ABC superfamily ATP binding cassette transporter,
           membrane protein [Aggregatibacter segnis ATCC 33393]
 gi|315477824|gb|EFU68566.1| toluene efflux ABC superfamily ATP binding cassette transporter,
           membrane protein [Aggregatibacter segnis ATCC 33393]
          Length = 261

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 119/206 (57%), Gaps = 1/206 (0%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I+Q++ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++T
Sbjct: 45  IKQLHVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVVT 104

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA II++P+L+I+   
Sbjct: 105 ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGIIAMPILSIIFIA 164

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAV 335
             I G S+V   +  +    F+S   S+ T + +I  G IK+ F A A+  +A+  G+  
Sbjct: 165 IGIWGGSLVGVDWKGVDAGSFWSVMQSSVTWSHDILNGTIKSVFFAIAVVWIALFNGYDC 224

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + K  T  VV +  +V+ +D
Sbjct: 225 IPTSEGISKATTRTVVHASLVVLGLD 250


>gi|330827998|ref|YP_004390950.1| ABC transporter permease [Aeromonas veronii B565]
 gi|328803134|gb|AEB48333.1| ABC-type transporter, permease subunit [Aeromonas veronii B565]
          Length = 259

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/207 (33%), Positives = 115/207 (55%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y VGV  V ++++     G V++ QG   L  FGAE     L+S+  LRE+G ++
Sbjct: 44  LIQQLYVVGVQSVAIILVSGLFIGMVLSLQGYNVLKDFGAEQSLGPLVSLSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +++PR WA +IS+PLL  + +
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLAFMFS 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V   +  +    F+S   ++     +I  G IK+   A  +  +A+  G+ 
Sbjct: 164 LIGIFGGKLVGVDWLGVDEGGFWSAMQASVDWHEDIMQGAIKSLIFALVVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  + +  T  VV S   V+ +D
Sbjct: 224 AKPTSAGISQATTRTVVHSSLAVLGLD 250


>gi|117618508|ref|YP_858369.1| putative ABC transporter, permease protein [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117559915|gb|ABK36863.1| putative ABC transporter, permease protein [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 259

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 68/207 (32%), Positives = 115/207 (55%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  V ++++     G V++ QG   L  FGAE     L+S+  LRE+G ++
Sbjct: 44  LVQQLYVVGVQSVAIILVSGLFIGMVLSLQGYNVLKDFGAEQSLGPLVSLSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +++PR WA +IS+PLL  + +
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVVAPRFWAGVISMPLLAFMFS 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V   +  +    F+S   ++     +I  G IK+   A  +  +A+  G+ 
Sbjct: 164 LIGIFGGKLVGVDWLGVDEGSFWSAMQASVDWQDDIMQGAIKSLIFALVVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  + +  T  VV S   V+ +D
Sbjct: 224 AKPTSAGISQATTRTVVHSSLAVLGLD 250


>gi|329121164|ref|ZP_08249793.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Dialister micraerophilus
           DSM 19965]
 gi|327470327|gb|EGF15786.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Dialister micraerophilus
           DSM 19965]
          Length = 253

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 115/212 (54%)

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
           +Q   +GV+  P+V L    TG V + Q   +L ++GAE  +  +++I   RE+G +L  
Sbjct: 42  KQCLLLGVNSFPIVFLTLLFTGMVFSAQIVGELVKYGAEFTAGSIVAIGLGRELGPVLCG 101

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           V++AGR G+AI AE+G+M++ E+IDA+R M +D V  L+ PR+ A +I LP+L + A   
Sbjct: 102 VVLAGRVGAAITAELGTMRVTEQIDALRCMAVDPVEYLVLPRVIACMIMLPILDVFAVTI 161

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
            + G  IV     +I   +++    S    ++++ G+IK  F    I +     G     
Sbjct: 162 GVGGGMIVASVTGNISSHMYWDSITSFCVASDLYIGMIKTVFFGMIIALTGCDRGITCET 221

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
            +  +GK  T  VV S+ ++ I++ + +   F
Sbjct: 222 GAEGVGKATTQSVVYSMIMIFIVNYILSTILF 253


>gi|94969917|ref|YP_591965.1| hypothetical protein Acid345_2890 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551967|gb|ABF41891.1| protein of unknown function DUF140 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 258

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 116/213 (54%), Gaps = 1/213 (0%)

Query: 152 FLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREI 211
           +L   ++Q   +GV  +P+VIL  F TGA +A   +  L +FG+   +  L+S   +RE+
Sbjct: 37  YLSDTLQQADLIGVGSLPIVILAGFFTGAALALNTSATLQKFGSITLTGQLVSYSMVREL 96

Query: 212 GVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLT 271
           G +LT +M+AGR+ S + +E+GSMK+ E+IDA+R +G D  + L++PR+ + ++ L  L+
Sbjct: 97  GPVLTGLMVAGRNSSGMASELGSMKVTEQIDAMRALGTDPSKKLVTPRVISTVVMLFFLS 156

Query: 272 ILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKE 331
           I+++   + G  I+ W    +    +++  +      ++  GL+K       I  V    
Sbjct: 157 IISDLLGMAGGFIISWTLLGLDANQYWTTAYQALVFQDVLMGLVKPVVFGFFIASVGCYY 216

Query: 332 GFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           G      +  +G+  T  VV + S++II   LF
Sbjct: 217 GMNATGGTQGVGRATTQAVVTA-SVLIIASDLF 248


>gi|167625602|ref|YP_001675896.1| hypothetical protein Shal_3697 [Shewanella halifaxensis HAW-EB4]
 gi|167355624|gb|ABZ78237.1| protein of unknown function DUF140 [Shewanella halifaxensis
           HAW-EB4]
          Length = 261

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 119/216 (55%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++++     G V+A QG   L  FG E     ++++  LRE+G ++
Sbjct: 45  LLRQLYVVGVQSMVIILVSGLFIGMVLALQGYNILVGFGTEESLGPMVALSLLRELGPVV 104

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AE+G MK  E++ ++  M +D +R +I+PR WA +ISLPLL ++  
Sbjct: 105 TALLFAGRAGSALTAELGLMKSTEQLASLEMMAIDPLRQIIAPRFWAGVISLPLLALMFT 164

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  IV  ++  I    F+S   ++     +I   +IK+   A  +  +A+  G+ 
Sbjct: 165 AVGIYGGHIVGVEWKGIDSGSFWSILQASVEWREDIVNCMIKSLLFAVVVTWIALYRGYH 224

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           V  +   + +  T  VVQS   V+ +D L     F 
Sbjct: 225 VIPNPEGISRATTQTVVQSSLAVLALDFLLTAIMFG 260


>gi|322515301|ref|ZP_08068298.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Actinobacillus ureae ATCC
           25976]
 gi|322118677|gb|EFX90889.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Actinobacillus ureae ATCC
           25976]
          Length = 258

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 116/206 (56%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++
Sbjct: 43  LIKQLYVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFAAETSLGTLVSLSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L  +  
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPILAAIFT 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S   ++   +++  G IK+   A A+  +A+  G+  
Sbjct: 163 AIGIWGGSLVGVDWKGVDGGSFWSVMQNSVDWSDLINGFIKSIIFAFAVVWIALFNGYDS 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + +  T  VV +  +V+ +D
Sbjct: 223 VATSEGISQATTRTVVHASLVVLGLD 248


