BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus
Liberibacter asiaticus str. psy62]
         (373 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62]
 gi|254039815|gb|ACT56611.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62]
          Length = 373

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY
Sbjct: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
           FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK
Sbjct: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA
Sbjct: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE
Sbjct: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR
Sbjct: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII
Sbjct: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360

Query: 361 DSLFAIFYFAIGI 373
           DSLFAIFYFAIGI
Sbjct: 361 DSLFAIFYFAIGI 373


>gi|209964745|ref|YP_002297660.1| ABC transporter, permease protein, putative [Rhodospirillum
           centenum SW]
 gi|209958211|gb|ACI98847.1| ABC transporter, permease protein, putative [Rhodospirillum
           centenum SW]
          Length = 384

 Score =  283 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 124/371 (33%), Positives = 195/371 (52%), Gaps = 5/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E    V    G W    +  +   +         + S  +DLS +  +DT GA LI    
Sbjct: 19  EEDQWVLAAGGRWDLSAVPRLDQRL-RTAGPDRPASSVCIDLSGLVALDTAGALLIDRLA 77

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           E+   +     +      L +L+    R    +        Y    +L   +G+  V+  
Sbjct: 78  ERLRAEGHTVAIVGARPDLCALLREVRRASRADSPA--LPRYEPMHDLLERVGRATVEAG 135

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D+      LG+V            +F+      +  +  VG++ +P+V L+SF+ G V+
Sbjct: 136 QDAAKLLGFLGMVTVTALRLVRQPRRFRM--TPFVFHLEQVGLNALPIVGLLSFLIGIVL 193

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL  FGAEIF ++L+ I  LREIG+L+T++++AGRSGSA  A+IG+MK+N+E+D
Sbjct: 194 AYQGADQLRLFGAEIFVVNLLGIGVLREIGILMTSIIVAGRSGSAFTAQIGTMKVNQEVD 253

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+GLD V +L+ PR+ AL+++LPLL   AN  A+ G +++ + Y DI F  F  +  
Sbjct: 254 AMRTLGLDPVELLVLPRLLALMVALPLLGFYANVVALFGGAVMAYSYLDITFGQFLKQLQ 313

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                  +F GL+KAP  A  I +V   EG  V   + S+G+  T  VV SI +VI++D+
Sbjct: 314 LAVNETTLFVGLVKAPVFAIVIALVGCYEGLRVTGSAQSVGQLTTRSVVVSIFLVIVLDA 373

Query: 363 LFAIFYFAIGI 373
           LF+I +  +GI
Sbjct: 374 LFSILFSYLGI 384


>gi|92117460|ref|YP_577189.1| hypothetical protein Nham_1921 [Nitrobacter hamburgensis X14]
 gi|91800354|gb|ABE62729.1| protein of unknown function DUF140 [Nitrobacter hamburgensis X14]
          Length = 388

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 135/372 (36%), Positives = 206/372 (55%), Gaps = 4/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S       R  G+W +  +  +         +  ++ S  +D+S ++E+DT+GA L+   
Sbjct: 21  SRGDALELRPDGSWIAANVIALETLADAVAPQVERAKSLKMDMSGLSELDTLGAWLLEKL 80

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +         V    E    LI         N  P ++   N        IG+     
Sbjct: 81  SRRVASADHPVEVVGVSENYAGLIEEVRHVNRHNPPPPKAR--NPVIAKVEEIGRSAWGS 138

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D      +LG +              +  L SL+ Q+Y VG   +P+++LI+F+ GA+
Sbjct: 139 REDVAVFLQMLGSLCVALLGIIRKPRSLR--LTSLVYQLYRVGWQAIPIILLITFLIGAI 196

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGA+ + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EEI
Sbjct: 197 IAQQGFFHFRKFGADSYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEI 256

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD V +LI PR+ AL+ +LP+LT + + +A+ G  +V W Y  +  ++F +R 
Sbjct: 257 DALSTMGLDPVVVLILPRVLALVSALPILTFIGSMAALYGGGLVAWFYGGMGPSIFIARL 316

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   ++ +   G+IKAPFMA  IGIVA  EG  V   + SLGK+ TT VV+SI +VI++D
Sbjct: 317 HDAVSVTHFEVGMIKAPFMALVIGIVACSEGLRVKGSAESLGKQTTTSVVKSIFLVIVLD 376

Query: 362 SLFAIFYFAIGI 373
            LFA+F+ +IG+
Sbjct: 377 GLFAVFFASIGM 388


>gi|83858858|ref|ZP_00952380.1| ABC transporter, permease protein, putative [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853681|gb|EAP91533.1| ABC transporter, permease protein, putative [Oceanicaulis
           alexandrii HTCC2633]
          Length = 384

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 112/371 (30%), Positives = 180/371 (48%), Gaps = 5/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +    +    G+W    +      +   I         ++DLS +  IDT GA ++   +
Sbjct: 19  DGARLIVEPKGDWLMEAVGRFDRRLRR-IESETDPKDLVIDLSGLGRIDTAGAYVLGRTL 77

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +       +      +    ++    ++     + +         +    IG+ +   +
Sbjct: 78  SRCREPDADRHFIGEHQTARRMMGEMLQRLADCPEDEIQPR--GVISTLARIGQGVEDGL 135

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            ++       G   +       +  K +    S I  M   GV  +P++ ++SF  GAV+
Sbjct: 136 KETVESFAFFGRTFTTGLSVLVNPTKMR--WTSTIHLMETAGVDALPIISVLSFFIGAVV 193

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L  FGA +F++DL+ I  LRE GV++TA+++AGRS SA  A IGSMK+ +EID
Sbjct: 194 AFMGASLLETFGASVFTVDLVGIAVLREFGVIITAILLAGRSDSAFTAAIGSMKMQQEID 253

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MGLD   +L+ PR+ A ++  PLLT+ A  + + G  +V W   DI    F +R +
Sbjct: 254 AMKVMGLDPYEVLVLPRVIACVVMAPLLTLSAMVAGVFGGMLVSWMTLDISPNFFLTRLN 313

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T  L +   G+ KAP     I IV  + G  VG    SLGK+VTT VVQ+I  VI+ID+
Sbjct: 314 DTIDLKHFLVGMSKAPVFGLVIAIVGCRHGLQVGGDVESLGKRVTTSVVQAIFAVIVIDA 373

Query: 363 LFAIFYFAIGI 373
           LFA+ Y  + I
Sbjct: 374 LFAMMYLELDI 384


>gi|119945392|ref|YP_943072.1| hypothetical protein Ping_1681 [Psychromonas ingrahamii 37]
 gi|119863996|gb|ABM03473.1| hypothetical protein DUF140 [Psychromonas ingrahamii 37]
          Length = 383

 Score =  278 bits (712), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 110/375 (29%), Positives = 187/375 (49%), Gaps = 10/375 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY- 60
           + +G  +FR  G+W +  +  +   +         + S   D+S + ++D+ G  L ++ 
Sbjct: 16  NNSGSILFRCQGDWTAKALQNVLRYLEKEAGILF-NMSVQWDVSGVGKVDSAGIMLYIHY 74

Query: 61  --FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
              ++  H  ++L G  +  + L+ L+    R  +  Q   +    +       +IGK  
Sbjct: 75  HDLLKLQHCTVELTGARSEYQNLYQLL----RSHVSQQAVSKPGLLSRLLLPFTNIGKST 130

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
                D       +G   +            +    S+++ +   GV  +P+V L S + 
Sbjct: 131 ENLWRDINDFLTFIGEHSAALLTSLRHPSSIRY--ASIVKNIEEAGVRALPIVALTSCLI 188

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G VI  Q A QL +FGA IF +D++ I   RE+  L+TA+++AGR+GS+  A++G+M I 
Sbjct: 189 GVVITYQSALQLQKFGANIFIVDMIGISVTRELAPLITAIVVAGRTGSSYTAQLGAMTIT 248

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEI A+RTMG +  R L+ PRI AL+I +PLL + A+   I G  IV   + +I +A F 
Sbjct: 249 EEISAMRTMGFEPHRFLVLPRIIALMIVMPLLILFADVIGIAGGMIVSNIHLNISYAEFI 308

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R      + +++ GL K PF A  I I     GF V  ++ SLG+  T  VV +I +VI
Sbjct: 309 HRLQHVLDIKHLWIGLFKGPFFAWLIAITGCFRGFQVASNTESLGRYTTISVVNAIFLVI 368

Query: 359 IIDSLFAIFYFAIGI 373
             D+LF++ +  +G+
Sbjct: 369 ACDALFSVIFTELGL 383


>gi|152992948|ref|YP_001358669.1| ABC transporter, permease [Sulfurovum sp. NBC37-1]
 gi|151424809|dbj|BAF72312.1| ABC transporter, permease [Sulfurovum sp. NBC37-1]
          Length = 367

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 115/363 (31%), Positives = 183/363 (50%), Gaps = 18/363 (4%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK--IK 70
           G W    + EI  +    +       S + DLS +   D+ G  L M + +K   K  ++
Sbjct: 21  GEWTLATVPEIEKE----LKGIPMGKSVLWDLSGVEAFDSAGVLLFMEYYDKLKQKNAVE 76

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
           L G S   ++++ L+     +K+  +K           +    +GK  +  + D      
Sbjct: 77  LVGYSESQKEMYDLLRKHMIEKVPERK----------TSFFEELGKSTLVVLGDIKDLIT 126

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
            LG +              +     ++  +++ G + + ++ L SF+ G VIA QGA QL
Sbjct: 127 FLGHLFFTLFNVLFHPRNIRI--KEMVYHIHHSGFNALMIIGLTSFLVGMVIAYQGAVQL 184

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
           ++FGA+IF +D + I  +RE+G L+TA++IAGRSGSA  AEIG+MKI EEI A+RTMG D
Sbjct: 185 AKFGADIFIVDTVGISMVRELGPLMTAIVIAGRSGSAYTAEIGAMKITEEIAAMRTMGFD 244

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
               L+ PRI+ALI++LPLL   ++   I G  +      +I  A F  R +    + + 
Sbjct: 245 PYNFLVMPRIFALIVALPLLIFFSDIMGIFGGMVASQMELNISMAQFVDRLNEVLEVKHY 304

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             G+IK P  A  I  +    GF V  ++ SLG + T  VV SI +VI  D+LF++ Y  
Sbjct: 305 ILGMIKGPVFAFVIAAIGCFRGFQVSDNTESLGLQTTASVVNSIFLVIAFDALFSVIYTE 364

Query: 371 IGI 373
           + +
Sbjct: 365 LNL 367


>gi|292490603|ref|YP_003526042.1| hypothetical protein Nhal_0469 [Nitrosococcus halophilus Nc4]
 gi|291579198|gb|ADE13655.1| protein of unknown function DUF140 [Nitrosococcus halophilus Nc4]
          Length = 380

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 106/371 (28%), Positives = 184/371 (49%), Gaps = 10/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +  R  G W    IS++   + +            VD S IT++DT GA L+   +
Sbjct: 20  DPATSTLRCLGTWTLYGISQLEQTLPL---SQSHPPVHAVDASGITQMDTGGAWLLQRLL 76

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                + +        ++   L+          Q             +   IG+     +
Sbjct: 77  ADLEQQTRPIPCKGLGQEQQKLLRLVQGGSTSQQLTTAPPP-----GILERIGRLSWAHV 131

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            ++ S    +G  +       A   + +      +  +   G++ +P+V L+ F+ G V+
Sbjct: 132 EEALSFLAFIGETLLYFLRSMAHPSRIR--WRPFLSNLQTAGINALPIVGLLIFLVGVVL 189

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG  QL  +GA IF ++L+++  +RE+  L+ A++IAGR+GSA  A+IG+M++ EEID
Sbjct: 190 AYQGGIQLRAYGANIFIVELVTLTMVRELAPLMAAIIIAGRTGSAFTAQIGTMQVTEEID 249

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ P+I+AL+++LPLLT+ A+   I G  ++     ++ F  F  R  
Sbjct: 250 ALRTLGIPPMEQLVLPKIFALVLALPLLTVFADMVGIFGGMVMSQALLEVEFREFAQRIP 309

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L++   G+ KAP  A  I  V   +GF VG  + S+G+  TT VVQ+I +VII D+
Sbjct: 310 EVVPLSSFLIGVGKAPVFAVIIATVGCYQGFRVGGGAESVGRHTTTSVVQAIFLVIIADA 369

Query: 363 LFAIFYFAIGI 373
            F+I +  +GI
Sbjct: 370 TFSILFSWLGI 380


>gi|209885947|ref|YP_002289804.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
 gi|209874143|gb|ACI93939.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
          Length = 377

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 142/370 (38%), Positives = 213/370 (57%), Gaps = 5/370 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +G      AG+W + ++S +   V  A   +  + +  +D+SA+ EIDTIGA L+   + 
Sbjct: 13  DGRAQMYAAGSWTASQVSALEPAVEAATRTASGARALQLDMSAVNEIDTIGAWLLERMIR 72

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                          E+   LI       +    P      N      Y IG+  V  + 
Sbjct: 73  HARQAGSEIKTVGISERFAGLIEELRSANL---NPPVYEKQNPLLLKLYQIGQSTVSSLQ 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +      +LG + +          + +  L S I Q++ VG   VP+++LI+F+ GA+IA
Sbjct: 130 ELLIFIDMLGRLGTVLARVILHPRRLR--LTSTIYQLHKVGWQAVPIIVLITFLIGAIIA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG F   +FGA+ + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA
Sbjct: 188 QQGIFHFRKFGADAYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEIDA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + TMGLD + +LI PR+ ALII+LP+LT + + +A+ G  ++ W Y D+  A F +R H 
Sbjct: 248 LTTMGLDPLEVLILPRVIALIIALPILTFIGSIAALYGGGLISWLYGDMMPATFIARLHE 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             ++ +   GLIKAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D L
Sbjct: 308 AVSVTHFEVGLIKAPFMALVIGIVASSEGLRVKGSAESLGRQTTTSVVKSIFLVIVLDGL 367

Query: 364 FAIFYFAIGI 373
           FA+F+ +IG+
Sbjct: 368 FAVFFASIGM 377


>gi|39937024|ref|NP_949300.1| hypothetical protein RPA3963 [Rhodopseudomonas palustris CGA009]
 gi|192292851|ref|YP_001993456.1| hypothetical protein Rpal_4485 [Rhodopseudomonas palustris TIE-1]
 gi|39650881|emb|CAE29404.1| putative permease of ABC transporter [Rhodopseudomonas palustris
           CGA009]
 gi|192286600|gb|ACF02981.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           TIE-1]
          Length = 383

 Score =  276 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 130/373 (34%), Positives = 198/373 (53%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++         +G+W +     +   V  A        +  +D+S I  +DT GA LI  
Sbjct: 16  IARGEGLALCASGSWTARFAPALERLVTEAEQLGGSKPNVSIDVSGIARLDTFGAWLIER 75

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    +      +P+      S +     +G+ I  
Sbjct: 76  LRRNLGQDGTEARIAGLSTNYASLVDEVRQVSEAGPEPR---RGGSLRAPIERLGRTIYA 132

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           FI+D  +   ++G V++           F+  L S +  +  V    VP+++LI+F+ G 
Sbjct: 133 FIDDIVALISMMGAVLAGVLRVVVRPTSFR--LTSTVHHLEQVCWRAVPIIVLITFLIGC 190

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGA++F +D++ +L LREIGVLL ++M+AGRSGSA  AE+GSMK+ EE
Sbjct: 191 IIAQQGIFHFRKFGADVFVVDMLGVLVLREIGVLLVSIMVAGRSGSAYTAELGSMKMREE 250

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +LI PR+ AL++++P+LT L   SA+ G  +V W Y  +    F  R
Sbjct: 251 IDALRTMGFDPIDVLIVPRLIALVLAVPILTFLGAMSALYGGGLVAWMYGGVDPEAFLLR 310

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IGIVA  EG AV   + SLG   T  VV+SI  VI++
Sbjct: 311 LRDAISIDHFTVGMIKAPVMAVVIGIVACVEGLAVQGSAESLGSHTTASVVKSIFFVIVM 370

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+  IGI
Sbjct: 371 DGVFAIFFAGIGI 383


>gi|115523755|ref|YP_780666.1| hypothetical protein RPE_1737 [Rhodopseudomonas palustris BisA53]
 gi|115517702|gb|ABJ05686.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisA53]
          Length = 382

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 133/371 (35%), Positives = 200/371 (53%), Gaps = 4/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           + G+   R  G+W +     +         +        +DL+ + EIDT+GA L+    
Sbjct: 16  DAGVLQLRPGGSWTAGNAVVLERLFEEVSPQLQGVRGLRIDLAGVQEIDTLGAWLLEKMS 75