>gi|284036726|ref|YP_003386656.1| hypothetical protein Slin_1812 [Spirosoma linguale DSM 74]
 gi|283816019|gb|ADB37857.1| protein of unknown function DUF140 [Spirosoma linguale DSM 74]
          Length = 271

 Score =  110 bits (275), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 113/213 (53%), Gaps = 4/213 (1%)

Query: 147 YKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSIL 206
           Y+FK     ++RQ Y VG   + ++    F+TG V   Q    LS+FGA  +   L++I 
Sbjct: 48  YEFK----EIVRQCYEVGFRSLLLISTTGFITGIVFTNQSRPSLSEFGATSWLPSLIAIA 103

Query: 207 QLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
            +R +G L+TA++ AG+ GS+I AE+GSM + E+IDA+   G D  + L+  R+ A   +
Sbjct: 104 IVRALGPLVTALIAAGKVGSSIGAELGSMNVTEQIDAMEVSGTDPFKFLVVTRVLATSFT 163

Query: 267 LPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
           +PLLT+   F  +IGA I + +     F  F        T  +IF  ++K+      IG+
Sbjct: 164 IPLLTMYTIFVGLIGAYINVNQNEQTSFTSFMQEVFGAITYLDIFASVLKSIVFGFTIGM 223

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           V   +G+     +  +GK   + VV S+ +V I
Sbjct: 224 VGCYKGYHSSKGTEGVGKAANSAVVTSMFLVFI 256


>gi|46143493|ref|ZP_00135103.2| COG0767: ABC-type transport system involved in resistance to
           organic solvents, permease component [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208757|ref|YP_001053982.1| hypothetical protein APL_1291 [Actinobacillus pleuropneumoniae L20]
 gi|307248316|ref|ZP_07530341.1| hypothetical protein appser2_12940 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307257357|ref|ZP_07539127.1| hypothetical protein appser10_13550 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259627|ref|ZP_07541351.1| hypothetical protein appser11_14250 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307261768|ref|ZP_07543434.1| hypothetical protein appser12_13270 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263956|ref|ZP_07545559.1| hypothetical protein appser13_13640 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097549|gb|ABN74377.1| hypothetical protein APL_1291 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|306855186|gb|EFM87364.1| hypothetical protein appser2_12940 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306864207|gb|EFM96120.1| hypothetical protein appser10_13550 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306866272|gb|EFM98136.1| hypothetical protein appser11_14250 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868586|gb|EFN00397.1| hypothetical protein appser12_13270 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870718|gb|EFN02459.1| hypothetical protein appser13_13640 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 234

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 118/215 (54%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++
Sbjct: 19  LIKQLYVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFAAETSLGTLVSLSLLRELGPVV 78

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L  +  
Sbjct: 79  TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPILAAIFT 138

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S   ++   +++  G IK+   A A+  +A+  G+  
Sbjct: 139 AIGIWGGSLVGVDWKGVDGGSFWSVMQNSVDWSDLINGFIKSIIFAFAVVWIALFNGYDS 198

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
              S  + +  T  VV +  +V+ +D +     F 
Sbjct: 199 VATSEGISQATTRTVVHASLVVLGLDFILTAIMFG 233


>gi|152978463|ref|YP_001344092.1| hypothetical protein Asuc_0787 [Actinobacillus succinogenes 130Z]
 gi|150840186|gb|ABR74157.1| protein of unknown function DUF140 [Actinobacillus succinogenes
           130Z]
          Length = 259

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 116/206 (56%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q++ +GV  + ++++  F  G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LIKQLHVLGVQSLLIILMSGFFIGMVLGLQGYVVLVDFAAEANVGQLVALALLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +I++P+L +L  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVIAMPILAVLFT 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              +IG S++   +  I    F+S   +     ++  G IK+   A  +  VA+  G+  
Sbjct: 164 AVGVIGGSLIGVDWKGIDGGSFWSVMQNAVASKDLLYGFIKSVVFAFTVVWVALFNGYDC 223

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + +  T  VV S  +V+ +D
Sbjct: 224 VPTSEGISQATTKTVVHSSLLVLGLD 249


>gi|145630177|ref|ZP_01785959.1| hypothetical protein CGSHi22421_08998 [Haemophilus influenzae
           R3021]
 gi|260581861|ref|ZP_05849657.1| ABC transporter permease [Haemophilus influenzae NT127]
 gi|144984458|gb|EDJ91881.1| hypothetical protein CGSHi22421_08998 [Haemophilus influenzae
           R3021]
 gi|260095054|gb|EEW78946.1| ABC transporter permease [Haemophilus influenzae NT127]
          Length = 261

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 123/218 (56%), Gaps = 1/218 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPILSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               S  + +  T  VV +  +V+ +D +     F  G
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLDFILTAIMFGAG 261


>gi|104780316|ref|YP_606814.1| toluene tolerance ABC efflux transporter permease [Pseudomonas
           entomophila L48]
 gi|95109303|emb|CAK14000.1| toluene tolerance ABC efflux transporter, permease [Pseudomonas
           entomophila L48]
          Length = 265

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 125/216 (57%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V+A QG   L+++G+E     ++++  LRE+G ++
Sbjct: 48  LVKQLYSVGVLSLAIIVVSGVFIGMVLALQGYSILTKYGSEQAVGQMVALTLLRELGPVV 107

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG+MK  E++ ++  +G+D ++ +++PR+WA  ISLPLL ++ +
Sbjct: 108 TALLFAGRAGSALTAEIGNMKSTEQLSSLEMIGVDPLKYIVAPRLWAGFISLPLLALIFS 167

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S V   +  +    F+    ++ + + ++  GLIK+   A  +  +A+ +G+ 
Sbjct: 168 VVGIWGGSWVAVDWLGVYEGSFWGNMQNSVSFSDDVINGLIKSLVFAFVVTWIAVFQGYD 227

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV +   V+ +D +     F 
Sbjct: 228 CEPTSEGISRATTKTVVYASLAVLGLDFILTALMFG 263


>gi|165976711|ref|YP_001652304.1| permease [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|303250627|ref|ZP_07336824.1| permease [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|303252079|ref|ZP_07338248.1| permease [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307246209|ref|ZP_07528290.1| hypothetical protein appser1_14130 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307250543|ref|ZP_07532487.1| hypothetical protein appser4_13230 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252926|ref|ZP_07534814.1| hypothetical protein appser6_14370 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255189|ref|ZP_07537007.1| hypothetical protein appser9_14250 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|165876812|gb|ABY69860.1| probable permease [Actinobacillus pleuropneumoniae serovar 3 str.
           JL03]
 gi|302649061|gb|EFL79248.1| permease [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|302650615|gb|EFL80774.1| permease [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306852818|gb|EFM85042.1| hypothetical protein appser1_14130 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306857436|gb|EFM89548.1| hypothetical protein appser4_13230 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859564|gb|EFM91589.1| hypothetical protein appser6_14370 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306862062|gb|EFM94038.1| hypothetical protein appser9_14250 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
          Length = 258

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 116/206 (56%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++
Sbjct: 43  LIKQLYVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFAAETSLGTLVSLSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L  +  
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPILAAIFT 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S   ++   +++  G IK+   A A+  +A+  G+  
Sbjct: 163 AIGIWGGSLVGVDWKGVDGGSFWSVMQNSVDWSDLINGFIKSIIFAFAVVWIALFNGYDS 222

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + +  T  VV +  +V+ +D
Sbjct: 223 VATSEGISQATTRTVVHASLVVLGLD 248


>gi|114564530|ref|YP_752044.1| hypothetical protein Sfri_3369 [Shewanella frigidimarina NCIMB 400]
 gi|114335823|gb|ABI73205.1| protein of unknown function DUF140 [Shewanella frigidimarina NCIMB
           400]
          Length = 261

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 121/216 (56%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + ++++     G V+A QG   L +FG E     ++++  LRE+G ++
Sbjct: 45  LIKQVYVLGVRSMVIILVSGLFIGMVLALQGYNILVEFGTEESLGPMVALSLLRELGPVV 104

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PLL ++ +
Sbjct: 105 AALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAGVISMPLLALMFS 164

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
              I+G  +V  ++  I    F+S   ++     +I   LIK+      +  +A+  G+ 
Sbjct: 165 LVGILGGHLVGVEWKGIDSGAFWSILRASVEWREDIVNCLIKSVIFGVVVTWIALYRGYE 224

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           V  +   + +  T+ VVQ+   V+ +D L     F 
Sbjct: 225 VQPNPEGISRATTSTVVQASLAVLALDFLLTAIMFG 260


>gi|212703465|ref|ZP_03311593.1| hypothetical protein DESPIG_01509 [Desulfovibrio piger ATCC 29098]
 gi|212673125|gb|EEB33608.1| hypothetical protein DESPIG_01509 [Desulfovibrio piger ATCC 29098]
          Length = 264

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 121/216 (56%), Gaps = 5/216 (2%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I+Q+Y +G   + V++LI    G V+  QG + L QFG+       +S+  +RE+G +LT
Sbjct: 47  IQQLYVIGYKSLFVILLIGIFCGMVLGLQGYYTLVQFGSVGMLGSAVSLSLIRELGPVLT 106

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+M+AGR+GS++ AEIG M+I+++IDA+  M ++ +  L+SPR+ A +++ PLLT + + 
Sbjct: 107 AIMLAGRAGSSMAAEIGVMRISDQIDALDVMDINSMAYLVSPRLVASLLAFPLLTAIFDV 166

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
             IIG  +       I    +  R  S+ T+ ++  G IK+      +  V   +G+   
Sbjct: 167 IGIIGGYLTGVLMLHINEGAYLYRIASSVTMNDVAGGFIKSLVFGLLVATVCCHQGYTTH 226

Query: 337 VHSNSLGKK-----VTTCVVQSISIVIIIDSLFAIF 367
           +  +S+G +      T+ VV S  ++++ D +   F
Sbjct: 227 MRRDSVGPEAVGNATTSAVVISCVLILVADYVLTSF 262


>gi|282891606|ref|ZP_06300097.1| hypothetical protein pah_c180o100 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498574|gb|EFB40902.1| hypothetical protein pah_c180o100 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 262

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/206 (34%), Positives = 117/206 (56%), Gaps = 1/206 (0%)

Query: 155 SLIR-QMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGV 213
           SLIR QM+ +GV  +PVV +  F TG V+A Q  FQLS  G    +  +++   + E+G 
Sbjct: 33  SLIRDQMFEIGVMSLPVVAITGFSTGLVLAAQSFFQLSDKGLASATGLMVTKAMMVELGP 92

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           +LTA M+ GR G+++ AE+G+M++ E+IDA+R+M ++ +R LI+PR  A    LPLLTI 
Sbjct: 93  ILTAFMVTGRVGASMCAELGTMRVTEQIDALRSMSVNPLRYLIAPRFIAGTTMLPLLTIF 152

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           +    I+G  ++   YY +P + F           ++ +GLIKA      I  ++   G 
Sbjct: 153 SCLMGILGGYLLSVYYYQMPPSTFLDPLPLHIKTFDMVSGLIKAFIFGIIIITISCYRGL 212

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVII 359
           +    +  +G+  T  VV   S+++I
Sbjct: 213 STRGGAAGVGRATTNSVVICYSVILI 238


>gi|319897434|ref|YP_004135631.1| abc-type transport system protein, permease component [Haemophilus
           influenzae F3031]
 gi|317432940|emb|CBY81307.1| conserved ABC-type transport system protein,permease component
           [Haemophilus influenzae F3031]
          Length = 261

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 123/218 (56%), Gaps = 1/218 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPVLSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               S  + +  T  VV +  +V+ +D +     F  G
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLDFILTAIMFGAG 261


>gi|145640771|ref|ZP_01796354.1| hypothetical protein CGSHiR3021_06880 [Haemophilus influenzae
           R3021]
 gi|319776661|ref|YP_004139149.1| ABC transporter permease [Haemophilus influenzae F3047]
 gi|329124179|ref|ZP_08252726.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Haemophilus aegyptius
           ATCC 11116]
 gi|145274697|gb|EDK14560.1| hypothetical protein CGSHiR3021_06880 [Haemophilus influenzae
           22.4-21]
 gi|317451252|emb|CBY87486.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae F3047]
 gi|327467604|gb|EGF13102.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Haemophilus aegyptius
           ATCC 11116]
          Length = 261

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 123/218 (56%), Gaps = 1/218 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPVLSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               S  + +  T  VV +  +V+ +D +     F  G
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLDFILTAIMFGAG 261


>gi|310817867|ref|YP_003950225.1| ABC transporter permease [Stigmatella aurantiaca DW4/3-1]
 gi|309390939|gb|ADO68398.1| ABC transporter, permease protein [Stigmatella aurantiaca DW4/3-1]
          Length = 250

 Score =  110 bits (274), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGV 213
           +L+    ++GV  +P+ +L S   G VI+ Q  F L++FG + +++  + +L L RE+  
Sbjct: 34  ALVYHTEFLGVRSMPIALLTSTFAGLVISLQFGFFLARFGVQ-YTVGRVVVLTLFRELAP 92

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           +LTA+ +  R GS + AE+G+M + E++DAIR +G D +R L+ PR+ A ++ +P LT+L
Sbjct: 93  VLTALTVGARIGSGMAAELGAMTVTEQVDAIRALGADPLRKLVVPRVLACLLVMPTLTVL 152

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           A+   +   ++V+   Y I F +FF        + +  +G+IK       IG+V   +G 
Sbjct: 153 ADVIGLGAGALVVNMQYAISFDLFFQGALDAVLMTDFVSGVIKGAIFGVIIGLVGCFKGL 212

Query: 334 AVGVHSNSLGKKVT-TCVVQSISIVI 358
            V   +  +G+  T T  + S+S+ +
Sbjct: 213 TVEGGTEGVGRATTQTVAITSVSVCL 238


>gi|121534945|ref|ZP_01666764.1| protein of unknown function DUF140 [Thermosinus carboxydivorans
           Nor1]
 gi|121306544|gb|EAX47467.1| protein of unknown function DUF140 [Thermosinus carboxydivorans
           Nor1]
          Length = 256

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 118/229 (51%), Gaps = 1/229 (0%)