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +   +     +    E+   LI    +       P      N        +G+      
Sbjct: 76  RRAAQQGVSSELVGVDERHAGLIDEVRQVNRNAPAPH--PRGNFVLGWLDQLGRLTWASR 133

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            +      +LG +              +  L SL  Q+Y VG   +P+++LI+F+ GA+I
Sbjct: 134 VEVLVFLQMLGALAVALLGVLRRPRSLR--LTSLFYQVYRVGWQAIPIMLLITFLIGAII 191

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEID
Sbjct: 192 AQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEID 251

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ TM LD V +LI PR+ ALII+LP+L+ L + +A+ G  +V W Y  +   +F +R H
Sbjct: 252 ALSTMDLDPVEVLILPRVLALIIALPILSFLGSMAALYGGGLVAWFYGGMSPTIFIARLH 311

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   G+IKAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI  VI++D 
Sbjct: 312 EAVSVTHFEVGIIKAPFMALVIGIVACSEGLRVKGSAESLGRQTTTSVVKSIFCVIVLDG 371

Query: 363 LFAIFYFAIGI 373
           LFA+F+ +IG+
Sbjct: 372 LFAVFFASIGM 382


>gi|209884491|ref|YP_002288348.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
 gi|209872687|gb|ACI92483.1| ABC transporter permease protein [Oligotropha carboxidovorans OM5]
          Length = 378

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 130/371 (35%), Positives = 198/371 (53%), Gaps = 6/371 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINK-SIQSDSAIVDLSAITEIDTIGAELIMYFM 62
                 R AG W       +   V         ++ + ++D+S ++ +DT GA LI    
Sbjct: 13  GAGVALRAAGEWTVHHAPALEKLVEHTERAGKSRNAALVIDVSQVSRLDTFGAWLIERLR 72

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                      ++       SL+    R K    +P+ +F           +G+ +V+  
Sbjct: 73  RAQIRGDVAPPIAGLSADYASLVEEVKRVKAPPVQPRPAF---GPIRAVEAVGRSVVEVG 129

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
               S  +++G V+            F+    S I  +  V    VP+V+LI+F+ G +I
Sbjct: 130 QTLLSLLNMMGSVLHALWRVILHPSHFR--FTSTIHHLEQVCWRAVPIVLLITFLIGCII 187

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG FQ  +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSM++ EE+D
Sbjct: 188 AQQGIFQFRKFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMRMREEVD 247

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMG D   +LI PRI ALII++P+L  L   +A+ G  +  W Y  +    F +R  
Sbjct: 248 ALRTMGFDPTEVLILPRILALIIAMPILAFLGAMAALYGGGLTAWLYGGVQPDAFLARLR 307

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   GL+KAPFMA  IGI+A  EG AV   + SLG+  T  VV+SI  VI++D 
Sbjct: 308 EAISINHFTVGLVKAPFMALIIGIIACVEGAAVRGSAESLGQHTTASVVKSIFFVIVVDG 367

Query: 363 LFAIFYFAIGI 373
           +FAIF+ +IG+
Sbjct: 368 IFAIFFASIGV 378


>gi|154248034|ref|YP_001418992.1| hypothetical protein Xaut_4113 [Xanthobacter autotrophicus Py2]
 gi|154162119|gb|ABS69335.1| protein of unknown function DUF140 [Xanthobacter autotrophicus Py2]
          Length = 474

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 133/372 (35%), Positives = 199/372 (53%), Gaps = 7/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S++        G W S    E+   V              +DLSA+  +DT GA L    
Sbjct: 110 SQDDRLTVAGRGAWTSEYADELEQAVDDTARSYANPKGIEIDLSAVERMDTFGALLFERL 169

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              + G      V     +   LI    R   +   P         + +    G + V  
Sbjct: 170 KRSWKGTGVEPQVKGLAPRYKVLIEEMGRMGQEQPPPA-----RRHEAILERFGHETVNV 224

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D+ +  + +G  ++  G        F+    +++ QM  VG+  VP+++LI+F+ G +
Sbjct: 225 AADAAALLNFVGASVAAMGRVLLRPRSFR--FTAMVNQMDRVGLRAVPIIVLITFLIGCI 282

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +AQQG F   +FGA+I+ +D++ +L LRE+GVL+ A+MIAGRSGSA  AE+GSM++ EEI
Sbjct: 283 LAQQGIFNFRRFGADIYVVDMVGVLVLRELGVLIVAIMIAGRSGSAYTAELGSMRMREEI 342

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R MG D V +L+ PR+ ALII+LPLLT + + S+++GA +V W Y  I   VF  R 
Sbjct: 343 DALRVMGFDPVEVLVVPRLLALIIALPLLTFIGSMSSLLGAGLVSWGYGGITPDVFLDRL 402

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                +     G+IKAPFMA  IGIVA  EG  VG  + SLG   T  VV++I +VI++D
Sbjct: 403 KGAIDMDQFNVGMIKAPFMAATIGIVACLEGLRVGGSAESLGAHTTASVVKAIFLVIVMD 462

Query: 362 SLFAIFYFAIGI 373
            +FA+F+ AI +
Sbjct: 463 GVFAMFFAAIDM 474


>gi|288962789|ref|YP_003453083.1| ABC transport system permease protein [Azospirillum sp. B510]
 gi|288915055|dbj|BAI76539.1| ABC transport system permease protein [Azospirillum sp. B510]
          Length = 401

 Score =  275 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 119/372 (31%), Positives = 196/372 (52%), Gaps = 5/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +E+G      AG W   E++  A D +          +  +DLS +  +DT+GA L+   
Sbjct: 35  AEDG-WRIAAAGRWTL-EVAAAASDALDHAAPPRDGAALRLDLSGVEALDTVGAYLLSRQ 92

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +   V     +  +L             P     ++   ++    G+  V  
Sbjct: 93  ADRMAADGRAVEVVGVRPEHAALFDAVRDAGKAPPHPIE-REHHPIHDMVVRTGETTVHA 151

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             +       LGLV            + +  L S++  +   G++ +P++ L+SF+ G V
Sbjct: 152 AREVLDLVGFLGLVTVTFVRLILRPSRLR--LTSVLFHIEQTGLNALPILGLLSFLIGVV 209

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A QGA QL +FGAE++ ++L+ I  LREIG+L+TA+++AGRSGSA  A+IG+MK+N+E+
Sbjct: 210 LAFQGADQLKRFGAELYVVNLLGISVLREIGILMTAIIVAGRSGSAFTAQIGTMKVNQEV 269

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DAI TMGLD V +L+ PR  AL+I+LPLL   A+   + G +++ +   DI F  F  + 
Sbjct: 270 DAIGTMGLDPVELLVVPRALALVITLPLLAFYADVMGLFGGAVMAYATLDITFGQFIRQL 329

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           HS   +  +  GLIKAP  A  I +V   EG  V   + S+G   T  VV+ I +VI+ID
Sbjct: 330 HSAIGINTVLAGLIKAPVFALVIAMVGCYEGLKVSGSAESVGIMTTKAVVEGIFLVIVID 389

Query: 362 SLFAIFYFAIGI 373
           ++F++ +  +G+
Sbjct: 390 AVFSVLFSLLGV 401


>gi|85716130|ref|ZP_01047106.1| ABC transporter permease protein [Nitrobacter sp. Nb-311A]
 gi|85697129|gb|EAQ35011.1| ABC transporter permease protein [Nitrobacter sp. Nb-311A]
          Length = 370

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 136/373 (36%), Positives = 214/373 (57%), Gaps = 8/373 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S       R  G W +  ++ +      A  +  ++ S  +D+S ++E+DT+GA L+   
Sbjct: 5   SRGDALELRPDGFWIAANVTVLEALADAAAPQVERAKSLKMDMSGLSELDTLGAWLLEKL 64

Query: 62  MEKYHG-KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
             +  G   ++ GVS +   L   +   +R  +   K +     N        +G+    
Sbjct: 65  SRQIAGHPAEIVGVSENYAGLIEEVRHVNRHNLPPPKAR-----NPVIAKVEEVGRAAWN 119

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D      +LG +              +  L SL+ Q+Y VG   +P+++LI+F+ GA
Sbjct: 120 SREDVAVFLQMLGSLCVALLGIIRKPRSLR--LTSLVYQLYRVGWQAIPIILLITFLIGA 177

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGA+ + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 178 IIAQQGFFHFRKFGADSYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREE 237

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ TMGLD V +LI PR+ AL+++LP+LT + + +A+ G  +V W Y  +  ++F +R
Sbjct: 238 IDALSTMGLDPVVVLILPRVLALVLALPILTFIGSMAALYGGGLVAWFYGGMGPSIFIAR 297

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            H   ++ +   G+IKAPFMA  IGIVA  EG  V   + SLGK+ TT VV+SI +VI++
Sbjct: 298 LHDAVSVTHFQVGMIKAPFMALVIGIVACSEGLRVKGSAESLGKQTTTSVVKSIFLVIVL 357

Query: 361 DSLFAIFYFAIGI 373
           D LFA+F+ +IG+
Sbjct: 358 DGLFAVFFASIGM 370


>gi|316935525|ref|YP_004110507.1| hypothetical protein Rpdx1_4222 [Rhodopseudomonas palustris DX-1]
 gi|315603239|gb|ADU45774.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           DX-1]
          Length = 383

 Score =  274 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 126/373 (33%), Positives = 198/373 (53%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++         +G+W +     +   V  A           +D+S I  +DT GA LI  
Sbjct: 16  IARAEGLALCASGSWTARFAPVLERLVTEAEQLGGSKPDVFIDVSGIARLDTFGAWLIER 75

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    +       P+      + +     +G+ +  
Sbjct: 76  LRRNLGQAGAEARIAGLSANYASLVDEVRQVSETGPAPK---RGGALRAPIERLGRTMYA 132

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F +D  +   ++G V++  G        F+  L S +  +  V  + VP+++LI+F+ G 
Sbjct: 133 FFDDIVALISMMGAVLAGLGRIVIRPTSFR--LTSTVHHLEQVCWNAVPIILLITFLIGC 190

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++AQQG F   +FGA++F +D++ +L LRE+GVLL A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 191 IVAQQGIFHFRKFGADVFVVDMLGVLVLRELGVLLVAIMVAGRSGSAYTAELGSMKMREE 250

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +LI PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R
Sbjct: 251 IDALRTMGFDPIDVLIVPRLIALVLAVPILTFLGAMAALYGGGLVAWLYGGVDPEAFLLR 310

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IGIVA  EG AV   + SLG+  T  VV+SI  VI++
Sbjct: 311 LRDAISIDHFTVGMIKAPVMAAVIGIVACVEGLAVQGSAESLGRHTTASVVKSIFFVIVM 370

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+  IGI
Sbjct: 371 DGVFAIFFAGIGI 383


>gi|299131823|ref|ZP_07025018.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
 gi|298591960|gb|EFI52160.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
          Length = 383

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 132/371 (35%), Positives = 195/371 (52%), Gaps = 6/371 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDS-AIVDLSAITEIDTIGAELIMYFM 62
                 R  G W       +   V         S +  ++D+S I+ +DT GA LI    
Sbjct: 18  GAGVALRAGGEWTVHHAPALEKLVERTERSRDGSRASLVIDVSQISRLDTFGAWLIERLR 77

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                      ++       SL+    R K   +  +  F           +G+ +V   
Sbjct: 78  RALTRGDTAPMIAGLSADYASLVEEVKRVKAVPEPAKVPF---GPVRAVEAVGRTVVGVA 134

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +      ++ G ++S           F+  L S + Q+  V    VP+V+LI+F+ G +I
Sbjct: 135 DTLLGLLNMTGSILSAFWRVILHPSHFR--LTSTVHQLEQVCWRAVPIVVLITFLIGCII 192

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG FQ  +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSM++ EE+D
Sbjct: 193 AQQGIFQFRKFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMRMREEVD 252

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMG D   +LI PRI AL+I++P+L  L   +A+ G  +  W Y  +    F SR  
Sbjct: 253 ALRTMGFDPTEVLILPRILALVIAMPILAFLGAMAALYGGGLTAWLYGGVQPDAFLSRLR 312

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   GL+KAPFMA  IGI+A  EG AV   + SLGK  T  VV+SI  VI++D 
Sbjct: 313 EAISINHFTVGLVKAPFMALIIGIIACVEGAAVQGSAESLGKHTTASVVKSIFFVIVVDG 372

Query: 363 LFAIFYFAIGI 373
           LFAIF+ +IG+
Sbjct: 373 LFAIFFASIGV 383


>gi|226942634|ref|YP_002797707.1| ABC transporter protein [Azotobacter vinelandii DJ]
 gi|226717561|gb|ACO76732.1| ABC transporter protein [Azotobacter vinelandii DJ]
          Length = 382

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 107/364 (29%), Positives = 184/364 (50%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +  ++  A  +   +   ++D   +  +DT GA L++  +      
Sbjct: 22  LNVVGDWTLQHYPRLKREIERARPRLDDACPVVLD--GLGALDTAGAGLLVELLGARRLT 79

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +       +  +L+             +     ++ K+   HIG+ +        + 
Sbjct: 80  DIARWAPQLPAERQALLRTVAMAVAGAAGTEEEPERSTLKDELAHIGRVVETLWEQQRTL 139

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +S          +++     L+  +   G+  VP+V L++F+ GAV+A  GA 
Sbjct: 140 YGFIGLTLSTLLATLPRPRRWRI--TPLVAHIERTGLDAVPIVALLTFMVGAVVAFLGAT 197

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L QFGA I++++L++   LRE GVLL A+++AGR+ SA  A+IG+MK NEEIDAIR +G
Sbjct: 198 VLGQFGATIYTVNLVAYSFLREFGVLLCAILMAGRTASAFAAQIGAMKANEEIDAIRALG 257

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ A++++LP+LT +A    I+G   V     DI    +F+       + 
Sbjct: 258 LDPIELLVLPRVLAMLLTLPILTFIAMLCGILGGLAVCVLALDISPVQYFAILEQEIPVN 317

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAP  A  I ++   EGF     + S+G++ T+ VVQSI +VI+ID+L A+F 
Sbjct: 318 HYLVGLGKAPLFAFLIAVIGCLEGFKASGSAQSVGERTTSSVVQSIFMVILIDALAALFL 377

Query: 369 FAIG 372
             +G
Sbjct: 378 MEMG 381


>gi|260430754|ref|ZP_05784726.1| ABC transporter, inner membrane subunit [Silicibacter
           lacuscaerulensis ITI-1157]
 gi|260418195|gb|EEX11453.1| ABC transporter, inner membrane subunit [Silicibacter
           lacuscaerulensis ITI-1157]
          Length = 374

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 119/370 (32%), Positives = 192/370 (51%), Gaps = 7/370 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           N       +G   +  +  +             +   + DLS +  +DT GA LI     
Sbjct: 12  NDALRIAVSGEMVTQSLESVEKGFRAL---HPDAKRIVFDLSGLGSLDTGGAWLICDLAR 68

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +                  +L+    +        +       F      +G++ V    
Sbjct: 69  RASAAGATVTYENVTATQSALLETVAQNIAAEIPAEAPPR--GFVPWLESLGRRTVGAGR 126

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D+ S    LGL +          ++ +    +L+ QM   G+  +P+V L+ F+ G V+A
Sbjct: 127 DTASMLSFLGLTLHRLARTLVMPWRLRR--AALVSQMEETGLKALPIVALMGFLIGVVLA 184

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            QGA QL QFGAEIF ++L+SI  LRE+GVLLTA+++AGRSGSA  A IGSMK+ EEIDA
Sbjct: 185 FQGATQLKQFGAEIFVVELISISVLRELGVLLTAIIVAGRSGSAFTASIGSMKVQEEIDA 244

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++T+GLD + +L+ PR+ AL+I LP+L  +A+ + + G +++ W    +   +F +R   
Sbjct: 245 MQTLGLDPIEVLVVPRVLALLIMLPILGFVADMAGLFGGALMSWIDLGVSPGMFVTRLKE 304

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + ++  GLIKAPF A  I ++A  +   V   S S+G++ T+ VVQ+I +VI ID+L
Sbjct: 305 NTDVWHLAVGLIKAPFFAVVIAVIACWQAMQVKGSSQSVGQRTTSSVVQAIFMVIAIDAL 364

Query: 364 FAIFYFAIGI 373
           F+IF+  +G+
Sbjct: 365 FSIFFSEVGV 374


>gi|85373087|ref|YP_457149.1| ABC-type transport system permease component [Erythrobacter
           litoralis HTCC2594]
 gi|84786170|gb|ABC62352.1| ABC-type transport system permease component [Erythrobacter
           litoralis HTCC2594]
          Length = 370