Query: 142 FCASSYKFKGFLLSL-IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSI 200
           F  + Y  + F L L +RQ  ++GV  +P+V+L    TG V+  Q A +  ++GA+    
Sbjct: 27  FTETIYHLRRFNLKLTLRQAAHLGVDSLPIVLLTILFTGMVMTVQTAHEFIKYGAQSSVG 86

Query: 201 DLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRI 260
            ++++   RE+  +LT V+ AGR G+AI AEIGSMK+ E+IDA+R M  + +  L+ PR+
Sbjct: 87  GVVAVAMGRELAPVLTGVVAAGRVGAAITAEIGSMKVTEQIDALRVMATNPIAYLVVPRL 146

Query: 261 WALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFM 320
            A +  LP+L + A+     G  +V   Y  I    +         + ++  GLIKA   
Sbjct: 147 VACVFMLPILVVFADVIGTFGGYLVATLYAGIGSFTYLHSIKVFTAINDVTGGLIKAMVF 206

Query: 321 ACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              I I+   +G      +  +G+  T  VV SI ++ + +   ++  +
Sbjct: 207 GAIIAIIGCYKGLTTDEGAEGVGRATTGSVVASIILIFVTNYFLSLLLY 255


>gi|157373873|ref|YP_001472473.1| hypothetical protein Ssed_0734 [Shewanella sediminis HAW-EB3]
 gi|157316247|gb|ABV35345.1| protein of unknown function DUF140 [Shewanella sediminis HAW-EB3]
          Length = 260

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/228 (32%), Positives = 123/228 (53%), Gaps = 2/228 (0%)

Query: 144 ASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLM 203
           A   + KGF L  ++Q+Y VGV  + ++ +     G V+A QG   L  FG E     ++
Sbjct: 33  ARKPRIKGFPL-FVKQLYVVGVQSMVLIFVSGLFIGMVLALQGYNILVGFGTEESLGPMV 91

Query: 204 SILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWAL 263
           ++  LRE+G ++TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA 
Sbjct: 92  ALSLLRELGPVVTALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQIIAPRFWAG 151

Query: 264 IISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMAC 322
           ++SLPLL ++     I G  +V  ++  I    F+S   ++     +I   +IK+   A 
Sbjct: 152 VVSLPLLALIFTAVGIYGGHVVGVEWKGIDSGSFWSILQASVEWREDIVNCIIKSLVFAV 211

Query: 323 AIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
            +  +A+  G+ V  +   + K  T  VVQS   V+ +D L     F 
Sbjct: 212 VVTWIALYRGYRVIPNPEGISKATTQTVVQSSLAVLALDFLLTAVMFG 259


>gi|190150611|ref|YP_001969136.1| hypothetical protein APP7_1342 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|189915742|gb|ACE61994.1| hypothetical protein APP7_1342 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
          Length = 276

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 67/206 (32%), Positives = 116/206 (56%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++
Sbjct: 61  LIKQLYVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFAAETSLGTLVSLSLLRELGPVV 120

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L  +  
Sbjct: 121 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPILAAIFT 180

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I G S+V   +  +    F+S   ++   +++  G IK+   A A+  +A+  G+  
Sbjct: 181 AIGIWGGSLVGVDWKGVDGGSFWSVMQNSVDWSDLINGFIKSIIFAFAVVWIALFNGYDS 240

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + +  T  VV +  +V+ +D
Sbjct: 241 VATSEGISQATTRTVVHASLVVLGLD 266


>gi|115378323|ref|ZP_01465489.1| ABC transporter, permease protein [Stigmatella aurantiaca DW4/3-1]
 gi|115364677|gb|EAU63746.1| ABC transporter, permease protein [Stigmatella aurantiaca DW4/3-1]
          Length = 274

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 64/206 (31%), Positives = 117/206 (56%), Gaps = 3/206 (1%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL-REIGV 213
           +L+    ++GV  +P+ +L S   G VI+ Q  F L++FG + +++  + +L L RE+  
Sbjct: 58  ALVYHTEFLGVRSMPIALLTSTFAGLVISLQFGFFLARFGVQ-YTVGRVVVLTLFRELAP 116

Query: 214 LLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTIL 273
           +LTA+ +  R GS + AE+G+M + E++DAIR +G D +R L+ PR+ A ++ +P LT+L
Sbjct: 117 VLTALTVGARIGSGMAAELGAMTVTEQVDAIRALGADPLRKLVVPRVLACLLVMPTLTVL 176

Query: 274 ANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
           A+   +   ++V+   Y I F +FF        + +  +G+IK       IG+V   +G 
Sbjct: 177 ADVIGLGAGALVVNMQYAISFDLFFQGALDAVLMTDFVSGVIKGAIFGVIIGLVGCFKGL 236

Query: 334 AVGVHSNSLGKKVT-TCVVQSISIVI 358
            V   +  +G+  T T  + S+S+ +
Sbjct: 237 TVEGGTEGVGRATTQTVAITSVSVCL 262


>gi|144898324|emb|CAM75188.1| ABC transporter permease protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 267

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 120/210 (57%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
           S+  Q   +G++ +P++ ++S   G ++A QG + L  FGAE      +++  +RE   L
Sbjct: 52  SVAAQAMDIGIAALPIITVLSTTIGLMLAIQGIYTLKTFGAESRVTLGVALSVVREFAPL 111

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           +T +++AGRSGSA+ A +G+M+IN+EID++  MG++ VR L++P + A+++ +PLLT+ A
Sbjct: 112 ITGILVAGRSGSALAARLGTMRINQEIDSLTVMGINPVRFLVAPPLAAMMVLMPLLTLWA 171

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           +   +  A + I        A +     S   L ++  GL K+      + IV +  G +
Sbjct: 172 DLVGLFAAGLYISIELQGTMAGYADEVLSLLKLNDLLHGLAKSAIFGVLVTIVGVVNGAS 231

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           V   +  +G+  T  VV +IS ++I D +F
Sbjct: 232 VSGGAEGVGRMTTRSVVHAISAIVITDMIF 261


>gi|198282478|ref|YP_002218799.1| hypothetical protein Lferr_0338 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667295|ref|YP_002424668.1| toluene tolerance protein Ttg2B, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198246999|gb|ACH82592.1| protein of unknown function DUF140 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218519508|gb|ACK80094.1| toluene tolerance protein Ttg2B, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 260

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 72/265 (27%), Positives = 142/265 (53%), Gaps = 8/265 (3%)

Query: 106 SFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGV 165
           +F     ++G++ ++ + +  + +  L L +     F  ++  F   +  L++Q+Y  GV
Sbjct: 2   AFMEFIPNLGRRTLRTVPNLGTASRFLLLSL-----FAVANRHFS--IQQLLKQVYGFGV 54

Query: 166 SGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSG 225
             + ++++ +F TG V+  QG + L +FGA      L+++  LRE+G +LTA++ AGR+G
Sbjct: 55  RSLLLMMVAAFFTGMVLGFQGYYALVRFGATSALGTLVALSLLRELGPVLTALLFAGRAG 114

Query: 226 SAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIV 285
           SA+ AEI SMK  E++ A+  M ++ +  +++PR+WA I+ +P+L ++ +   I G  ++
Sbjct: 115 SALTAEISSMKATEQLSAMEMMAVNPLAWVVAPRLWAGILVVPILCVIFDLVGIFGGYLI 174

Query: 286 IWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
                 +    F+++  S    + +I TGL KA      +  +A  +G+A    +  +G 
Sbjct: 175 SVPVLGVDGGTFWAQMQSNVAFSGDILTGLFKALCFGLVVTWIAAWQGYAAQPTAEGVGN 234

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYF 369
             T  VV +   V+ +D +   F F
Sbjct: 235 ATTISVVTASLAVLGLDFILTAFLF 259


>gi|94264494|ref|ZP_01288281.1| Protein of unknown function DUF140 [delta proteobacterium MLMS-1]
 gi|94266598|ref|ZP_01290280.1| Protein of unknown function DUF140 [delta proteobacterium MLMS-1]
 gi|93452769|gb|EAT03307.1| Protein of unknown function DUF140 [delta proteobacterium MLMS-1]
 gi|93455053|gb|EAT05280.1| Protein of unknown function DUF140 [delta proteobacterium MLMS-1]
          Length = 263

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 117/216 (54%), Gaps = 6/216 (2%)

Query: 155 SLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL 214
            ++RQ   +G + +PV+   +  TG V+  QG + L QFGAE      +++  +RE+G +
Sbjct: 43  EVVRQTRLIGANSLPVIFFTAAFTGMVLGLQGYYTLRQFGAESALGSAVALSLIRELGPV 102

Query: 215 LTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILA 274
           LTA+M+ GR+GSA+ AEIG M+ +E+IDA+  M +D  R LI+P++ A +IS+PLLT++ 
Sbjct: 103 LTALMVIGRAGSAMCAEIGIMRNSEQIDALECMAVDPFRYLIAPKLLATMISIPLLTLIF 162

Query: 275 NFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFA 334
           N   I G  +       +    +F+    +   A+I  G+IK+   A  +  +    G+ 
Sbjct: 163 NVVGIFGGYVAGVMLLGVNPGSYFAGMEQSVVDADIRMGIIKSLVFALLVVWICTARGYY 222

Query: 335 V------GVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           V      G  +  + +  T  VV S   V++ D L 
Sbjct: 223 VHAIRGAGFGAEGVSRATTQAVVFSSISVLLFDYLL 258


>gi|254362425|ref|ZP_04978534.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Mannheimia haemolytica PHL213]
 gi|261494094|ref|ZP_05990597.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261496065|ref|ZP_05992475.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153094014|gb|EDN74930.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Mannheimia haemolytica PHL213]
 gi|261308315|gb|EEY09608.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261310260|gb|EEY11460.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 258

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 134/263 (50%), Gaps = 9/263 (3%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHIL-GLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG 167
           N    IG  ++ FI      A +L G +I           +F+     LI+Q+Y +GV  
Sbjct: 3   NFISSIGAVVINFIRTLGRSAFMLWGALIGKP--------EFRKHTPLLIKQLYVLGVQS 54

Query: 168 VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSA 227
           + +++L     G V+  QG   L  F AE     L+S+  LRE+G ++TA++ AGR+GSA
Sbjct: 55  LLIIMLSGLFIGMVLGLQGYVVLVDFAAESSLGTLVSLSLLRELGPVVTALLFAGRAGSA 114

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
           + AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L  +     I G S+V  
Sbjct: 115 LTAEIGLMKATEQLSSLEMMAVDPLRRIIAPRFWAGVISMPVLAAIFTAIGIWGGSLVGV 174

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
            +  +    F+S   ++   +++  G IK+   A A+  +A+  G+     S  + +  T
Sbjct: 175 DWKGVDGGSFWSVMQNSVNTSDLINGFIKSVIFAFAVVWIALFNGYDCVPTSEGISQATT 234

Query: 348 TCVVQSISIVIIIDSLFAIFYFA 370
             VV +  +++ +D +     F 
Sbjct: 235 RTVVNASLVILGLDFILTAIMFG 257


>gi|182412508|ref|YP_001817574.1| hypothetical protein Oter_0685 [Opitutus terrae PB90-1]
 gi|177839722|gb|ACB73974.1| protein of unknown function DUF140 [Opitutus terrae PB90-1]
          Length = 250

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 115/208 (55%), Gaps = 2/208 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI Q + +G + +P+V ++SF  G+V+A Q  + +   GA+ +   L+ +   RE+G ++
Sbjct: 35  LIEQCFTIGYTTLPIVAILSFFIGSVLALQAGYAMQNVGAKQYIGSLVGLSMARELGPVM 94

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A+++AGR GS+I AE+ SMK+ +E+DA+ TM +   R+L+ PR+ A++  +P+L ++AN
Sbjct: 95  VAILLAGRVGSSIAAELASMKVYQEVDALVTMNIPPERMLVLPRLIAVLFMMPVLVMIAN 154

Query: 276 FSAIIGASIVI--WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGF 333
                G +IV     +  I    +F+         ++  GLIKA      + +V    G 
Sbjct: 155 LVGWFGGAIVAKYTTFISIDPPAYFAVLRRYTEFKDVLNGLIKAEVFGFGVVLVCCNIGL 214

Query: 334 AVGVHSNSLGKKVTTCVVQSISIVIIID 361
                   +G  VT  VV S+ ++++++
Sbjct: 215 NTRGGPREIGAAVTQAVVTSLILILVLN 242


>gi|16273014|ref|NP_439243.1| ABC transporter permease [Haemophilus influenzae Rd KW20]
 gi|260580171|ref|ZP_05848001.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
 gi|1176838|sp|P45030|Y1086_HAEIN RecName: Full=Probable ABC transporter permease protein HI_1086
 gi|1574640|gb|AAC22742.1| conserved hypothetical protein [Haemophilus influenzae Rd KW20]
 gi|260093455|gb|EEW77388.1| conserved hypothetical protein [Haemophilus influenzae RdAW]
          Length = 261

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 72/218 (33%), Positives = 123/218 (56%), Gaps = 1/218 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLIDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPVLSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
               S  + +  T  VV +  +V+ +D +     F  G
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLDFILTAIMFGAG 261


>gi|319789984|ref|YP_004151617.1| protein of unknown function DUF140 [Thermovibrio ammonificans HB-1]
 gi|317114486|gb|ADU96976.1| protein of unknown function DUF140 [Thermovibrio ammonificans HB-1]
          Length = 260

 Score =  109 bits (273), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 68/213 (31%), Positives = 117/213 (54%), Gaps = 3/213 (1%)

Query: 154 LSLIRQMYY---VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
           L L R +YY   +G   +PV+ + S  TG VIA +      +F AE     +++I   RE
Sbjct: 38  LRLKRFIYYLATIGSDSIPVIAVTSLFTGGVIALETYNAFHRFNAEFMIGAVVAISMARE 97

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +  +L+A+++  RSGSA+ AEIG+M++ E+IDA+  M ++ ++ LI+PRI+A  ISL  L
Sbjct: 98  LSPVLSALLVTARSGSAMAAEIGTMRVTEQIDALEMMAVNPIKFLITPRIYATTISLVFL 157

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
           T++A+    IG  +V    + +   ++     + A + ++F GLIKA      +  ++  
Sbjct: 158 TVIADIIGYIGGYLVSVHIFGVNKTLYLRYTQNFAHMEDVFHGLIKAAVFGFLLSTISCL 217