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 121/370 (32%), Positives = 201/370 (54%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G TV R AG +    I  I  D+        +   + VDL  +++IDT+GA +     
Sbjct: 13  DDGTTVLRLAGPYLVSTIGPIDQDLRAL-----EGGFSAVDLGDVSQIDTVGAWMACTVA 67

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +  +I+    S    +L   +  +  K     +         F+ +    G+++V+F 
Sbjct: 68  GAHDAEIR--NASDRASRLIDAVQGSINKAETTPE-----RDPLFRRVAMMTGERVVEFG 120

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ++        G +++  G       +F     +L RQ+  VG++ +P++ L+SF+ G VI
Sbjct: 121 HNLLDLLSFAGAIVAGFGRLLLHPGRFPH--KALFRQLELVGINALPIIGLMSFLIGIVI 178

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA QL QFGAE  +++L+  + +RE+GVL+TA+M+AGRSGSA  A+IG+MK+ EE+D
Sbjct: 179 AQQGAVQLEQFGAETLTVNLVGRITMRELGVLMTAIMVAGRSGSAFAAQIGTMKLTEEVD 238

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  V  L+ PRI A ++ +PLL   +   AI+G ++V      IPF  F  R  
Sbjct: 239 AMRTIGISPVEALVLPRILAAVLMMPLLGFYSACVAIVGGAVVSEFALGIPFWNFLERIQ 298

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                 +++ GLIKAP     + +    +G  V  +S  +G + T  VVQ+I +VI++D+
Sbjct: 299 DVVPTYDLWVGLIKAPVFGLIVALAGCYQGMQVRGNSEEVGSRTTKAVVQAIFMVIVLDA 358

Query: 363 LFAIFYFAIG 372
            FA+F+  IG
Sbjct: 359 FFAVFFTEIG 368


>gi|92116871|ref|YP_576600.1| hypothetical protein Nham_1315 [Nitrobacter hamburgensis X14]
 gi|91799765|gb|ABE62140.1| protein of unknown function DUF140 [Nitrobacter hamburgensis X14]
          Length = 377

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 131/373 (35%), Positives = 200/373 (53%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +++        AG W +     +   V  A   +    +  +D+S I+ +DT GA LI  
Sbjct: 10  IAQGDGLALCAAGPWTARFAPALERIVADAEKLAGSRPNIFIDVSQISRLDTFGAWLIER 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    R    +  P       +   L   +G+ +V 
Sbjct: 70  LRRSLTQGGVEAKIAGLSLNYSSLVDEVRRVPAADPAPA---RQRALTGLIEDVGRNVVG 126

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F         +LG V++ +G        F+  L S +  +  V    VP+V+LI+F+ G 
Sbjct: 127 FGTTLTGLIGMLGAVLAASGRVMRHPRSFR--LTSTVHHLEQVCWRAVPIVVLITFLIGC 184

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +I+QQG F   +FGA+IF +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 185 IISQQGIFHFRKFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREE 244

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +L+ PR+ AL+I+LP+L  L   +A+ G  +V W Y  +    F  R
Sbjct: 245 IDALRTMGFDPIEVLVLPRMLALVIALPILAFLGAIAALYGGGLVAWLYGGVQPEAFLIR 304

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IGIVA  EG AV   + SLG++ T+ VV+ I  VI++
Sbjct: 305 LRDAISIDHFVVGMIKAPVMAAVIGIVACVEGLAVEGSAESLGQRTTSSVVKGIFFVIVM 364

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+ +IG+
Sbjct: 365 DGVFAIFFASIGM 377


>gi|182680563|ref|YP_001834709.1| hypothetical protein Bind_3668 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636446|gb|ACB97220.1| protein of unknown function DUF140 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 377

 Score =  273 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 143/368 (38%), Positives = 209/368 (56%), Gaps = 5/368 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
                F  AG+W       +       +    ++  A+ +L+ +  +DT GA LI     
Sbjct: 13  GDAMHFSLAGHWTLEWSKGLESAAADLLKALGKARKAVFNLAGVERLDTAGAWLIDRTRR 72

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
               +     +     +   L    H +     K Q + F   F       GK +V+   
Sbjct: 73  NLSERGVSTELDHVRPEYGILFQEAHFRTFPEPKRQNASF---FVAPLVETGKTVVEAGR 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           ++      LG  I++  +       F+G   SL+ Q+  +G+  VP++ LI+F+ G ++A
Sbjct: 130 ETLRGMSFLGEAIASLAQSFVQRQHFRGI--SLVYQIETIGLRSVPIITLINFLVGCIVA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG FQL +FGA  F++DL+ IL LRE+GVLLT++MIAGRSGSAI AEIGSMK+ EEIDA
Sbjct: 188 QQGLFQLRRFGASTFAVDLLGILTLRELGVLLTSIMIAGRSGSAITAEIGSMKMREEIDA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MGL  + +LI PR+ AL+ISLPLLT +A+ +A+ G  +V + Y  I    F +R H 
Sbjct: 248 LTVMGLRPIEVLIVPRLLALVISLPLLTFIADMAALAGGLLVSYSYGGIQPVAFLNRLHD 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +L   +TGLIKAPFMA  IG++A  EGFAV   + SLG++VTT VV+SI +VI++D L
Sbjct: 308 AISLHTFYTGLIKAPFMALVIGLIAAVEGFAVEGSAESLGRQVTTSVVKSIFMVIVLDGL 367

Query: 364 FAIFYFAI 371
           FA+F+  I
Sbjct: 368 FAMFFAGI 375


>gi|238784662|ref|ZP_04628667.1| ABC transporter, permease protein [Yersinia bercovieri ATCC 43970]
 gi|238714434|gb|EEQ06441.1| ABC transporter, permease protein [Yersinia bercovieri ATCC 43970]
          Length = 381

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 118/364 (32%), Positives = 187/364 (51%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +  +V         +   + DLS +  +DT GA L++  + +   K
Sbjct: 21  VAAKGDWVLAHYRALEPEVTQLRANLPAA--VVFDLSQLGALDTAGATLLVLLLGEERVK 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +   T  ++   L+               +     +  L  +IG+ +     D  S 
Sbjct: 79  QLRKLAPTLPDERRVLLETVSHVLPDLTPEPATKAPPFWLELLSNIGRSMDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFVGLTLEALLSTIFRPSRWRM--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMICGIFGGMVVCALTLDISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPVFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|58580429|ref|YP_199445.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58425023|gb|AAW74060.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 398

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 43  DQAQLRLAGSWVLATALPQAE-----LLQTVPDGVRRIDARGIQQLDSAGVLQLLRFASR 97

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 98  IGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRIGQD 151

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 152 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 209

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 210 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 269

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 270 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 329

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 330 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 389

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 390 ALWFMKMG 397


>gi|78049251|ref|YP_365426.1| ABC transporter permease [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
 gi|78037681|emb|CAJ25426.1| ABC transporter permease [Xanthomonas campestris pv. vesicatoria
           str. 85-10]
          Length = 409

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 118/368 (32%), Positives = 190/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R  G+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 54  DQAQVRLVGSWVLATALPQAE-----LLQAVPDGVRRIDARGIQQLDSAGVLQLLRFAGR 108

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 109 MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRVGQD 162

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 163 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 220

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 221 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 280

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 281 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 340

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 341 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 400

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 401 ALWFMKMG 408


>gi|114798707|ref|YP_761599.1| hypothetical protein HNE_2921 [Hyphomonas neptunium ATCC 15444]
 gi|114738881|gb|ABI77006.1| putative membrane protein [Hyphomonas neptunium ATCC 15444]
          Length = 375

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 108/371 (29%), Positives = 187/371 (50%), Gaps = 9/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +   V R  G+W    I    + +   +    QS    +D+S +  +DT GA LI    
Sbjct: 14  SDEGNVLRLGGDWTVATI----NQLDAQLRAVSQSVPICLDVSGLGRLDTSGAYLIDRTW 69

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +         +        SL+   H        P ++        +    GK  V F 
Sbjct: 70  RENGAAW-PPRIVGDHASAASLLEQVHAHAEPVPPPAKAD--AGLLAMLERTGKGSVDFY 126

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            ++ +    LG  +          +K +    S++  M   G++ +P++  +SF  G V+
Sbjct: 127 KETTASLAFLGETLVTIVRLLVQPWKLR--WTSIVAVMEEAGLNAMPIIAFLSFFVGMVV 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L  F  EI++I+L+    LRE GV+LT +++AGR+ S+  A+IG+MK+ +E+D
Sbjct: 185 AFIGATTLKDFDLEIYTIELIGFSMLREFGVVLTGIVLAGRTNSSFTAQIGTMKMRQEVD 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++T+GL  + +L++PR+ A+++  P+LT +A  + + G + V W   DI  AVF  R  
Sbjct: 245 AMQTLGLKPMDVLVAPRVLAMLVMTPILTFVATLAGVAGGATVAWAALDINPAVFVERMR 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           ++  +   + G+ K+P     + ++A ++G  VG    SLGK  TT VVQ+I  +I+ID+
Sbjct: 305 NSVPIDQFWIGMSKSPVFGLVVALIACRQGLQVGGSVQSLGKATTTSVVQAIFAIIVIDA 364

Query: 363 LFAIFYFAIGI 373
           +FAIFY  +G+
Sbjct: 365 IFAIFYMELGL 375


>gi|86748751|ref|YP_485247.1| hypothetical protein RPB_1627 [Rhodopseudomonas palustris HaA2]
 gi|86571779|gb|ABD06336.1| Protein of unknown function DUF140 [Rhodopseudomonas palustris
           HaA2]
          Length = 383

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 128/373 (34%), Positives = 198/373 (53%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++         AG+W +     +   V  A   +    +  +D+S +  +DT GA LI  
Sbjct: 16  IARGDGLALCAAGSWTAKFAPVLERIVADAEQLTGTRPNIFIDVSEVVRLDTFGAWLIER 75

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    + +     P  +      +     +G+ +  
Sbjct: 76  LRRNLAQDGIEAKIAGLSANYASLVDEVRQVE---PVPADTSRGGGLRAPIEKLGRTMFA 132

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F +D  +   +LG V++           F+  L S +  +  V    VP+V+LI+F+ G 
Sbjct: 133 FGDDIVALISMLGAVLAGVLRAILHPSTFR--LASTVHHLEQVCWRAVPIVVLITFLIGC 190

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 191 IIAQQGIFHFRRFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREE 250

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +LI PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R
Sbjct: 251 IDALRTMGFDPIDVLIVPRLLALLLAMPILTFLGAMAALYGGGLVAWLYGGVDPEAFLLR 310

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IGIVA  EG AV   + SLG+  T  VV+ I  VI++
Sbjct: 311 LRDAISINHFTVGMIKAPVMALVIGIVACVEGLAVRGSAESLGQHTTASVVKGIFFVIVM 370

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+ +IGI
Sbjct: 371 DGVFAIFFASIGI 383


>gi|154252954|ref|YP_001413778.1| hypothetical protein Plav_2512 [Parvibaculum lavamentivorans DS-1]
 gi|154156904|gb|ABS64121.1| protein of unknown function DUF140 [Parvibaculum lavamentivorans
           DS-1]
          Length = 387

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 125/372 (33%), Positives = 199/372 (53%), Gaps = 5/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++  +     AG+W    +  +   +  AI     +  AI+    IT  DT  A ++   
Sbjct: 21  ADGNVLRIEAAGDWSIVHLDPVDRQL-RAIGARPGTGRAIIGFKDITRFDTAAAAILGRT 79

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                 +          +    L+           +P    +      +   IG  +   
Sbjct: 80  AAHLGEQGIKVDFEDVSDAQRLLLDKID--SCGMPEPAHVPWRPLHIQIIDKIGATMRDI 137

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             +  +    +G V++  G   A   + +      +  M   G   +P+V L++F+ GAV
Sbjct: 138 GAEGLAMLGFVGAVMATAGRTIARPSRLR--WTPFVHHMEKAGFDALPLVCLLTFLIGAV 195

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +AQQGA QL QFGAE+F+++L++I+ LRE+G+LLTA+++AGRSGSA  AEIGSMK+ EEI
Sbjct: 196 VAQQGAVQLRQFGAEVFTVNLIAIIFLREVGLLLTAIIVAGRSGSAFTAEIGSMKMREEI 255

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+RT+GLD + +L+ PR+ AL+++LPLLT +A+   +IG  +V+    D+P  V+ SR 
Sbjct: 256 DAMRTLGLDPMEMLVLPRVLALMVTLPLLTFVADIMGLIGGGLVVQVMLDMPPGVYISRV 315

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                      GL+KAPFMA  I +V  + G +V   + S+G   T  VV+SI +VII+D
Sbjct: 316 QEAVGFWTFGVGLVKAPFMAVVIALVGCRSGLSVTGSAESVGAMTTRSVVRSIFLVIILD 375

Query: 362 SLFAIFYFAIGI 373
           +LFA+F+ A+GI
Sbjct: 376 ALFAMFFTAVGI 387


>gi|229587675|ref|YP_002869794.1| putative ABC transporter permease [Pseudomonas fluorescens SBW25]
 gi|229359541|emb|CAY46382.1| putative ABC transport system, permease [Pseudomonas fluorescens
           SBW25]
          Length = 382

 Score =  271 bits (694), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 120/365 (32%), Positives = 194/365 (53%), Gaps = 5/365 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +         +      A +DL+ +  +DT GA L++  +     +
Sbjct: 21  LRITGDWTLAHYASLKKLSDKLDGQYDAG--ARIDLNGLGALDTAGASLLVELLGPTRIE 78

Query: 69  IKLQGVS-THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
              +    +      +L+   +R       P+++    +   +   IG+ +     DS  
Sbjct: 79  QSAEQTDCSLSAADRALLKTVYRSLNDFCVPEKAPEEAAGIQVLARIGRAVDTVWQDSKQ 138

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +GL++           +++  L  ++  +  VG+   P+V L++F+ GAV+A  GA
Sbjct: 139 LLGFIGLILETFARGIFRPRRWR--LTPMVAHLEQVGLDAAPIVALLTFLVGAVVAFLGA 196

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L  FGA IF++DL++   LRE GVLLTA++IAGR+ SA  A+IGSMK NEEIDAIRT+
Sbjct: 197 TVLKSFGATIFTVDLVAFSFLREFGVLLTAILIAGRTASAFTAQIGSMKANEEIDAIRTL 256

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD + +L+ PR+ AL+++LP+LT LA  S I+G  +V     DI  A+F S   S   +
Sbjct: 257 GLDPMELLVLPRVLALLVALPMLTFLAMLSGIVGGGVVCAVALDISPAMFLSLLQSDIGV 316

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   GL+KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F
Sbjct: 317 QHFLVGLVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAALF 376

Query: 368 YFAIG 372
           +  +G
Sbjct: 377 FMEMG 381


>gi|86357964|ref|YP_469856.1| ABC transporter permease [Rhizobium etli CFN 42]
 gi|86282066|gb|ABC91129.1| probable ABC transporter, permease protein [Rhizobium etli CFN 42]
          Length = 389

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 149/371 (40%), Positives = 225/371 (60%), Gaps = 5/371 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S+      R +GNW+S  +  +  +      +  ++ +  +DLS +++IDT G  L+   
Sbjct: 23  SDGSGQHVRLSGNWRSAYVHLVLHEFEKL--QREKTGNLTLDLSDVSDIDTAGIWLLCRL 80

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +          +  ++     +  K  +P++    +    +   +GK     
Sbjct: 81  KKQEEAAGRTVRFVGTNPHIDEMLEMFSEEPAK-PEPEQKEKVSLAARILAPLGKMTYDI 139

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +  +ILG  +                  S++ Q+ ++GV  VP+++L+SF+ GA+
Sbjct: 140 WDNLAASMYILGSAVRGAQMKLGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSFLIGAI 197

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 198 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEI 257

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA++V W Y  I FA F +R 
Sbjct: 258 DALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAVVAWGYSGITFANFLARL 317

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D
Sbjct: 318 HEAITLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKAIFVVILMD 377

Query: 362 SLFAIFYFAIG 372
            LFA+FY AI 
Sbjct: 378 GLFAMFYAAID 388


>gi|90425518|ref|YP_533888.1| hypothetical protein RPC_4043 [Rhodopseudomonas palustris BisB18]
 gi|90107532|gb|ABD89569.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB18]
          Length = 378

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 133/373 (35%), Positives = 206/373 (55%), Gaps = 4/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +S     + R  G+W +   + +     +   +  Q+ +  +DL+ + EIDT+GA L+  
Sbjct: 10  ISTGDGLLLRPTGSWTAVHAAALEHLFDVVAPQLRQAKALTIDLAELHEIDTLGAWLLEK 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +         V    E+   LI    +  +  ++P  +   +        IG+    
Sbjct: 70  ISRRAAQAGHPASVVGAAERYAGLIDQVRQ--VNRRQPANAVRGSLILTRLEDIGRATWG 127