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
            G+     +  +G+  T  VV S   ++I D L
Sbjct: 218 YGYYTRGGAKGVGESTTKAVVSSSIAILIFDYL 250


>gi|303327433|ref|ZP_07357874.1| ABC transporter, permease protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862373|gb|EFL85306.1| ABC transporter, permease protein [Desulfovibrio sp. 3_1_syn3]
          Length = 375

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 118/217 (54%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           +  MY  GV  +P++ + S + G ++A  GA QL+QFGA+I+   L+ I  LR +G ++ 
Sbjct: 159 VAAMYECGVQALPIISVTSMLFGLILAFVGAVQLTQFGAQIYVAGLVGIGMLRVMGAVMV 218

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
            V+++GR G+A  A IG+M++NEE+DA+ T+G+  V  L+ PR+ AL   +PLLT+ A+ 
Sbjct: 219 GVVMSGRVGAAYAALIGTMQVNEEVDALATLGISPVDFLVLPRVLALTAMVPLLTLYADL 278

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
             ++G  +V     D+    + +         ++  GL+        I +    +G   G
Sbjct: 279 MGVLGGYLVGVMMLDLNPMEYINATTQMVPFKHVLIGLVYGTVFGVVIAVAGCYQGMRCG 338

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
             + ++G+  TT VV SI  +I+  +   +    +G+
Sbjct: 339 RSAQAVGQATTTAVVHSIVGIIVATAAITVICNVLGV 375


>gi|90413007|ref|ZP_01221005.1| hypothetical protein P3TCK_24185 [Photobacterium profundum 3TCK]
 gi|90326022|gb|EAS42461.1| hypothetical protein P3TCK_24185 [Photobacterium profundum 3TCK]
          Length = 260

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 69/216 (31%), Positives = 119/216 (55%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V++ QG   L  FGAE     ++++  LRE+G ++
Sbjct: 44  LMKQLYSVGVLSIAIIMVSGLFIGMVLSLQGYIVLVDFGAETSLGQMVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+PLL ++ +
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVIAPRFWAGVISMPLLAMMFS 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V   +  I +  F+S   ++  L  +I    IK+   A  I  +A+  G+ 
Sbjct: 164 AVGIWGGQLVGVDWKGIDYGSFWSVMQASVELGEDIGNSFIKSVVFAITITWIAVFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV S   V+ +D +     F 
Sbjct: 224 AVPTSEGISRATTRTVVNSSLAVLGLDFVLTALMFG 259


>gi|218710669|ref|YP_002418290.1| ABC transport protein: transmembrane protein (IM) [Vibrio
           splendidus LGP32]
 gi|218323688|emb|CAV20020.1| ABC transport protein: transmembrane protein (IM) [Vibrio
           splendidus LGP32]
          Length = 261

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 122/224 (54%), Gaps = 2/224 (0%)

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           K K F L L++Q Y VGV  + ++++     G V++ QG   L  +GAE     ++++  
Sbjct: 38  KLKNFPL-LVKQFYSVGVQSLAIILVSGLFIGMVLSLQGYVVLIDYGAEGNLGQMVALSL 96

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           LRE+G ++TA++ AGR+GSA+ AEIG MK  E+I ++  M +D ++ +I+PR+WA +IS+
Sbjct: 97  LRELGPVVTALLFAGRAGSALTAEIGLMKATEQISSLEMMAVDPLKRIIAPRLWAGLISM 156

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGI 326
           PLL ++     I GA +V   +  I    F+S   S+  L  +I   +IK    A  +  
Sbjct: 157 PLLAMIFMAVGIWGAQLVGVDWKGIDHGSFWSAMQSSVELGRDIGNSMIKCMVFAITVTW 216

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +A+  G+     S  + +  T  VV S   V+ +D +     F 
Sbjct: 217 IALFNGYDAVPTSEGISQATTRTVVHSSLAVLGLDFVLTALMFG 260


>gi|127514231|ref|YP_001095428.1| hypothetical protein Shew_3303 [Shewanella loihica PV-4]
 gi|126639526|gb|ABO25169.1| protein of unknown function DUF140 [Shewanella loihica PV-4]
          Length = 261

 Score =  109 bits (272), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 119/216 (55%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LI+Q+Y +GV  + ++++     G V+A QG   L  FG E     ++++  LRE+G ++
Sbjct: 45  LIKQLYVIGVQSMVIILVSGLFIGMVLALQGYNILVGFGTEDSLGPMVALSLLRELGPVV 104

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +ISLPLL ++  
Sbjct: 105 TALLFAGRAGSALTAEIGLMKSTEQLSSLEMMAIDPLRQVIAPRFWAGVISLPLLALMFT 164

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V  ++  I    F+S   ++     +I   LIK+   A  +  +A+  G+ 
Sbjct: 165 AVGIYGGHLVGVEWKGIDSGSFWSILQASVEWRQDIVNCLIKSLVFAVVVTWIALYRGYH 224

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           V  +   + +  T  VVQS   V+ +D L     F 
Sbjct: 225 VIPNPEGISRATTQTVVQSSLAVLALDFLLTAMMFG 260


>gi|71282011|ref|YP_271183.1| hypothetical protein CPS_4535 [Colwellia psychrerythraea 34H]
 gi|71147751|gb|AAZ28224.1| putative membrane protein [Colwellia psychrerythraea 34H]
          Length = 258

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 120/215 (55%), Gaps = 1/215 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++Q+Y VGV  + ++++     G V+A QG   L  +GAE     ++++  LRE+G ++
Sbjct: 42  LMQQLYSVGVLSLLIIVVSGTFIGMVLALQGYTILVGYGAEASLGPMVALSLLRELGPVV 101

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA  ISLPLL  + +
Sbjct: 102 AALLFAGRAGSALTAEIGLMKATEQLSSLEMMAIDPLRRVIAPRFWAGFISLPLLAAIFS 161

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFA 334
              I+GA +V   +  +    F+S          +I  G+IK+   A  +  +A+ +G+ 
Sbjct: 162 MVGILGAHVVGVDWLGVDGGTFWSVMQDQVDFQKDILNGIIKSIVFAFVVMWIAVYKGYD 221

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
               S  + +  T+ VVQS  +V+ +D +     F
Sbjct: 222 CEPTSEGISRATTSTVVQSSLLVLFLDFILTALMF 256


>gi|260596176|ref|YP_003208747.1| hypothetical protein CTU_03840 [Cronobacter turicensis z3032]
 gi|260215353|emb|CBA27350.1| UPF0393 inner membrane protein yrbE [Cronobacter turicensis z3032]
          Length = 262

 Score =  109 bits (272), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 140/265 (52%), Gaps = 12/265 (4%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGV 168
           NL   +G++ +KF + S  +A   GL++ N         +F+     L+RQ+Y+VGV  +
Sbjct: 6   NLLASMGQRGLKF-SASFGRA---GLMLFNA---IVGKPEFRKHGPLLVRQLYHVGVLSM 58

Query: 169 PVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAI 228
            ++I+     G V+  QG   L+ +GAE     L+++  LRE+G ++ A++ AGR+GSA+
Sbjct: 59  IIIIVSGLFIGMVLGLQGYLVLTTYGAETSLGMLVALSLLRELGPVVAALLFAGRAGSAL 118