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D  +   + G + +            +  L SL+ Q+Y VG   +P++ LI+F+ GA
Sbjct: 128 AREDLFAFLQMTGALANALLGVLRRPRSLR--LTSLVYQIYRVGWQAIPIIGLITFLIGA 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGAE + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 186 IIAQQGIFHFRKFGAESYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ TM LD V +LI PR+ ALII+LP+L  L   +A+ G  +V W Y  +   +F +R
Sbjct: 246 IDALSTMDLDPVEVLILPRVIALIIALPILAFLGAMAALYGGGLVAWFYGGMSPTIFIAR 305

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            H   ++ +   G+IKAPFMA  IGIVA  EG  V   + SLG++ T  VV+SI  VI++
Sbjct: 306 LHEAVSITHFEVGIIKAPFMALVIGIVACSEGLRVMGSAESLGRQTTASVVKSIFCVIVL 365

Query: 361 DSLFAIFYFAIGI 373
           D LFA+F+ +IG+
Sbjct: 366 DGLFAVFFASIGM 378


>gi|254512708|ref|ZP_05124774.1| ABC transporter, inner membrane subunit [Rhodobacteraceae bacterium
           KLH11]
 gi|221532707|gb|EEE35702.1| ABC transporter, inner membrane subunit [Rhodobacteraceae bacterium
           KLH11]
          Length = 374

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 126/368 (34%), Positives = 197/368 (53%), Gaps = 7/368 (1%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G+ ++ E+ ++  D            + ++D+S +  +DT GA LI   + + 
Sbjct: 14  GVHIRITGDLRTQELDDVEADFGKL---RPSGQNVVLDMSQLQSLDTGGAWLIADLVRRL 70

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                            SLI    +     Q                 IG++      D+
Sbjct: 71  GSDSSQVQFEGAKPAHASLIETVSKNIP--QAVGDQAPARGVVVWVSRIGERTFGAWEDT 128

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            S    LGL +          ++ +    +L+ QM  VG   +P+V L+ F+ G V+A Q
Sbjct: 129 LSIMGFLGLTLHRLVRTLIMPWRLRR--AALVSQMEQVGFKALPIVALMGFLIGVVLAFQ 186

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA QL QFGAEIF ++L+SI  LRE+G+LLTA+++AGRSGSA  A IGSMK+ EEIDA+R
Sbjct: 187 GATQLKQFGAEIFVVELISISILRELGILLTAIIVAGRSGSAFTASIGSMKVQEEIDAMR 246

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ AL+I LP+L  +A+ + +IG +++ W    +   +F +R     
Sbjct: 247 TLGLDPIEVLVIPRVLALLIMLPILGFIADMAGLIGGALMSWIDLGVSPGMFLTRLKENT 306

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +A +  G+IKAPF A  IG++A  +   V   S S+G++ T  VVQSI +VI ID+LF+
Sbjct: 307 GVAQLAVGMIKAPFFALVIGVIACWQAMQVKGSSESVGQRTTASVVQSIFMVIAIDALFS 366

Query: 366 IFYFAIGI 373
           IF+  +G+
Sbjct: 367 IFFSELGV 374


>gi|115523490|ref|YP_780401.1| hypothetical protein RPE_1471 [Rhodopseudomonas palustris BisA53]
 gi|115517437|gb|ABJ05421.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisA53]
          Length = 377

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 126/373 (33%), Positives = 197/373 (52%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +++        AG W +P    +   VV A   S      ++D+S ++ +DT GA LI  
Sbjct: 10  IAKGNALALCAAGPWTAPYAPALERIVVEAEALSSDGAKVLIDVSDVSRLDTFGAWLIER 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    R +  +            +     IG+ +V 
Sbjct: 70  LRRSLAQGGIEAQIAGLSANYSSLVDEVRRVEADDAPRSTKMR---LRAPLEEIGRNVVG 126

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F +   S   + G V ++          F+  L S +  +  V    VP+V+LI+F+ G 
Sbjct: 127 FGDTMVSLVAMSGAVTASVFRLIRHPLSFR--LTSTVHHLEQVCWRAVPIVVLITFLIGC 184

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++AQQG F   +FGA++F +D++ +L LRE+GVLL A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 185 IVAQQGIFHFRKFGADVFVVDMLGVLVLRELGVLLVAIMVAGRSGSAYTAELGSMKMREE 244

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +L+ PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R
Sbjct: 245 IDALRTMGFDPIDVLVMPRLIALVLAVPILTFLGVVAALYGGGLVAWVYGGVEPDAFLLR 304

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IG+VA  EG AV   + SLG+  T  VV+ I  VI++
Sbjct: 305 LREAISIDHFTVGMIKAPVMALVIGVVACVEGLAVQGSAESLGQHTTASVVKGIFFVIVM 364

Query: 361 DSLFAIFYFAIGI 373
           D +FAI +  IG+
Sbjct: 365 DGVFAIMFATIGM 377


>gi|299132338|ref|ZP_07025533.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
 gi|298592475|gb|EFI52675.1| protein of unknown function DUF140 [Afipia sp. 1NLS2]
          Length = 377

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 139/370 (37%), Positives = 215/370 (58%), Gaps = 5/370 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +G      AG+W + ++S +   V  AI+    +    +D+SA+ +IDTIGA L+   + 
Sbjct: 13  DGSAQLYAAGSWTASQVSSLEPVVNAAIHNVSGARVLQLDMSAVDQIDTIGAWLLERMIR 72

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           + H            E+   LI       +    P      N+     Y IG+  V  + 
Sbjct: 73  RVHQAGSEIRTVGIHERFAGLIDELRSVNLH---PPVHERQNAVLLKLYQIGQSTVASLQ 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +      +LG + S          + +  L S I Q++ VG   VP++++I+F+ GA+IA
Sbjct: 130 ELLVFLEMLGRLGSVLARLAFKPSRLR--LTSTIYQLHKVGWQAVPIMVMITFLIGAIIA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG F   +FGA+ + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEIDA
Sbjct: 188 QQGIFHFRKFGADAYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEIDA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + TMGLD + +L+ PR+ AL+I+LP+L  + + +A+ G  ++ W Y  +  A+F +R H 
Sbjct: 248 LTTMGLDPLEVLVLPRVLALVIALPILAFIGSIAALYGGGLISWLYGGMSPAIFIARLHE 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             ++ +   GLIKAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D L
Sbjct: 308 AVSVTHFEVGLIKAPFMALVIGIVASSEGLRVKGSAESLGRQTTTSVVKSIFLVIVLDGL 367

Query: 364 FAIFYFAIGI 373
           FA+F+ +IG+
Sbjct: 368 FAVFFASIGM 377


>gi|149374946|ref|ZP_01892719.1| putative permease of ABC transporter [Marinobacter algicola DG893]
 gi|149360835|gb|EDM49286.1| putative permease of ABC transporter [Marinobacter algicola DG893]
          Length = 374

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 116/364 (31%), Positives = 195/364 (53%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G+W  P    +  DV  A+ K +      V+L+ I  +DT GA L++  +  +   
Sbjct: 14  LTVSGDWTLPNYGSLKRDVQNAVLKEVPDGH-SVNLATINALDTAGASLLVDLLGAHELH 72

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +       +   L+         + + +++F  N        IG+ I  F +     
Sbjct: 73  ELTEQTPELSSERQELLRLVANAMA-SPEGEKAFCSNPITEFLAGIGENIEDFWHQQRLL 131

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
               G +++      A+ ++++    SL+  ++  G++ +P+V L++F+ GAV+A  GA 
Sbjct: 132 IGFTGQILATLASILATPWRWRI--TSLVAHVHQTGLNALPIVALLTFLVGAVVAFLGAT 189

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGA I++++L++   LRE GVLL A+++AGR+ SA  A++GSMK NEEIDA+RT G
Sbjct: 190 ILDDFGATIYTVNLVAFSFLREFGVLLAAILLAGRTASAFTAQLGSMKANEEIDALRTFG 249

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L  V +L+ PR+ A++ISLP+LT +   S IIG S+V     DI      +   +   + 
Sbjct: 250 LSPVELLVIPRVLAMVISLPILTFVGMISGIIGGSVVCVLALDISVPQILNILETKVKVV 309

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL KAP  A  I ++   EGF     + S+G+  T+ VVQSI +VI++DS+ AIF+
Sbjct: 310 HLLVGLGKAPVFAFVIAVIGCLEGFKASGSAQSVGEHTTSAVVQSIFMVILLDSIAAIFF 369

Query: 369 FAIG 372
             +G
Sbjct: 370 MEMG 373


>gi|114320361|ref|YP_742044.1| hypothetical protein Mlg_1205 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226755|gb|ABI56554.1| protein of unknown function DUF140 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 377

 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 187/366 (51%), Gaps = 8/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + + +G+W    ++ +A   +  +    ++    +D SA+  +D  GA  +    E+   
Sbjct: 20  LIQCSGDWTRTGLTRLAGQDLRTL-PPPRTGGWTLDASAMGRLDLTGARQLHRLQERLRE 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +     +     +    +     + +  ++                +G++ V  +    +
Sbjct: 79  RGDSVRLGEERPEHMDGLLAFTERAVSERR-----PPPPPPGPLERLGRQTVIRLGHFWA 133

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +G +           +  +     L  ++   GV  +P++ L++F+TG VIA QG 
Sbjct: 134 FLAFIGEIALEALPRLLRPWTIR--WKQLSAEIQKAGVQALPIIGLLAFLTGLVIAYQGG 191

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L ++GA IF ++L+S+  LRE+  +LTA+++AGR+GS+  A++G+MKI EEIDA+RT+
Sbjct: 192 DTLERYGANIFLVELVSVTMLREMAPMLTAIVVAGRTGSSWAAQLGTMKITEEIDALRTL 251

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+    +LI PR+ AL++ LPLLTI A+   I+G  +V    + +    F +R       
Sbjct: 252 GISPFDMLILPRLMALMVVLPLLTIYADVLGILGGMLVADLMFGVAMHDFINRLPEAIAT 311

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           ++++ GL+KAP  A  I  +A  +G  V   + S+G+  T  VVQ+I +VI+ D++F+I 
Sbjct: 312 SHLWVGLVKAPVFALIIVGIACFQGMRVKGSAESVGRATTITVVQAIFLVIVTDAVFSIL 371

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 372 FNLVGL 377


>gi|146342154|ref|YP_001207202.1| putative ABC transporter permease [Bradyrhizobium sp. ORS278]
 gi|146194960|emb|CAL78985.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           ORS278]
          Length = 378

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 133/372 (35%), Positives = 207/372 (55%), Gaps = 4/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +   +   R +G+W S  ++++      A  K   +    +DL +++EIDT+GA LI   
Sbjct: 11  ATEEVLELRASGSWVSRNVTQLESLTGSACAKLGHAGIVRLDLGSVSEIDTVGAWLIEKL 70

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +     +   ++        L+    +   +   P  +   N        +G+  +  
Sbjct: 71  SRRAGVGGRRVEMTGVAASYSGLVDEVRQVNRREIAP--APRPNPIVARLTDLGRSTMGA 128

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D      +L  +              +    SL+ QMY +G   +P+V+LI+F+ GA+
Sbjct: 129 AKDVTIFLDMLAALSFALVRTLRRPRSLRV--TSLVYQMYRIGWQAIPIVVLITFLIGAI 186

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGAE + +D++ IL LRE+GVL+ A+M+AGRSGSA  AEIGSMK+ EEI
Sbjct: 187 IAQQGIFHFRRFGAESYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAEIGSMKMREEI 246

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD V +LI PRI ALI++LP+L  + + +A+ G  +V   Y  +   +F +R 
Sbjct: 247 DALVTMGLDPVEVLILPRIVALILTLPILAFIGSMAALYGGGLVAQLYGGMGPPIFIARL 306

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   ++ +   G++KAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D
Sbjct: 307 HEAISVTHFEVGMLKAPFMALVIGIVACSEGLRVKGSAESLGQQTTTSVVKSIFLVIVLD 366

Query: 362 SLFAIFYFAIGI 373
            LFAIF+ +IG+
Sbjct: 367 GLFAIFFASIGM 378


>gi|91975833|ref|YP_568492.1| hypothetical protein RPD_1353 [Rhodopseudomonas palustris BisB5]
 gi|91682289|gb|ABE38591.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB5]
          Length = 378

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 135/373 (36%), Positives = 202/373 (54%), Gaps = 4/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +++  +      G W + + + +         +   + S  +D++ + EIDTIGA L+  
Sbjct: 10  VTDGDVLELHPGGAWIASQSAALERLFEGVAPQVAAAKSLKIDMTEVIEIDTIGAWLLEK 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +     +        E+   LI    +       P+     N        +G+    
Sbjct: 70  ASREAAQAGRTAHFVGVGERYAGLIEEVRQVNRHRPTPK--PKVNPIIARLDQVGRSAWS 127

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D      + G +              +  L SL  Q+Y VG   +P+V+LI+F+ GA
Sbjct: 128 ATQDIAVFLDMFGALGVALLGVLRRPRSLR--LTSLTYQIYRVGWRAIPIVVLITFLIGA 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 186 IIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ TMGLD V +LI PRI AL+I+LP+LT + + SA+ G  +  W Y  +  AV+ +R
Sbjct: 246 IDALSTMGLDPVEVLILPRIIALVIALPILTFIGSMSALYGGLLTAWFYGGMQPAVYIAR 305

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            H   +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI++
Sbjct: 306 LHEAVSLNSFEVGIWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVL 365

Query: 361 DSLFAIFYFAIGI 373
           D LFA+F+ +IG+
Sbjct: 366 DGLFAVFFASIGL 378


>gi|110633893|ref|YP_674101.1| hypothetical protein Meso_1540 [Mesorhizobium sp. BNC1]
 gi|110284877|gb|ABG62936.1| protein of unknown function DUF140 [Chelativorans sp. BNC1]
          Length = 395

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 159/370 (42%), Positives = 217/370 (58%), Gaps = 3/370 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ENG  V R +GNW +  +S + DD +  +         I+DL  +  +DT GA L+    
Sbjct: 28  ENGALVCRLSGNWTTRTVS-LVDDPMRRLRARKGLTHFIIDLGDVGHLDTAGAWLVSRLA 86

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                      +S   E    L++       +   P+     N   N+   +G+ I    
Sbjct: 87  AAQKENGAQVEISGQSEAASILLAAIEPTAQEPDVPKDGRRGNLIVNILAAMGRTIYDIK 146

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +D     HILG  IS         +       ++  Q+  +GV  +P+++L+S V GA+I
Sbjct: 147 DDVLYGMHILGATISGAQMKLGRGHAVNP--AAIANQIDRMGVGSIPIIVLMSAVVGAII 204

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEI+ +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 205 AQQGAFQLRWFGAEIYVVDLVGILILRELGVLLTAIMIAGRSGSAITAEIGSMKMREEVD 264

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++++P LTI+ANFSA+ GA +V W Y DI  A F  R H
Sbjct: 265 ALTVIGLNPVGVLVFPRLVALVVAVPCLTIVANFSALGGAILVAWLYSDIMPATFIQRLH 324

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L +IF GLIKAPFMA  IGI+A  EG  VG  + SLGK VT  VV++I +VI+ID 
Sbjct: 325 DAIDLTSIFAGLIKAPFMALIIGIIASVEGMKVGGSAESLGKHVTASVVKTIFLVIVIDG 384

Query: 363 LFAIFYFAIG 372
           LFA+FY AI 
Sbjct: 385 LFAMFYAAID 394


>gi|294624127|ref|ZP_06702865.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294663966|ref|ZP_06729386.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292601572|gb|EFF45571.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292606261|gb|EFF49492.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 370

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 118/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQVRLAGSWVLATALPQAE-----LLQAVPEGVRRIDARGIQQLDSAGVLQLLRFAGR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRVGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ AL+ +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALVFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|21244295|ref|NP_643877.1| ABC transporter permease [Xanthomonas axonopodis pv. citri str.
           306]
 gi|21109945|gb|AAM38413.1| ABC transporter permease [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 370

 Score =  269 bits (688), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 119/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQVRLAGSWVLATALPQAE-----LLQAVPDGVRRIDARGIQQLDSAGVLQLLRFAGR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRVGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|148257023|ref|YP_001241608.1| putative ABC transporter permease [Bradyrhizobium sp. BTAi1]
 gi|146409196|gb|ABQ37702.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           BTAi1]
          Length = 378

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 135/372 (36%), Positives = 210/372 (56%), Gaps = 4/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +   +   R +G+W S  ++E+ +    A  K   + +  +DL A++EIDT+G  L+   
Sbjct: 11  ATGELLELRPSGSWVSLNVTELENLTRSASGKVGNAKAVKLDLGAVSEIDTVGVWLLEKL 70

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                   +L  ++   E    L+    +   ++  P      N        +G+  +  
Sbjct: 71  SRSAAAGGRLVEMTGVAENYVGLVEEVRQVNRRDIAP--PPRQNPIVAKLTDLGRSTLGA 128

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D      +L  +        A     +    SL+ QMY +G   +P+V+LI+F+ GA+
Sbjct: 129 ARDVTVFLDMLAALSLALVRTLARPRSLRV--TSLVYQMYRIGWQAIPIVVLITFLIGAI 186

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGAE + +D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ EEI
Sbjct: 187 IAQQGIFHFRRFGAESYVVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMREEI 246

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD V +LI PRI ALI++LP+L  + + +A+ G  +V   Y  +  A+F +R 
Sbjct: 247 DALVTMGLDPVEVLILPRIVALILTLPILAFIGSMAALYGGGLVAQLYGGMGPAIFIARL 306

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   ++ +   G+ KAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI++D
Sbjct: 307 HDAVSVTHFEVGMWKAPFMALVIGIVACSEGLRVKGSAESLGQQTTTSVVKSIFLVIVLD 366

Query: 362 SLFAIFYFAIGI 373
            LFA+F+ +IG+
Sbjct: 367 GLFAVFFASIGL 378


>gi|325928564|ref|ZP_08189752.1| putative integral membrane protein [Xanthomonas perforans 91-118]
 gi|325541103|gb|EGD12657.1| putative integral membrane protein [Xanthomonas perforans 91-118]
          Length = 370

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 119/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQVRLAGSWVLATALPQAE-----LLQAVPDGVRRIDARGIQQLDSAGVLQLLRFAGR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRVGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|312958198|ref|ZP_07772721.1| ABC transport system permease protein [Pseudomonas fluorescens WH6]
 gi|311287629|gb|EFQ66187.1| ABC transport system permease protein [Pseudomonas fluorescens WH6]
          Length = 382

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 119/366 (32%), Positives = 193/366 (52%), Gaps = 5/366 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
            + R  G+W     + +         +      A +DL+ +  +DT GA L++  +    
Sbjct: 19  ALLRITGDWTLAHYANLKKLADKLDGQYDAG--ARIDLNGLGALDTAGASLLVELLGPTR 76

Query: 67  GKIKLQGVS-THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
            +   +    T      +L+   +R       P+++    +   L   IG+ +     DS
Sbjct: 77  IEQSAEQTDCTLSAADRALLKTVYRSLNDFCVPEKAPEETAGMQLLARIGRAVDTVWQDS 136

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +GL++           +++     ++  +  VG+   P+V L++F+ GAV+A  
Sbjct: 137 KQLLGFIGLILETFARGIFRPKRWRI--TPMVAHLEQVGLDAAPIVALLTFLVGAVVAFL 194

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA  L  FGA IF++DL++   LRE GVLLTA++IAGR+ SA  A+IGSMK NEEIDAIR
Sbjct: 195 GATVLKSFGATIFTVDLVAFSFLREFGVLLTAILIAGRTASAFTAQIGSMKANEEIDAIR 254

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ AL+++LP+LT LA  S I+G  +V     DI  A+F S   S  
Sbjct: 255 TLGLDPMELLVLPRVLALLVALPMLTFLAMLSGIVGGGVVCAVALDISPAMFLSLLQSDI 314

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   G++KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A
Sbjct: 315 GVQHFLVGMVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAA 374

Query: 366 IFYFAI 371
           +F+  +
Sbjct: 375 LFFMEM 380


>gi|166713439|ref|ZP_02244646.1| ABC transporter permease [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 370

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 119/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQLRLAGSWVLATALPQAE-----LLQTVPDGVRRIDARGIQQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRIGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|289662615|ref|ZP_06484196.1| ABC transporter permease [Xanthomonas campestris pv. vasculorum
           NCPPB702]
 gi|289668440|ref|ZP_06489515.1| ABC transporter permease [Xanthomonas campestris pv. musacearum
           NCPPB4381]
          Length = 370

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 119/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQLRLAGSWVLATALPQAE-----LLQTVPDGVRRIDARGIQQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRVGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVTGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|91976115|ref|YP_568774.1| hypothetical protein RPD_1636 [Rhodopseudomonas palustris BisB5]
 gi|91682571|gb|ABE38873.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB5]
          Length = 383

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 128/373 (34%), Positives = 196/373 (52%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++         AG+W +     +   V  A   +    +  +D+S +  +DT GA LI  
Sbjct: 16  IARGEGLALCAAGSWTARFAPSLERIVADAEKLTGTRPNIFIDVSEVARLDTFGAWLIER 75

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    + +             + +     +G+ +  
Sbjct: 76  LRRNLTQDGVEARIAGLSANYASLVDEVRQVQPDVPAVASG---GALRAPIEKLGRTMYV 132

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F +D  +   +LG V++           F+  L S +  +  V    VP+V+LI+F+ G 
Sbjct: 133 FADDIVALISMLGAVLAGVMRAILHPTTFR--LTSTVHHLEQVCWRAVPIVVLITFLIGC 190

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGA++F +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 191 IIAQQGIFHFRRFGADVFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREE 250

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +LI PR+ AL++++P+LT L   SA+ G  +V W Y  +    F  R
Sbjct: 251 IDALRTMGFDPIDVLIVPRLIALLLAMPILTFLGAMSALYGGGLVAWLYGGVDPEAFLLR 310

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IGIVA  EG AV   + SLG   T  VV+ I  VI++
Sbjct: 311 LRDAISINHFTVGMIKAPVMALVIGIVACVEGLAVKGSAESLGSHTTASVVKGIFFVIVM 370

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+ +IGI
Sbjct: 371 DGVFAIFFASIGI 383


>gi|158423837|ref|YP_001525129.1| hypothetical protein AZC_2213 [Azorhizobium caulinodans ORS 571]
 gi|158330726|dbj|BAF88211.1| protein of unknown function [Azorhizobium caulinodans ORS 571]
          Length = 408

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 134/372 (36%), Positives = 203/372 (54%), Gaps = 7/372 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +E         G W S     +   V+   +   ++ +  +DLS +  +DT GA L+   
Sbjct: 44  AEGDHIKVEGQGAWTSEYADSLEQAVMQVASHYGEAKAVEIDLSRLDRMDTFGALLLERL 103

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              +  K     +         LI    R   +               +   IG+++V  
Sbjct: 104 RRVWQEKGVEPQIVGLNPAYSVLIEEMTRTGREP-----PPPERKPPGVFERIGREMVVI 158

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D+ S  + +G V++  G        F+    S++ QM  VG   +P++ILI+F+ G +
Sbjct: 159 TEDAVSLLNFVGAVVAAFGRVLTRPRSFR--FTSMVNQMDRVGFRAMPIIILITFLIGCI 216

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQG F   +FGA+I+ +D++ +L LRE+GVL+ ++MIAGRSGSA  AE+GSM++ EE+
Sbjct: 217 IAQQGIFNFRRFGADIYVVDMVGVLVLRELGVLIVSIMIAGRSGSAYTAELGSMRMREEV 276

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R MG D V +L+ PR+ ALII LPLLT + + +A+IG  +V W Y  I   VF +R 
Sbjct: 277 DALRVMGFDPVEVLVVPRLLALIICLPLLTFVGSMAAMIGGGLVAWFYGGIAPDVFINRL 336

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
               TLA    G+IKAPFMA  IG+V   EG  VG  + SLG+  T  VV++I +VI++D
Sbjct: 337 KDAITLAQFEVGMIKAPFMAAIIGVVGCMEGLRVGGSAESLGQHTTASVVKAIFLVIVVD 396

Query: 362 SLFAIFYFAIGI 373
            LFAIF+ +I +
Sbjct: 397 GLFAIFFASIDM 408


>gi|84622391|ref|YP_449763.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188578633|ref|YP_001915562.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|84366331|dbj|BAE67489.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|188523085|gb|ACD61030.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 370

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 119/368 (32%), Positives = 191/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQLRLAGSWVLATALPQAE-----LLQTVPDGVRRIDARGIQQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+   +   D
Sbjct: 70  IGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRATHRIGQD 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHET 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|170724242|ref|YP_001751930.1| hypothetical protein PputW619_5085 [Pseudomonas putida W619]
 gi|169762245|gb|ACA75561.1| protein of unknown function DUF140 [Pseudomonas putida W619]
          Length = 377

 Score =  268 bits (686), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 120/364 (32%), Positives = 190/364 (52%), Gaps = 7/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R AG+W     + +  D      ++     A+ DLS + ++DT GA L+   +      
Sbjct: 20  LRIAGDWTLAHYASLKRDSERL--RTQYDADAVADLSQLGQLDTAGASLLAELLGSERLS 77

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              Q +      L       +        P +    +    L   IG+ +     D+   
Sbjct: 78  HCTQELPDASRALL---KNVYCSVQDYCIPVKEPERHVLILLLERIGRAVNTLWQDTLQL 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL++          ++++  L  ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 135 LGFIGLILETLLRRALQPHRWR--LTPVVSHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA +F++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 193 VLADFGATVFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S   + 
Sbjct: 253 LNPIELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALSLDISPAMFLSLLQSDIGVQ 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F 
Sbjct: 313 HFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAALFC 372

Query: 369 FAIG 372
             +G
Sbjct: 373 MEMG 376


>gi|237808113|ref|YP_002892553.1| hypothetical protein Tola_1352 [Tolumonas auensis DSM 9187]
 gi|237500374|gb|ACQ92967.1| protein of unknown function DUF140 [Tolumonas auensis DSM 9187]
          Length = 381

 Score =  268 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 110/369 (29%), Positives = 197/369 (53%), Gaps = 4/369 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E+G  + R +G+W       +   +     + I     + D   +  +DT GA L++  +
Sbjct: 15  ESGHVLLRISGDWTLTHYVMLKRQITSVQEQMIADTPILWD--DLGSLDTAGAALLVELL 72

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    +     S    +  +L+        ++   ++    ++   +  HIG+ ++   
Sbjct: 73  GQVRLSLLTTQDSGLSAERLALLHSVAAALKESTNIEKQPKESAISEMLAHIGQVVIHLG 132

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
               +    +GL I           +++    SL   +   G++ +P++ L++F+ GAV+
Sbjct: 133 QQQIALLGFIGLTIETLVRSLIHPRRWRI--TSLAAHIEQTGLNAIPIIALLTFLVGAVV 190

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  G   LS FGA I+++DL++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEEID
Sbjct: 191 AFLGTTVLSDFGASIYTVDLVAFAFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEID 250

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           AIR +GL+ + +L+ PR+ A++ISLP+LT +A    +IG ++V +   DI   +F +   
Sbjct: 251 AIRALGLNPIELLVLPRVLAMLISLPILTFIAMACGMIGGAVVCFLELDITPRLFLTILQ 310

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +++ F G+ KAP  A  + ++   EGF VG  + S+G+   + VVQSI +VI++D+
Sbjct: 311 RDIDISHFFVGIGKAPLFAFIVAVIGCLEGFKVGGSAQSVGEHTISSVVQSIFMVILLDA 370

Query: 363 LFAIFYFAI 371
           L A+F+  +
Sbjct: 371 LAALFFMEM 379


>gi|148555653|ref|YP_001263235.1| hypothetical protein Swit_2742 [Sphingomonas wittichii RW1]
 gi|148500843|gb|ABQ69097.1| protein of unknown function DUF140 [Sphingomonas wittichii RW1]
          Length = 365

 Score =  268 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 116/365 (31%), Positives = 187/365 (51%), Gaps = 14/365 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V  F G      I +++  +              +DL  +  IDT+GA L+     ++  
Sbjct: 13  VLHFTGALTLARIGDLSRRLEALDEVPR-----TIDLGEVDRIDTVGAWLVHRIAREH-- 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
            +++ G    + QL   I+   +         R      F  +   IG       +    
Sbjct: 66  DVEIVGADADVCQLIEQIAEADK-----PLKIRPDSSPPFFRVLREIGDATSAAAHSLAG 120

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
                G  +           +F+    ++ RQ   VGV  + ++ L+SF+ G VIAQQGA
Sbjct: 121 LIGFFGATLIGLWGLVTHPRRFRYN--AMARQFEVVGVKALAIIGLMSFLIGIVIAQQGA 178

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL QFGAE+F+++L+  + LRE+GVL+TA+M+AGRSGSA  A++GSMK+ EE+DA+RT+
Sbjct: 179 VQLRQFGAEVFAVNLIGRITLRELGVLMTAIMVAGRSGSAFAAQLGSMKLAEEVDAMRTI 238

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+  +  LI PR+ + ++ +PLL   A   AIIG  I  W   DIP   +  R      +
Sbjct: 239 GVSPMEALILPRVLSTVVLMPLLGFYAAVIAIIGGGIFCWIDLDIPPITYVQRIREVVPM 298

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+I +VI++D++FA+F
Sbjct: 299 TDLWVGLIKAPVFGMLIALCGCYQGMQVEGNAEEVGLRTTASVVQAIFLVIVLDAVFAVF 358

Query: 368 YFAIG 372
           + +IG
Sbjct: 359 FSSIG 363


>gi|325915744|ref|ZP_08178046.1| hypothetical integral membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
 gi|325538008|gb|EGD09702.1| hypothetical integral membrane protein [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 370

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 117/368 (31%), Positives = 189/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R +G+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DQAQVRLSGSWVLATALPQAE-----LLQAVPDGVRRIDARGIGQLDSAGVLQLLRFAGR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+        
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRTTHGVGQG 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIMRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|323136828|ref|ZP_08071909.1| protein of unknown function DUF140 [Methylocystis sp. ATCC 49242]
 gi|322398145|gb|EFY00666.1| protein of unknown function DUF140 [Methylocystis sp. ATCC 49242]
          Length = 380

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 130/369 (35%), Positives = 205/369 (55%), Gaps = 5/369 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           NG      +G+W       +       +++  +     +DLS + ++DT GA LI     
Sbjct: 16  NGGERLALSGDWILIASRRLEQKAQQLVDEGGRVKFVTIDLSGVEKLDTAGAWLINRARH 75

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +         ++    +  +++     ++ +    +    +N+  +L   +G  +V  + 
Sbjct: 76  ELAHADVGVALAHARPEHHTMLEEAAFREFEKPPRR---RFNAIVDLLADLGASVVDALR 132

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +       LG  I+           F+    SL+  M  +G    P+++LI+ + GA++A
Sbjct: 133 EFYRGVAFLGEFIAAMAYVATHPGHFR--FTSLVFHMETIGFRSAPIIVLINLLVGAIVA 190

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG FQL +FGA  +++ L+ IL LRE+GVLLT++MIAGRSGSAI AEIGSMK+ EEIDA
Sbjct: 191 QQGIFQLLKFGASSYTVSLIGILVLRELGVLLTSIMIAGRSGSAITAEIGSMKMREEIDA 250

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MGL  + +LI+PR+ ALI+SLP+LT +A+ +A+ G  +V W Y  I  A F S    
Sbjct: 251 LRVMGLSPIEVLIAPRVLALIVSLPILTFIADMAALFGGLLVSWSYGGISPAAFLSLLKE 310

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              L     G+IKAPFMA  IG++A  +G      + SLG++VT+ VV+SI +VI++D L
Sbjct: 311 AIALHTFLVGMIKAPFMALVIGLIAAMDGLETKGSAESLGRQVTSSVVKSIFMVIVLDGL 370

Query: 364 FAIFYFAIG 372
           FAIF+ +I 
Sbjct: 371 FAIFFASID 379


>gi|209549578|ref|YP_002281495.1| hypothetical protein Rleg2_1984 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535334|gb|ACI55269.1| protein of unknown function DUF140 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 383

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 154/371 (41%), Positives = 222/371 (59%), Gaps = 5/371 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S       R  GNW+S  +  +  D    +++  ++    VDLS IT+IDT G  L+   
Sbjct: 17  SGGSGQHVRLKGNWRSAYVHFVLRDFEKLLHQ--KAGDLTVDLSDITDIDTAGIWLLCRL 74

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +          +  ++     +  K  +P+     +    +   IG+     
Sbjct: 75  KKEEEAAGRTVRFEGTNPHIDEMLEMFSEEPAK-PEPELKEKVSLAARILAPIGRMTYDI 133

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +  +ILG  +                  S++ Q+ ++GV  VP+++L+SF+ GA+
Sbjct: 134 WDNFAAAMYILGSAVRGAQMKFGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSFLIGAI 191

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 192 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEI 251

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA+ V W Y  I FA F SR 
Sbjct: 252 DALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAAVAWGYSGITFANFLSRL 311

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D
Sbjct: 312 HEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTAAVVKAIFVVILMD 371

Query: 362 SLFAIFYFAIG 372
            LFA+FY AI 
Sbjct: 372 GLFAMFYAAID 382


>gi|241204915|ref|YP_002976011.1| hypothetical protein Rleg_2195 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240858805|gb|ACS56472.1| protein of unknown function DUF140 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 394

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 156/371 (42%), Positives = 225/371 (60%), Gaps = 5/371 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++      R  GNW+S  I  +  D    + K  ++    VDLS I+EIDT G  L+   
Sbjct: 28  ADGSGQRVRLQGNWRSAYIHLVLRDFEKLLQK--KTGDLTVDLSDISEIDTAGIWLLCRL 85

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +          +  ++     +  K + P+++   +    +   IGK   + 
Sbjct: 86  KKQEEAGGRTVRFEGTNSHIDEMLEMVSEEPAKVE-PEQTEKVSLAARIFAPIGKMTYEV 144

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +  +ILG  +                  S++ Q+ ++GV  VP+++L+SF+ GA+
Sbjct: 145 WDNFAAAMYILGSAVRGAQMKFGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSFLIGAI 202

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 203 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEI 262

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA+ V W Y  I FA F SR 
Sbjct: 263 DALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLGGAAAVAWGYSGITFANFLSRL 322

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D
Sbjct: 323 HEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTAAVVKAIFVVILMD 382

Query: 362 SLFAIFYFAIG 372
            LFA+FY AI 
Sbjct: 383 GLFAMFYAAID 393


>gi|167031179|ref|YP_001666410.1| hypothetical protein PputGB1_0158 [Pseudomonas putida GB-1]
 gi|166857667|gb|ABY96074.1| protein of unknown function DUF140 [Pseudomonas putida GB-1]
          Length = 377

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 118/364 (32%), Positives = 188/364 (51%), Gaps = 7/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +      ++  +   + DLS +  +DT GA L+   +      
Sbjct: 20  LRITGDWTLAHYANLKRESEQL--RTQYAADTVADLSQLGRLDTAGASLLAELLGSERLS 77

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              Q +      L       +        P +    N    L   IG+ +     DS   
Sbjct: 78  RCTQDLPEASRALL---KNVYCSVQDYCIPVKEPERNVLLMLLERIGRAVGTLWQDSMQL 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 135 LGFVGVILETLLRRALQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 193 VLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ + +L+ PR+ AL+ISLPLLT +A    +IG ++V     DI  A+F S   S   + 
Sbjct: 253 LNPMELLVVPRVLALLISLPLLTFVAMICGMIGGAVVCALTLDISPAMFLSLLQSDIGVQ 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F+
Sbjct: 313 HFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFF 372

Query: 369 FAIG 372
             +G
Sbjct: 373 MEMG 376


>gi|206575650|ref|YP_002235755.1| putative ABC transporter, permease protein [Klebsiella pneumoniae
           342]
 gi|206570494|gb|ACI12140.1| putative ABC transporter, permease protein [Klebsiella pneumoniae
           342]
          Length = 382

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 113/364 (31%), Positives = 187/364 (51%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G+W     + +   V     + +   +AI DLS +  +DT GA L++  M +    
Sbjct: 22  ISASGDWVLAHYAYLEPAVSALQPQLLS--NAIFDLSQLGTLDTAGATLLVKLMGEKKVL 79

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +   T   +   L+            P           L  +IGK +  F  +  + 
Sbjct: 80  ELERIAPTLPIERRVLLQTVRSAIQNYVTPPAQHQPGIVTELLANIGKSVESFWQNLVAL 139

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +            ++    SL+  +  +G++ VP++ L++F+ GAVIA  G+ 
Sbjct: 140 IGFIGLTMEALFATLLRPAHWRV--TSLVANLQQIGLNAVPIIALLTFMVGAVIAFLGST 197

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            LS FGA IF++ L++   LRE  VLL A+++AGR+ SA  A+IG MK NEEIDAI+TMG
Sbjct: 198 VLSTFGASIFTVQLVAFSFLREFAVLLAAILMAGRTASAFTAQIGLMKANEEIDAIQTMG 257

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+++LP++T +     I+G  +V     DI   +F +   +     
Sbjct: 258 LNPVELLVLPRVLALLVALPMMTFIGMICGILGGIVVCALTLDISPTMFLTIMQNNVGFE 317

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           + + G+IKAP  A  I I+   EGF V   + S+G+  T  VV SI +VI++D++ A+F+
Sbjct: 318 HFWVGMIKAPVFAFLIAIIGCLEGFKVSGSAESVGEHTTASVVHSIFVVILLDAVAALFF 377

Query: 369 FAIG 372
             +G
Sbjct: 378 MEMG 381


>gi|26986887|ref|NP_742312.1| hypothetical protein PP_0142 [Pseudomonas putida KT2440]
 gi|24981490|gb|AAN65776.1|AE016203_9 ABC transporter, permease protein, putative [Pseudomonas putida
           KT2440]
          Length = 377

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 118/364 (32%), Positives = 187/364 (51%), Gaps = 7/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +      +S      + DLS +  +DT GA L+   +      
Sbjct: 20  LRITGDWTLAHYANLKRESERL--RSHCPADTVADLSQLGRLDTAGASLLAELLGSERLS 77

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +    + L       +        P +    N    L   IG+ +     DS   
Sbjct: 78  HCTHALPEASQALL---KNVYCSVQDYCIPVKEPERNVLLLLLERIGRAVGTLWQDSMQL 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 135 LGFVGVILETLLRRAFQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 193 VLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S   + 
Sbjct: 253 LNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAMFLSLLQSDIGVQ 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F+
Sbjct: 313 HFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFF 372

Query: 369 FAIG 372
             +G
Sbjct: 373 MEMG 376


>gi|87200858|ref|YP_498115.1| hypothetical protein Saro_2845 [Novosphingobium aromaticivorans DSM
           12444]
 gi|87136539|gb|ABD27281.1| protein of unknown function DUF140 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 372

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 117/370 (31%), Positives = 192/370 (51%), Gaps = 13/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +       F+G      +      +     + I    A +DLSA+T +DT+GA  +    
Sbjct: 14  QGAGATLAFSGPMTVSSLGLTDQRL-----RHITDPVARIDLSAVTAMDTVGAWTVWRLS 68

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  ++   S   ++L   IS         + P        F+ +   +G  ++   
Sbjct: 69  RDTGA--EIVACSEEAQKLVDAISKADSNAHSIEPP----RLPLFQRVPEKVGDAMIGLG 122

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             +      LG VI   G       +F+    +L+ QM  VGV+ + ++ L+SF+ G VI
Sbjct: 123 LGAVQVLGFLGQVILAIGTLVRHPSRFRM--KALVHQMELVGVNALAIIGLMSFLVGIVI 180

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA QL QFGAEI++++L+  L LRE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+D
Sbjct: 181 AQQGAVQLRQFGAEIYTVNLVGRLTLRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVD 240

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PRI A ++ +PLL   + F  IIG + +      IPF  F +R  
Sbjct: 241 AMRTIGVSPMEALVVPRILATMVMMPLLGFYSAFIGIIGGAFLSSLTLGIPFFTFLARIQ 300

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L +++ G+ KAP     + +    +G  V  ++  +G + T  VV +I +VI++D+
Sbjct: 301 EVVPLHDVWVGITKAPVFGLIVAVAGCYQGMQVKTNAEEVGTRTTAAVVMAIFMVIVLDA 360

Query: 363 LFAIFYFAIG 372
            FA+F+  IG
Sbjct: 361 FFAVFFTEIG 370


>gi|188993114|ref|YP_001905124.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. B100]
 gi|167734874|emb|CAP53086.1| ABC transporter permease [Xanthomonas campestris pv. campestris]
          Length = 370

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 119/364 (32%), Positives = 190/364 (52%), Gaps = 13/364 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +   K
Sbjct: 19  VRLAGSWVLATALPQAE-----LLQAVPDGVRRIDARGIGQLDSAGVLQLLRFASRMGLK 73

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                     + L   I   + ++ K +          F      +G+            
Sbjct: 74  EDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRTTHGVGQGILEL 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG  +   G       +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  G+ 
Sbjct: 128 NSFLGENLVKIGRLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFLGST 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIRT+G
Sbjct: 186 ILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIRTLG 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T  L 
Sbjct: 246 LDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTIQLR 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A+++
Sbjct: 306 HFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAALWF 365

Query: 369 FAIG 372
             +G
Sbjct: 366 MKMG 369


>gi|241661797|ref|YP_002980157.1| hypothetical protein Rpic12D_0175 [Ralstonia pickettii 12D]
 gi|240863824|gb|ACS61485.1| protein of unknown function DUF140 [Ralstonia pickettii 12D]
          Length = 374

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 97/371 (26%), Positives = 180/371 (48%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++   ++    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAFLSGDWTTLALAERAGVRSARQQIRAGLDNANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +         ++   ++                      N    +G+ ++ F 
Sbjct: 75  GNQWP--EHLDARPDQRRMLDRVAKLD-------PGGWKQRLAPRMNPVAILGEGMLDFF 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           + + +   ++G ++ + G F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 DHASNGIAMVGQLVFDLGRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|187927276|ref|YP_001897763.1| hypothetical protein Rpic_0168 [Ralstonia pickettii 12J]
 gi|309780024|ref|ZP_07674777.1| competence protein ComM [Ralstonia sp. 5_7_47FAA]
 gi|187724166|gb|ACD25331.1| protein of unknown function DUF140 [Ralstonia pickettii 12J]
 gi|308921194|gb|EFP66838.1| competence protein ComM [Ralstonia sp. 5_7_47FAA]
          Length = 374

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 97/371 (26%), Positives = 180/371 (48%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++   ++    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAFLSGDWTTLALAERAGVRSARQQIRAGLDNANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +         ++   ++                      N    +G+ ++ F 
Sbjct: 75  GNQWP--EHLDARPDQRRMLDRVAKLD-------PGGWKQRLAPRMNPVAILGEGMLDFF 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           + + +   ++G ++ + G F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 DHAGNGIAMVGQLVFDLGRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|77456265|ref|YP_345770.1| hypothetical protein Pfl01_0037 [Pseudomonas fluorescens Pf0-1]
 gi|77380268|gb|ABA71781.1| putative ABC transport system, permease [Pseudomonas fluorescens
           Pf0-1]
          Length = 382

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 118/367 (32%), Positives = 194/367 (52%), Gaps = 5/367 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G+W     +E+   +   +N    +++  +DL+ +  +DT GA L++  +    
Sbjct: 19  ARLRVTGDWTLAHYAEL-KQLSETLNGQYDANTP-IDLNGLGALDTAGASLLVELLGSER 76

Query: 67  GKIKLQGVSTHIEQL-FSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                +     I     +L+   +R       P +    +    L   IG+ +     D+
Sbjct: 77  LGKSAEHPDCTISSADRALLQTVYRSLTDFCVPIKEPEISVSVQLLTRIGRAVDTVWQDT 136

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +GL++           +++     +I  +   G+   P+V L++F+ GAV+A  
Sbjct: 137 LQLLGFVGLILETIARSLFRPKRWRI--TPMIAHIEQTGLDAAPIVALLTFLVGAVVAFL 194

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA  L+ FGA +F++DL+    LRE GVLLTA+++AGR+ SA  A+IGSMK NEEIDAIR
Sbjct: 195 GATVLASFGASVFTVDLVGFAFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEIDAIR 254

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD + +L+ PR+ AL+++LP+LT LA    I+G ++V     DI  A+F S   S  
Sbjct: 255 TLGLDPMELLVVPRVLALLVALPMLTFLAMICGIVGGAVVCAVSLDISPAMFLSLLQSDI 314

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GL+KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A
Sbjct: 315 GIQHFLVGLVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAA 374

Query: 366 IFYFAIG 372
           +F+  +G
Sbjct: 375 LFFMEMG 381


>gi|307945713|ref|ZP_07661049.1| ABC transporter permease protein [Roseibium sp. TrichSKD4]
 gi|307771586|gb|EFO30811.1| ABC transporter permease protein [Roseibium sp. TrichSKD4]
          Length = 382

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 133/366 (36%), Positives = 208/366 (56%), Gaps = 6/366 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V   +G+W    ++E    V   +          +D SAI  +DT GA L+         
Sbjct: 23  VLCLSGDWTISSLAEAERLVESIMLDKY--RVTCLDTSAIDNLDTSGAWLVHRLRGSLEY 80

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           + +   +    E  F+L     R      KP++S    S        GK++V    D+ +
Sbjct: 81  QGRRVELIGLTENRFNLFCQIERHHPPEYKPEKSKV--SLVGFLEATGKQVVNVGRDAIA 138

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
             HILG +            + +G   ++  Q     +  VP+V L+SF+ GA+I+QQG 
Sbjct: 139 MLHILGSLGVVLSTVLLQPKRLRGI--AVAVQFDRTCIGAVPIVALMSFLIGAIISQQGG 196

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           F L QFGA+I+ +DL  IL LREIGV+LTA+M+AGRSGSA  AE+G+M++ EE+DA+  +
Sbjct: 197 FYLRQFGADIYVVDLAGILVLREIGVILTAIMVAGRSGSAFTAELGAMRMQEEVDALHVI 256

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL    +L+ PRI AL+I+LP+LT +A+ +A++GA +  W Y DIP A + ++  +  T+
Sbjct: 257 GLSVTEVLVLPRILALMIALPVLTFIADMAALVGAGLTTWVYLDIPPAAYLTQLQAAITM 316

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
             ++ G++KAPFMA  IG++A  EG  VG  + SLG+  T  VV++I +VI++D +FAIF
Sbjct: 317 KTLWVGIVKAPFMALIIGLIACVEGLKVGGSAESLGRHTTMSVVKAIFLVIVVDGVFAIF 376

Query: 368 YFAIGI 373
           + +I +
Sbjct: 377 FASINV 382


>gi|116252407|ref|YP_768245.1| transmembrane component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115257055|emb|CAK08149.1| putative transmembrane component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 389

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 156/371 (42%), Positives = 225/371 (60%), Gaps = 5/371 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++      R  GNW+S  I  +  D    + K  ++    VDLS I+EIDT G  L+   
Sbjct: 23  ADGSGQRVRLQGNWRSAYIHLVLRDFEKLLQK--KTGDLSVDLSDISEIDTAGIWLLCRL 80

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +          +  ++     +  K + P+++   +    +   IGK   + 
Sbjct: 81  KKQEEAGGRTVRFEGTNSHIDEMLEMFSEEPAKVE-PEQTEKVSLAARIFAPIGKMTYEV 139

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +  +ILG  +                  S++ Q+ ++GV  VP+++L+SF+ GA+
Sbjct: 140 WDNFAAAMYILGSAVRGAQMKFGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSFLIGAI 197

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 198 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEI 257

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA+ V W Y  I FA F SR 
Sbjct: 258 DALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLGGAAAVAWGYSGITFANFLSRL 317

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D
Sbjct: 318 HEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTAAVVKAIFVVILMD 377

Query: 362 SLFAIFYFAIG 372
            LFA+FY AI 
Sbjct: 378 GLFAMFYAAID 388


>gi|90422963|ref|YP_531333.1| hypothetical protein RPC_1452 [Rhodopseudomonas palustris BisB18]
 gi|90104977|gb|ABD87014.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           BisB18]
          Length = 377

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 128/373 (34%), Positives = 199/373 (53%), Gaps = 5/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++         AG+W +P    +   V  A   S    +  +D+SA+ ++DT GA LI  
Sbjct: 10  IARGNGLALCAAGSWTAPFAPVLERIVAEAEALSGTRPNISIDVSAVAKLDTFGAWLIER 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        ++       SL+    R K      +      S +     +G+ +  
Sbjct: 70  LRRSLTQGDAEATIAGLSANYSSLVDEVRRVKDPEPSKRGGI---SLRAPVERLGRSVAG 126

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F++       + G V++           F+  L S +  +  V    VP+V+LI+F+ G 
Sbjct: 127 FLDTIVGLVAMTGAVMAGMLRVVMHPGSFR--LTSTVHHLEQVCWRAVPIVMLITFLIGC 184

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++AQQG F   +FGA++F +D++ +L LRE+GVLL A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 185 IVAQQGIFHFRKFGADVFVVDMLGVLVLRELGVLLVAIMVAGRSGSAYTAELGSMKMREE 244

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D + +LI PR+ AL++++P+LT L   +A+ G  +V W Y  +    F  R
Sbjct: 245 IDALRTMGFDPIDVLIMPRMMALVLAMPILTFLGVVAALYGGGLVAWLYGGVDPDAFLLR 304

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                ++ +   G+IKAP MA  IGIVA  EG AV   + SLG+  T  VV+ I  VI++
Sbjct: 305 LRDAISIDHFTVGMIKAPVMAIVIGIVACVEGLAVAGSAESLGRHTTASVVKGIFFVIVM 364