Query: 229 VAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASI--VI 286
            AEIG MK  E++ ++  M +D +R +ISPR WA +ISLPLLT++     + G S+  V 
Sbjct: 119 TAEIGLMKATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTVIFVAVGVWGGSLVGVN 178

Query: 287 WKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKK 345
           WK  D  F  F+S          ++   LIK+   A  +  +A+  G+     S  + + 
Sbjct: 179 WKGIDAGF--FWSAMQDAVDWRMDLINCLIKSVVFAITVTWIALFNGYDAIPTSAGISRA 236

Query: 346 VTTCVVQSISIVIIIDSLFAIFYFA 370
            T  VV +   V+ +D +     F 
Sbjct: 237 TTRTVVHASLAVLGLDFVLTALMFG 261


>gi|86147572|ref|ZP_01065882.1| putative ABC superfamily transport protein [Vibrio sp. MED222]
 gi|85834611|gb|EAQ52759.1| putative ABC superfamily transport protein [Vibrio sp. MED222]
          Length = 259

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/224 (32%), Positives = 122/224 (54%), Gaps = 2/224 (0%)

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           K K F L L++Q Y VGV  + ++++     G V++ QG   L  +GAE     ++++  
Sbjct: 36  KLKNFPL-LVKQFYSVGVQSLAIILVSGLFIGMVLSLQGYVVLIDYGAEGNLGQMVALSL 94

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           LRE+G ++TA++ AGR+GSA+ AEIG MK  E+I ++  M +D ++ +I+PR+WA +IS+
Sbjct: 95  LRELGPVVTALLFAGRAGSALTAEIGLMKATEQISSLEMMAVDPLKRIIAPRLWAGLISM 154

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGI 326
           PLL ++     I GA +V   +  I    F+S   S+  L  +I   +IK    A  +  
Sbjct: 155 PLLAMIFMAVGIWGAQLVGVDWKGIDHGSFWSAMQSSVELGRDIGNSMIKCMVFAITVTW 214

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +A+  G+     S  + +  T  VV S   V+ +D +     F 
Sbjct: 215 IALFNGYDAVPTSEGISQATTRTVVHSSLAVLGLDFVLTALMFG 258


>gi|68249643|ref|YP_248755.1| ABC transporter permease [Haemophilus influenzae 86-028NP]
 gi|68057842|gb|AAX88095.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 86-028NP]
 gi|309973443|gb|ADO96644.1| Phospholipid ABC transporter, permease component [Haemophilus
           influenzae R2846]
          Length = 261

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 121/207 (58%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPILSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G+S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGSSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  + +  T  VV +  +V+ +D
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLD 250


>gi|148828248|ref|YP_001293001.1| ABC transporter permease [Haemophilus influenzae PittGG]
 gi|148719490|gb|ABR00618.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittGG]
          Length = 261

 Score =  108 bits (271), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 120/207 (57%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPILSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  + +  T  VV +  +V+ +D
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLD 250


>gi|146313264|ref|YP_001178338.1| hypothetical protein Ent638_3630 [Enterobacter sp. 638]
 gi|145320140|gb|ABP62287.1| protein of unknown function DUF140 [Enterobacter sp. 638]
          Length = 260

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 118/218 (54%), Gaps = 5/218 (2%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+RQ+Y VGV  + ++I+     G V+  QG   L+ + AE     L+++  LRE+G ++
Sbjct: 44  LVRQLYNVGVLSMLIIIVSGLFIGMVLGLQGYLVLTTYSAETSLGMLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++ AGR+GSA+ AEIG M+  E++ ++  M +D +R +ISPR WA +ISLPLLTIL  
Sbjct: 104 AALLFAGRAGSALTAEIGLMRATEQLSSMEMMAVDPLRRVISPRFWAGVISLPLLTILFV 163

Query: 276 FSAIIGASI--VIWKYYDIPFAVFFSRFHSTATL-ANIFTGLIKAPFMACAIGIVAMKEG 332
              I G S+  V WK  D  F  F+S       L  ++   LIK+   A  +  +A+  G
Sbjct: 164 AVGIWGGSLVGVQWKGIDAGF--FWSAMQDAVDLRMDLVNCLIKSVVFAFTVTWIALFNG 221

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           +     S  + +  T  VV S   V+ +D +     F 
Sbjct: 222 YDAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFG 259


>gi|218885146|ref|YP_002434467.1| hypothetical protein DvMF_0038 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756100|gb|ACL06999.1| protein of unknown function DUF140 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 381

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 105/181 (58%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++ M   G + +P+V LIS + G ++A  GA QL  FGA+I+   L++I  +R +G ++
Sbjct: 164 LLQFMSESGSAALPIVSLISMLVGLILAFVGAVQLRVFGAQIYVASLVAIAMVRVMGAIM 223

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           T + +AGR+G++  A +G+M++NEE+DA+ TMGL  V  L+ PR+ AL++ LPLLT+ A+
Sbjct: 224 TGITMAGRTGASYAAILGTMQVNEEVDALATMGLRPVEQLVLPRLLALVVMLPLLTVYAD 283

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              ++G  IV     D+    + +      +LAN++ G+         + +     G   
Sbjct: 284 LMGMLGGFIVGVFMLDLNPMEYLNATREALSLANLWIGITHGAVFGVVVALCGCYHGMRC 343

Query: 336 G 336
           G
Sbjct: 344 G 344


>gi|225848307|ref|YP_002728470.1| toluene tolerance protein Ttg2B [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643396|gb|ACN98446.1| putative toluene tolerance protein Ttg2B [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 247

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 115/215 (53%), Gaps = 2/215 (0%)

Query: 149 FKGF--LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSIL 206
           FK F  L  +++ M  +GV+   ++IL  F TG V+  +      +F AE     L+S+ 
Sbjct: 25  FKRFPKLKHILKYMEDIGVNAALLIILTGFFTGGVLVVETYPTFHKFNAEYLMGALVSLS 84

Query: 207 QLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
             RE+  +L A+++  RSGSAI A IG+M+I E+IDA+  M ++    L+SPR+ A ++ 
Sbjct: 85  LARELSPVLVALLVTARSGSAIAANIGTMRITEQIDALEVMAVNPYSYLVSPRLIAAVVM 144

Query: 267 LPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGI 326
           +P LT+L+  S +IG        Y I   +++ +      L +IF GL KA      + I
Sbjct: 145 VPALTVLSYVSGVIGGYFTSVYIYGINEYMYWEKLKDFTELKDIFGGLYKAAVFGAVLTI 204

Query: 327 VAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           V    G+     +  +G+  TT VV +  +++I+D
Sbjct: 205 VTSYFGYITKGGAEGVGRSTTTAVVVASVLILILD 239