Query: 361 DSLFAIFYFAIGI 373
           D +FAIF+ +IG+
Sbjct: 365 DGVFAIFFASIGM 377


>gi|27381176|ref|NP_772705.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
 gi|27354343|dbj|BAC51330.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
          Length = 378

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 131/374 (35%), Positives = 205/374 (54%), Gaps = 10/374 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
                  R  G+W +  ++ +            +S +  +D+S ++ +DT+GA ++    
Sbjct: 12  SGDGLKLRPQGSWTAANVAMLETLSRSVGADVDRSRAVTLDMSGVSALDTLGAWVLEKLS 71

Query: 63  EKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
            +        +  GV+ H   L   +   +R                       +GK  V
Sbjct: 72  RRAATSGRSAEFVGVADHFSGLMDEVREVNRHTPAPAAAPNPLLLR-----LGDLGKSTV 126

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
               D      +LG +              +  L SL+ Q+Y +G   +P+V LI+F+ G
Sbjct: 127 GAREDITIFLQMLGALFMAIFGVLRRPRSLR--LTSLVYQLYRIGWQAIPIVALITFLIG 184

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           A+IAQQG F   +FGAE +++D++ IL LRE+GVL+ A+M+AGRSGSA  AE+GSMK+ E
Sbjct: 185 AIIAQQGFFHFRRFGAESYTVDMVGILVLRELGVLIVAIMVAGRSGSAYTAELGSMKMRE 244

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+ TMGLD V +LI PR+ AL+I+LP+L  + + +A+ G  +V   Y D+  A++ +
Sbjct: 245 EIDALSTMGLDPVGVLILPRVAALVIALPILAFIGSIAALYGGGLVAQFYGDMGPAIYIA 304

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R H   ++ +   G++KAPFMA  IGIVA  EG  V   + SLG++ TT VV+SI +VI+
Sbjct: 305 RLHEAISVTHFEVGILKAPFMALVIGIVACSEGLRVKGSAESLGRQTTTSVVKSIFLVIV 364

Query: 360 IDSLFAIFYFAIGI 373
           +D LFAIF+ +IG+
Sbjct: 365 LDGLFAIFFASIGM 378


>gi|21230110|ref|NP_636027.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66769899|ref|YP_244661.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. 8004]
 gi|21111638|gb|AAM39951.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66575231|gb|AAY50641.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 370

 Score =  266 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 118/364 (32%), Positives = 189/364 (51%), Gaps = 13/364 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +   K
Sbjct: 19  VRLAGSWVLATALPQAE-----LLQAVPDGVRRIDARGIGQLDSAGVLQLLRFASRMGLK 73

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                     + L   I   + ++ K +          F      +G+            
Sbjct: 74  EDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRTTHGVGQGILEL 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA  G+ 
Sbjct: 128 NSFLGENLVKIARLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAFLGST 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAIRT+G
Sbjct: 186 ILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAIRTLG 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T  L 
Sbjct: 246 LDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDTIQLR 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ A+++
Sbjct: 306 HFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIAALWF 365

Query: 369 FAIG 372
             +G
Sbjct: 366 MKMG 369


>gi|120609009|ref|YP_968687.1| hypothetical protein Aave_0306 [Acidovorax citrulli AAC00-1]
 gi|120587473|gb|ABM30913.1| protein of unknown function DUF140 [Acidovorax citrulli AAC00-1]
          Length = 375

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 90/370 (24%), Positives = 172/370 (46%), Gaps = 12/370 (3%)

Query: 6   ITVFRFAGNWKSPEIS--EIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
             V    G W + ++       +V   + ++        DL ++  +D +GA+L+     
Sbjct: 16  GPVAALHGRWGAADLGARRTWREVSAQLAQNAPDSGLGWDLRSVDWLDHVGAQLLWNHWG 75

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +     +   +      +   ++           P               +G K++  + 
Sbjct: 76  RVWP--ERIALDDAQRDMLDRVAEFTVIDRPPVPPW------RLVEEVDRLGVKVLHALG 127

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  ++G ++ + G    +  +       +   +Y +G + +P+  ++ F+ G V+A
Sbjct: 128 HGRHLLELVGQLVIDLGSALRAPRRAP--WRDVSGHLYRMGATALPITAIVGFLIGVVLA 185

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              + QL QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 186 YLMSLQLRQFGAESFIVNILGISLIRELGPMLAAILVAGRSGSAITAQIGVMRVTEELDA 245

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     L+ PR  AL I++PL+ +     A+ G  +      D+  A F     +
Sbjct: 246 MRVMGIPHGFRLVMPRAVALAIAMPLIAVWTTLCALAGGMLAADIAMDVSPAYFVQALPN 305

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
               +N+   + K+      I ++    G  V  ++ SLG+  T  VV +I++VII+D+L
Sbjct: 306 AVGFSNLVLAMAKSVVFGVGIALIGCHWGLRVKPNTQSLGEGTTASVVNAITMVIIVDAL 365

Query: 364 FAIFYFAIGI 373
           FAI +  +GI
Sbjct: 366 FAIAFKNLGI 375


>gi|261855956|ref|YP_003263239.1| hypothetical protein Hneap_1358 [Halothiobacillus neapolitanus c2]
 gi|261836425|gb|ACX96192.1| protein of unknown function DUF140 [Halothiobacillus neapolitanus
           c2]
          Length = 413

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 101/368 (27%), Positives = 193/368 (52%), Gaps = 8/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDL-SAITEIDTIGAELIMYFMEK 64
           +TV   +G W    +  +     ++   + ++D   + L S ++  D  GA ++  ++  
Sbjct: 52  VTVLVLSGTWTIHSLQHVPTLDTLSGAPTKKADKPCIVLRSEMSAFDGAGALVLARWIRT 111

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           +        +     +  SL+     + +  +             +   IG+  V+  ++
Sbjct: 112 WRADGFEVDLGEFPPRETSLLQLLDDRLVDTEPAPVKKPK-----MIARIGQFTVEQWHE 166

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           + S    LG ++        + ++ +    ++I ++   GV  + +V L+SF+ G V+A 
Sbjct: 167 TRSFLAFLGELVWRGAPLLLTFWRIR--WRAVISEIDAAGVRALGIVGLLSFMIGMVMAY 224

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QG   L  +GA +  +DL+ I+ LRE+G LL A+++AGR+GS+  A++G+M+I EEIDA+
Sbjct: 225 QGGATLQNYGANVLIVDLVGIITLREMGPLLAAIIVAGRTGSSYTAQLGTMRITEEIDAL 284

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R +G+    ILI P++ ALII+LPLL+I ++   ++G ++V    + + F+V+F R    
Sbjct: 285 RAIGVPPFEILIFPKVLALIITLPLLSIFSDLMGLLGGAVVANYGFGVSFSVYFDRMPEA 344

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +L  ++ GL+K P  A  I ++   +G  V   +  +G   T  VVQ+I +VI+ID+LF
Sbjct: 345 VSLTTLWLGLLKTPVFAIVIALIGCMQGLRVRGSAAEVGHATTVSVVQAIFMVIVIDALF 404

Query: 365 AIFYFAIG 372
           ++ Y  +G
Sbjct: 405 SVLYNVMG 412


>gi|319956950|ref|YP_004168213.1| hypothetical protein Nitsa_1211 [Nitratifractor salsuginis DSM
           16511]
 gi|319419354|gb|ADV46464.1| protein of unknown function DUF140 [Nitratifractor salsuginis DSM
           16511]
          Length = 371

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 106/369 (28%), Positives = 175/369 (47%), Gaps = 16/369 (4%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---ME 63
           T+    G+W   +   I  ++        ++    +D   +   D+ G  L++     M+
Sbjct: 15  TLIECQGDWTLDQARLIEKELRRL--PLPETPRCRIDFGKVQRFDSAGILLLLELRERMK 72

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K     ++ G+    E++  LI   + ++               + L + IGK  V+ + 
Sbjct: 73  KAGKACEITGLDEKKEKMLHLIERGYGEE---------PLPKRREGLLWRIGKATVEELK 123

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                 H LG +  +          F+      +  + + GV+ + ++ L SF+ G VIA
Sbjct: 124 VVRDFFHFLGELSVSFLRLLFKPSNFRM--RETVYHIQHSGVNALFIIGLTSFLVGLVIA 181

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            +   QL QFGA+I+ +D + I   RE+G ++TA++IAGRS S+  AEIG+MKI EEI A
Sbjct: 182 YESLVQLVQFGADIYVVDGIGIAITRELGPMITAIVIAGRSASSYAAEIGTMKITEEIAA 241

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++T+G D    L+ PRI A++I+LPLL   ++   I+G  I      D+ F  F  R   
Sbjct: 242 MQTLGFDPFYFLVIPRIVAMMIALPLLIFFSDVIGILGGMIATKVQVDLSFTFFIERLQE 301

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                +   G++K PF A  I       GF V   + S+G + T  VV +I  VI  D+L
Sbjct: 302 VLAAKHYILGIVKGPFFALIIAATGCFHGFRVTGDTESIGIETTASVVHAIFFVIACDAL 361

Query: 364 FAIFYFAIG 372
           FA+ Y  +G
Sbjct: 362 FAVIYTQLG 370


>gi|118588764|ref|ZP_01546172.1| hypothetical protein SIAM614_18699 [Stappia aggregata IAM 12614]
 gi|118438750|gb|EAV45383.1| hypothetical protein SIAM614_18699 [Stappia aggregata IAM 12614]
          Length = 382

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 132/365 (36%), Positives = 205/365 (56%), Gaps = 6/365 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G+W    I++   ++        +     +D+S I  +DT GA LI     +   +
Sbjct: 24  LALSGDWTVSTIADAERELNGLTLD--KKRLTCIDVSRIEHLDTSGAWLIHRTRGRLEFE 81

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            +  G+S       +L          + KP    F  S        G+++V   +D+ + 
Sbjct: 82  GRKVGLSGVSPVRKTLFEEIENHHPPSWKPDPGGF--SIAGFLEATGRQMVDVYHDALAM 139

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
            HILG +            + +    S+  Q     +  VP+V L+SF+ GA+I+QQG F
Sbjct: 140 LHILGSLGLVLSTVLLQPKRLRSI--SIAVQFDRSCIGAVPIVALMSFLIGAIISQQGGF 197

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L QFGA+IF +DL  IL LREIGV+LTA+M+AGRSGSA  AE+G+M++ EE+DA+  +G
Sbjct: 198 YLRQFGADIFVVDLAGILVLREIGVILTAIMVAGRSGSAFTAELGAMRMQEEVDALHVIG 257

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L    +L+ PRI AL+I+LP+LT +++ +A+ G+ +V W Y DIP A F ++  +  T+ 
Sbjct: 258 LSVTEVLVLPRILALMIALPILTFISDLAALFGSGMVTWAYLDIPPAAFLTQLQAAITIN 317

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
            +  GL+KAPFMA  +G++A  EG  V   S SLG+  T  VV++I +VI++D  FAIF+
Sbjct: 318 TLVVGLVKAPFMALIVGLIACVEGLKVEGSSESLGRHTTMSVVKAIFLVIVVDGFFAIFF 377

Query: 369 FAIGI 373
            AIG+
Sbjct: 378 AAIGV 382


>gi|85707661|ref|ZP_01038727.1| ABC-type transport system permease component [Erythrobacter sp.
           NAP1]
 gi|85689195|gb|EAQ29198.1| ABC-type transport system permease component [Erythrobacter sp.
           NAP1]
          Length = 370

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 115/370 (31%), Positives = 190/370 (51%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E G T+   +G      I ++  ++          +   VDLS + E+DT+GA ++  F 
Sbjct: 13  EGGGTMLALSGPLLVSTIGKLERELSRL-----GHEVGRVDLSDVEEMDTVGAWVVCRF- 66

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
              H    + G +   ++L   +         +           ++ +   +G+K+    
Sbjct: 67  -ATHQSAAITGTTPSAKRLLEAVEAA-----SSDVEITPDRTPVWERVPLALGEKVYAAR 120

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +         G ++   G        F   L + +RQM  VGV+ +P++ L+SF+ G VI
Sbjct: 121 SGVYGVVGFFGQILIGFGSLLRHPSTFP--LKATVRQMEMVGVAALPIIGLMSFLIGIVI 178

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA QL+QFGAE  +++L+  + LRE+GVL+TA+M+AGRSGSA  A+IG+MK+ EE+D
Sbjct: 179 AQQGAVQLAQFGAETLTVNLVGRITLRELGVLMTAIMVAGRSGSAFAAQIGTMKLTEEVD 238

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PRI A    + +L   A+   I+G ++V      IPF  F  R  
Sbjct: 239 AMRTIGISPIERLVIPRILACTFMMVVLGFYASIVGIVGGAVVGHLSLGIPFFTFLERIQ 298

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L +++ GL+KAP     + +     G  V  +S  +G + T  VV +I  VI++D+
Sbjct: 299 EVVPLHDVWVGLVKAPVFGLIVALAGCYHGMQVKGNSEQVGIRTTMAVVSAIFAVIVLDA 358

Query: 363 LFAIFYFAIG 372
            FA+F+  IG
Sbjct: 359 FFAVFFTEIG 368


>gi|222086200|ref|YP_002544732.1| ABC transporter [Agrobacterium radiobacter K84]
 gi|221723648|gb|ACM26804.1| ABC transporter [Agrobacterium radiobacter K84]
          Length = 386

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 151/370 (40%), Positives = 223/370 (60%), Gaps = 4/370 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +     +R  GNW+S  +  +   +     +S      ++DLS ++++DT GA LI    
Sbjct: 20  DGNGHRYRLEGNWRSANVHGVLRRIDELTTRS-AGGRVVIDLSDLSDVDTAGALLIRRLK 78

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           E          +      +  L+     +    +KP+     +  + +   IG+ + +  
Sbjct: 79  ESQEAHGASVSIEGSNSHIDELL-TAFTEDPDAEKPEPRQKKSWTERIFAPIGETVYEVW 137

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            +  +  +ILG  +                  S++ Q+ ++GV  VP+++L+S++ GA+I
Sbjct: 138 GNLVAAMYILGSAVRGAQLKFGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSYLIGAII 195

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 196 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVD 255

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MGL+ + +LI PR+ AL ++LPLLTILANF+++ GA+ V W Y  I FA F +R H
Sbjct: 256 ALKVMGLNPIGVLIFPRLVALTVALPLLTILANFASLFGAATVTWAYSGITFATFIARLH 315

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              +L+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV+SI +VI++D 
Sbjct: 316 EAISLSTVISGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKSIFVVILMDG 375

Query: 363 LFAIFYFAIG 372
           LFA+FY AI 
Sbjct: 376 LFAMFYAAID 385


>gi|218886600|ref|YP_002435921.1| hypothetical protein DvMF_1505 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218757554|gb|ACL08453.1| protein of unknown function DUF140 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 430

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 121/374 (32%), Positives = 200/374 (53%), Gaps = 11/374 (2%)

Query: 7   TVFRFAGNWKSPEISEIADDVVM-------AINKSIQSDSAIVDLSAITEIDTIGAELIM 59
            V  F+G W    I  +   ++        A +    +    +DL+ +T +DT GA+L+ 
Sbjct: 61  LVLTFSGVWDVASIGRMTARLLRRCAEVGNACSVQGDAPVVHLDLAEVTRLDTAGAQLLC 120

Query: 60  YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
                         V  H+      +     + I      R+   +        IG  IV
Sbjct: 121 RAA--ASMATAGARVVWHVSDHGQSMLLDRVRAIDISAVPRARRISPVVGALNAIGGSIV 178

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           + +  + +    LG+ + +     A  ++ +   +S++  M   G+  VP+V L++F+ G
Sbjct: 179 EELEQARAIIGFLGMFLVSLAAAVARPWRLR--WVSIVHHMEQTGIQAVPIVALLTFLIG 236

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V A  G+ Q ++FGA++F ++L+ +  LRE+GVLLTA+++AGRSGS+  A+IG+M  NE
Sbjct: 237 LVTAYMGSEQFTRFGAQVFVVNLIEVSTLRELGVLLTALIVAGRSGSSFTAQIGAMVANE 296

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+R+MGLD + +L+ PR+ AL++ LP+LT +A+F  ++G  I  W    I    F  
Sbjct: 297 EVDAMRSMGLDPMEVLVIPRVVALVLMLPVLTFIADFMGVLGGGIASWLSLGISPGAFAV 356

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           RF     LAN  TGL+KAPF A  IGIV   +GF V   + S+G+  T  VV+SI +VI+
Sbjct: 357 RFQEITRLANFVTGLVKAPFFALIIGIVGCFQGFRVTGSAESVGRLTTQAVVESIFLVIV 416

Query: 360 IDSLFAIFYFAIGI 373
            ++ FAI + ++G+
Sbjct: 417 ANAGFAILFMSLGV 430


>gi|326315184|ref|YP_004232856.1| hypothetical protein Acav_0366 [Acidovorax avenae subsp. avenae
           ATCC 19860]
 gi|323372020|gb|ADX44289.1| protein of unknown function DUF140 [Acidovorax avenae subsp. avenae
           ATCC 19860]
          Length = 375

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 89/370 (24%), Positives = 173/370 (46%), Gaps = 12/370 (3%)

Query: 6   ITVFRFAGNWKSPEIS--EIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
             V    G W + E+        +   + K+  +     DL  +  +D +GA+L+     
Sbjct: 16  GPVAALLGRWGAAELGTRPAWKALSAQLAKTPPAAGLGWDLRGVEWLDHVGAQLLWNHWG 75

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +   +      +        ++       +  + P+  +           +G K++  + 
Sbjct: 76  REWPERLSVDGAQ-----RDMLERVAEYTVTRRPPESPWR---LAEEVDRLGVKVLSALG 127

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  ++G ++ +      +  +       +   +Y +G + +P+  ++ F+ G V+A
Sbjct: 128 HGRHLLELVGQLMIDLVRVVRAPRRAP--WRDISGHLYRMGATALPITAIVGFLIGVVLA 185

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              + QL QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 186 YLMSLQLRQFGAESFIVNILGISLIRELGPMLAAILVAGRSGSAITAQIGVMRVTEELDA 245

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     L+ PR  AL I++PL+ +     A+ G  +      ++  A F     +
Sbjct: 246 MRVMGIPHGFRLVMPRAVALAIAMPLIAVWTTLCALAGGMLAADIAMNVSPAYFVQALPN 305

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
               +N+   + K+      I ++    G  V  ++ SLG+  T  VV +I++VII+D+L
Sbjct: 306 AVGFSNLVLAMGKSVVFGVGIALIGCHWGLRVKPNTQSLGEGTTASVVNAITMVIIVDAL 365

Query: 364 FAIFYFAIGI 373
           FAI +  +GI
Sbjct: 366 FAIAFKNLGI 375


>gi|86748498|ref|YP_484994.1| hypothetical protein RPB_1373 [Rhodopseudomonas palustris HaA2]
 gi|86571526|gb|ABD06083.1| Protein of unknown function DUF140 [Rhodopseudomonas palustris
           HaA2]
          Length = 378

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 135/373 (36%), Positives = 204/373 (54%), Gaps = 4/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +++  +      G W +   + +        ++   + +  +D++ + EIDTIGA L+  
Sbjct: 10  VTQGDVLRLHPGGAWIAMHTAVLERLFDGVASQVAAAKALEIDMTDVVEIDTIGAWLLEK 69

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                    +        ++   LI    +   +  KP+     N        IG+    
Sbjct: 70  VSRDAAQAGRTAQFVGVADRYAGLIEEVRQVNRRGPKPR--PSVNPIIARLDQIGRSAWS 127

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D      +LG +              +  L SL  Q+Y VG   +P+V+LI+F+ GA
Sbjct: 128 ATQDISVFLAMLGALGVALLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIVVLITFLIGA 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 186 IIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ TMGLD V +LI PRI AL+I+LP+LT + + +A+ G  +  W Y  +  AV+ +R
Sbjct: 246 IDALTTMGLDPVEVLILPRIIALVIALPILTFIGSMAALYGGLLTAWFYGGMQPAVYIAR 305

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            H   +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI++
Sbjct: 306 LHEAVSLNSFEVGIWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVL 365

Query: 361 DSLFAIFYFAIGI 373
           D LFA+F+ +IG+
Sbjct: 366 DGLFAVFFASIGM 378


>gi|146341950|ref|YP_001206998.1| putative ABC transporter permease [Bradyrhizobium sp. ORS278]
 gi|146194756|emb|CAL78781.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           ORS278]
          Length = 377

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 135/371 (36%), Positives = 202/371 (54%), Gaps = 5/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E      R  G W +P    +   V  A   + +S +  +D+S ++++DT GA LI    
Sbjct: 12  EGNALALRATGAWTAPFAPALERLVADAEKLAGKSGNVSIDVSQVSKLDTFGAWLIERLR 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +        +        SL+    R  +    P       +   +   IG+ +   +
Sbjct: 72  RSFTTGTVEARIDGLSANYASLVDEVRRVSL---APGDDATNVTITGMLGQIGRSVAGIV 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
               +   +LG VI  +G        F+  L S I  +  V    VP+++LI+F+ G +I
Sbjct: 129 GTVAALIDMLGAVIVASGRVLVHPRSFR--LTSTIHHLEQVCWRAVPIIVLITFLIGCII 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGA+IF +D++ +L LREIGVLL A+MIAGRSGSA  AE+GSMK+ EEID
Sbjct: 187 AQQGIFHFRRFGADIFVVDMLGVLVLREIGVLLVAIMIAGRSGSAYTAELGSMKMREEID 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMG D + +LI PR+ AL+I+LP+L+ L + +A+ G  +V W Y  +    F  R  
Sbjct: 247 ALRTMGFDPIEVLILPRMLALVIALPILSFLGDIAALYGGGLVAWFYGGVDPEAFLLRLR 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   GL+KAP MA  IGIVA  EG AV   + SLG+  T+ VV+ I  VI++D 
Sbjct: 307 DAISIDHFTVGLLKAPVMAAVIGIVACVEGLAVEGSAESLGRHTTSSVVKGIFFVIVMDG 366

Query: 363 LFAIFYFAIGI 373
           +FAIF+ A+G+
Sbjct: 367 VFAIFFAAVGM 377


>gi|325982943|ref|YP_004295345.1| hypothetical protein NAL212_2362 [Nitrosomonas sp. AL212]
 gi|325532462|gb|ADZ27183.1| protein of unknown function DUF140 [Nitrosomonas sp. AL212]
          Length = 370

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 85/372 (22%), Positives = 176/372 (47%), Gaps = 11/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +++G       G++    +  +   +   +++  ++ +   DL+ I +IDT G  L+   
Sbjct: 9   TKDGSPHIILTGDYTLATLESLLKPLEDELSREARNQNLYWDLTGIGQIDTAGTILLWRV 68

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            +          +    E++F  +             Q    +         +GK ++  
Sbjct: 69  WKTKRPDRLQ--LRPEHEKMFQRLERLPTH-------QSGIKHRDLLWPITTLGKLVLVL 119

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
              S     ++G ++ +                 +   +Y  G   + +  L+ F+ G V
Sbjct: 120 WQHSVGLITLIGQLMLDVIYLIRHPVYIP--WREISANLYRTGAQALGITALVGFLIGIV 177

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   + QL  FGA+IF I+++ I  +RE+G +L A+++AGRSGSA+ A++G M++ +E+
Sbjct: 178 LSYLSSKQLQLFGADIFIINILGISIIRELGPMLAAILVAGRSGSAMTAQLGVMRVTQEL 237

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MG+   + LI P++  L I++PLL +  +  A++G  +       + +  F +  
Sbjct: 238 DALTVMGISHSQRLILPKVLGLGIAMPLLVMWTSAVALLGGMVAAEIQLGLHYHYFITAL 297

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             +  + N++ GL K       I ++A   G  +  ++ SLG+  T  VV +I++VIIID
Sbjct: 298 PDSVPVGNLWLGLGKGIVCGMVIALIACHFGLKIKPNTESLGEGTTASVVTAITMVIIID 357

Query: 362 SLFAIFYFAIGI 373
           ++FA+ +  +G+
Sbjct: 358 AIFAVLFSDVGL 369


>gi|39937298|ref|NP_949574.1| hypothetical protein RPA4238 [Rhodopseudomonas palustris CGA009]
 gi|39651156|emb|CAE29679.1| putative permease of ABC transporter [Rhodopseudomonas palustris
           CGA009]
          Length = 378

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 136/375 (36%), Positives = 205/375 (54%), Gaps = 10/375 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++      +  G W +     +         +   + S  +D++ I EIDTIGA ++   
Sbjct: 11  ADGDTLELKPKGAWTATNSKFMEQLSQDVAPQIAAAKSLTIDMAEIGEIDTIGAWVLEKL 70

Query: 62  ME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                +     + +G+ST   +L   +   +R+      P      N        IG+  
Sbjct: 71  SRSAAQAGRTAQFKGISTSYAELIDEVRQLNRRG-----PTPHPKPNPIIAKLDEIGRSA 125

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
                D      +LG + +            +  L SL  Q+Y VG   +P+++LI+F+ 
Sbjct: 126 WSATTDMAVFLEMLGALGAALLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIMVLITFLI 183

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ 
Sbjct: 184 GAIIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMR 243

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+ TMGLD V +LI PRI AL+I+LP+L  + + +A+ G  +  W Y  +  +VF 
Sbjct: 244 EEIDALSTMGLDPVEVLILPRIIALVIALPILAFVGSMAALYGGLLTAWFYGGMQPSVFI 303

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +R H   +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI
Sbjct: 304 ARLHEAVSLNSFEVGMWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVI 363

Query: 359 IIDSLFAIFYFAIGI 373
           ++D LFA+F+ +IG+
Sbjct: 364 VLDGLFAVFFASIGM 378


>gi|319783795|ref|YP_004143271.1| hypothetical protein Mesci_4108 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317169683|gb|ADV13221.1| protein of unknown function DUF140 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 395

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 147/369 (39%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E+G+    F+G W +  ++ + D  +  I K     +  +D+S I ++DT GA LI   +
Sbjct: 28  EDGVLGCAFSGIWTTRTVA-LVDADMRKIEKRSGFKTLALDVSKIEKMDTAGAWLIDRLV 86

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +  K     +    E    L+        +  +       N        +G+++ +  
Sbjct: 87  SAFEKKGVEIQMQGQSEIASILLEAVGEAVRREPESGPVRPPNIVIRALEAVGRRVYEMR 146

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +D  +  +ILG  I          +       ++  Q+  +GV  +PVV+L+S + GA++
Sbjct: 147 DDFLASMNILGATIRGAQMKLGRGHAVNP--AAIFNQIDRMGVGAIPVVVLMSAIVGAIV 204

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA+QLS FGA+IF +DL+ +L LRE+GVL+TA+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 205 AQQGAYQLSYFGADIFVVDLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMREEVD 264

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ + +L+ PR+ AL+I+LP LTI+ANF+A+ G  +  W Y DIP A F  R  
Sbjct: 265 ALKVIGLNPIGVLVFPRLVALVIALPCLTIIANFAALGGGILAAWLYSDIPPAAFIDRLR 324

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L+ IF GLIKAPFMA  IG +A  EG  VG  + SLG+ VT  VV+SI +VII+D 
Sbjct: 325 VAIDLSTIFAGLIKAPFMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVIILDG 384

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 385 LFAMFYAAI 393


>gi|148256837|ref|YP_001241422.1| putative ABC transporter permease [Bradyrhizobium sp. BTAi1]
 gi|146409010|gb|ABQ37516.1| putative ABC transporter (permease protein) [Bradyrhizobium sp.
           BTAi1]
          Length = 377

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 133/371 (35%), Positives = 196/371 (52%), Gaps = 5/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E      R  G W +P    +   V  A   + +     +D+S ++ +DT GA LI    
Sbjct: 12  EGSALSLRATGAWTAPFAPSLERLVADAEKLAGKKIDVSIDVSEVSRLDTFGAWLIERLR 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +        +        SL+    R       P       +   +   IG+ +    
Sbjct: 72  RSFTTGTAEARIDGLSANYASLVDEVRRVSA---APDGDATAVTITGMLGQIGRSVAGIF 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
               +   +LG VI  +G        F+  L S I  +  V    VP+++LI+F+ G +I
Sbjct: 129 GTVAALIDMLGAVIVASGRVFIHPRSFR--LTSTIHHLEQVCWRAVPIIVLITFLIGCII 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGA+IF +D++ +L LREIGVLL A+MIAGRSGSA  AE+GSMK+ EEID
Sbjct: 187 AQQGIFHFRRFGADIFVVDMLGVLVLREIGVLLVAIMIAGRSGSAYTAELGSMKMREEID 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMG D + +LI PR+ AL+I+LP+L+ L + +A+ G  +V W Y  +    F  R  
Sbjct: 247 ALRTMGFDPIEVLILPRMLALVIALPILSFLGDIAALYGGGLVAWFYGGVDPEAFLLRLR 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              ++ +   GL+KAP MA  IGIVA  EG AV   + SLG+  T+ VV+ I  VI++D 
Sbjct: 307 EAISIDHFTVGLLKAPVMAAVIGIVACVEGLAVQGSAESLGRHTTSSVVKGIFFVIVMDG 366

Query: 363 LFAIFYFAIGI 373
           +FAIF+  +G+
Sbjct: 367 VFAIFFATVGM 377


>gi|192293078|ref|YP_001993683.1| hypothetical protein Rpal_4717 [Rhodopseudomonas palustris TIE-1]
 gi|192286827|gb|ACF03208.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           TIE-1]
          Length = 382

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 136/375 (36%), Positives = 205/375 (54%), Gaps = 10/375 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++      +  G W +     +         +   + S  +D++ I EIDTIGA ++   
Sbjct: 15  ADGDTLELKPKGAWTATNSKFMEQLSQDVAPQIAAAKSLTIDMAEIGEIDTIGAWVLEKL 74

Query: 62  ME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                +     + +G+ST   +L   +   +R+      P      N        IG+  
Sbjct: 75  SRSAAQAGRTAQFKGISTSYAELIDEVRQLNRRG-----PTPHPKPNPIIAKLDEIGRSA 129

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
                D      +LG + +            +  L SL  Q+Y VG   +P+++LI+F+ 
Sbjct: 130 WSATTDMAVFLEMLGALGAALLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIMVLITFLI 187

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA+IAQQG F   +FGAE + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ 
Sbjct: 188 GAIIAQQGIFHFRKFGAESYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMR 247

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+ TMGLD V +LI PRI AL+I+LP+L  + + +A+ G  +  W Y  +  +VF 
Sbjct: 248 EEIDALSTMGLDPVEVLILPRIIALVIALPILAFVGSMAALYGGLLTAWFYGGMQPSVFI 307

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +R H   +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI
Sbjct: 308 ARLHEAVSLNSFEVGMWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVI 367

Query: 359 IIDSLFAIFYFAIGI 373
           ++D LFA+F+ +IG+
Sbjct: 368 VLDGLFAVFFASIGM 382


>gi|325923308|ref|ZP_08184981.1| conserved hypothetical integral membrane protein [Xanthomonas
           gardneri ATCC 19865]
 gi|325546235|gb|EGD17416.1| conserved hypothetical integral membrane protein [Xanthomonas
           gardneri ATCC 19865]
          Length = 370

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 118/368 (32%), Positives = 189/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R AG+W        A+     + +++      +D   I ++D+ G   ++ F  +
Sbjct: 15  DHAQVRLAGSWVLATALPQAE-----LLQAVPDGIRRIDARGIAQLDSAGVLQLLRFASR 69

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K          + L   I   + ++ K +          F      +G+        
Sbjct: 70  MGLKEDAIDFRDEHQALVCTIEELNDERPKPK------RDYGFVAALDRLGRTTHGVGQG 123

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +           +F+  L S +  M  VG+  VP+V+L+S++ GAVIA 
Sbjct: 124 ILELNSFLGENLVKIARLIHEPRRFR--LTSTVHHMEQVGLDAVPLVVLLSYLVGAVIAF 181

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EE+DAI
Sbjct: 182 LGSTILRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEVDAI 241

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD + +L+ PR+ ALI +LPLLT +A  + + G   V     DIP  ++ +R H T
Sbjct: 242 RTLGLDPIDLLVIPRLLALIFTLPLLTFIAMIAGLAGGVTVGAFDLDIPPQMYLARMHDT 301

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VII+D++ 
Sbjct: 302 IQLRHFLVGLSKAPLFALVIGLIGCLEGLKVSGTAQSVGERTTSSVVQTISLVIILDAIA 361

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 362 ALWFMKMG 369


>gi|316935758|ref|YP_004110740.1| hypothetical protein Rpdx1_4456 [Rhodopseudomonas palustris DX-1]
 gi|315603472|gb|ADU46007.1| protein of unknown function DUF140 [Rhodopseudomonas palustris
           DX-1]
          Length = 382

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 134/371 (36%), Positives = 196/371 (52%), Gaps = 4/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +         G W +     +      A  +   + S  +D++AI EIDTIGA ++    
Sbjct: 16  DGDTLELEPTGAWTATNSKIMEQLSAGAAQQIASAKSLTIDMAAIGEIDTIGAWVLEKLS 75

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                           +    LI    +   +   P      N        IG+