>gi|145627949|ref|ZP_01783750.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 22.1-21]
 gi|145632451|ref|ZP_01788186.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 3655]
 gi|145634244|ref|ZP_01789955.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittAA]
 gi|145636462|ref|ZP_01792130.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittHH]
 gi|145638100|ref|ZP_01793710.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittII]
 gi|148826300|ref|YP_001291053.1| ABC transporter permease [Haemophilus influenzae PittEE]
 gi|229843875|ref|ZP_04464016.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 6P18H1]
 gi|229846118|ref|ZP_04466230.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 7P49H1]
 gi|144979724|gb|EDJ89383.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 22.1-21]
 gi|144987358|gb|EDJ93888.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 3655]
 gi|145268688|gb|EDK08681.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittAA]
 gi|145270287|gb|EDK10222.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittHH]
 gi|145272429|gb|EDK12336.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittII]
 gi|148716460|gb|ABQ98670.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae PittEE]
 gi|229811122|gb|EEP46839.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 7P49H1]
 gi|229812869|gb|EEP48557.1| conserved ABC-type transport system protein, permease component
           [Haemophilus influenzae 6P18H1]
 gi|301169827|emb|CBW29431.1| predicted toluene transporter subunit: membrane component of ABC
           superfamily [Haemophilus influenzae 10810]
 gi|309751266|gb|ADO81250.1| Phospholipid ABC transporter, permease component [Haemophilus
           influenzae R2866]
          Length = 261

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/207 (33%), Positives = 120/207 (57%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L++QM+ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++
Sbjct: 44  LVKQMHVLGVQSLLIILLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVV 103

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA +IS+P+L+IL  
Sbjct: 104 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGVISMPILSILFI 163

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G S+V   +  +    F+S   ++ + + +I  G IKA F A A+  +A+  G+ 
Sbjct: 164 AIGIWGGSLVGVDWKGVDSGSFWSVMQNSVSWSYDILNGFIKAVFFAVAVTWIALFNGYD 223

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  + +  T  VV +  +V+ +D
Sbjct: 224 CMPTSEGISQATTRTVVHASLVVLGLD 250


>gi|303327746|ref|ZP_07358186.1| thioredoxin family protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862107|gb|EFL85041.1| thioredoxin family protein [Desulfovibrio sp. 3_1_syn3]
          Length = 267

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 117/216 (54%), Gaps = 5/216 (2%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           ++Q+Y +G   + V++LI    G V+  QG + L QFG+       +S+  +RE+G +LT
Sbjct: 50  LQQIYVIGYKSLFVILLIGIFCGMVLGLQGYYTLIQFGSVGMLGSAVSLTLIRELGPVLT 109

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+M+ GR+GS++ AEIG M+I ++IDA+  M ++ +  L+SPR+ A +IS PLLT + + 
Sbjct: 110 AIMLTGRAGSSMAAEIGVMRITDQIDALDVMDINSLGYLVSPRLVAALISFPLLTAIFDV 169

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV- 335
             I+G  +       I    +F R  S+ T+ +I  G +KA      +  V   +G+   
Sbjct: 170 IGILGGYLTGVLMLGINEGAYFYRIASSVTMTDISGGFVKALVFGLLVTTVCCHQGYYTH 229

Query: 336 ----GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
                V   ++G   T+ VV S  +++  D +   F
Sbjct: 230 RRRDSVGPEAVGNATTSAVVISCVLILAADYVLTSF 265


>gi|251793143|ref|YP_003007871.1| ABC transporter permease [Aggregatibacter aphrophilus NJ8700]
 gi|247534538|gb|ACS97784.1| conserved ABC-type transport system protein, permease component
           [Aggregatibacter aphrophilus NJ8700]
          Length = 261

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/206 (33%), Positives = 118/206 (57%), Gaps = 1/206 (0%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I+Q++ +GV  + +++L     G V+  QG   L  F AE     L+++  LRE+G ++T
Sbjct: 45  IKQLHVLGVQSLLIIMLSGLFIGMVLGLQGYVVLVDFSAETSLGQLVALSLLRELGPVVT 104

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A++ AGR+GSA+ AEIG MK  E++ ++  M +D +R +I+PR WA II++P+L+I+   
Sbjct: 105 ALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLRRVIAPRFWAGIIAMPILSIIFIA 164

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAV 335
             I G S+V   +  +    F+S   ++ T   +I  G IK+ F A A+  +A+  G+  
Sbjct: 165 IGIWGGSLVGVDWKGVDAGSFWSVMQNSVTWGHDILNGSIKSLFFAIAVVWIALFNGYDC 224

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIID 361
              S  + K  T  VV +  +V+ +D
Sbjct: 225 IPTSEGISKATTRTVVHASLVVLGLD 250


>gi|312881882|ref|ZP_07741649.1| hypothetical protein VIBC2010_12694 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370461|gb|EFP97946.1| hypothetical protein VIBC2010_12694 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 263

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 118/216 (54%), Gaps = 1/216 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           LIRQ+Y VGV  + +++L     G V++ QG   L  FGAE     ++++  LRE+G ++
Sbjct: 47  LIRQLYSVGVQSLLIIVLSGLFIGMVLSLQGYVILVDFGAEGALGQMVALSLLRELGPVV 106

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ ++  M +D ++ +I+PR WA +IS+P+L ++  
Sbjct: 107 TALLFAGRAGSALTAEIGLMKATEQLSSLEMMAVDPLKRVIAPRFWAGVISMPMLAMIFM 166

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
              I G  +V   +  I    F+S   ++  L  +I   LIK+   A  +  VA+  G+ 
Sbjct: 167 AVGIWGGQLVGVDWKGIDNGSFWSAMQASVELGQDIGNSLIKSMVFAFTVTWVALFNGYD 226

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
               S  + +  T  VV S   V+ +D +     F 
Sbjct: 227 AVPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFG 262


>gi|326795053|ref|YP_004312873.1| hypothetical protein Marme_1781 [Marinomonas mediterranea MMB-1]
 gi|326545817|gb|ADZ91037.1| protein of unknown function DUF140 [Marinomonas mediterranea MMB-1]
          Length = 260

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 122/207 (58%), Gaps = 1/207 (0%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           L+ Q+Y VGV  + +VI+     G V+A QG   L++FG+E     L+++  LRE+G ++
Sbjct: 43  LVNQVYSVGVLSLVIVIVSGCFIGMVLALQGYTILAKFGSEQAVGQLLALSLLRELGPVV 102

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA++ AGR+GSA+ AEIG MK  E++ +   MG+D +R +I+PR  A +I +PLL ++ +
Sbjct: 103 TALLFAGRAGSALTAEIGLMKATEQLSSYEMMGVDPLRRVIAPRFIAGMICMPLLCLIFS 162

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFA 334
            + I+G  +V   +  I    F+S    +     ++F G+IK+ F ACAI  +A+ +GF 
Sbjct: 163 ATGILGGMLVSVHWLGIYDGSFWSLMQQSVYFDIDVFNGIIKSIFFACAITWIAVYQGFE 222

Query: 335 VGVHSNSLGKKVTTCVVQSISIVIIID 361
               S  +GK  T  VV     V+ +D
Sbjct: 223 CDPTSEGIGKATTRTVVLGSLAVLFLD 249


>gi|229588433|ref|YP_002870552.1| putative ABC transporter membrane protein [Pseudomonas fluorescens
           SBW25]
 gi|229360299|emb|CAY47156.1| putative ABC transport system, membrane protein [Pseudomonas
           fluorescens SBW25]
          Length = 265

 Score =  108 bits (270), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 124/215 (57%), Gaps = 1/215 (0%)

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVL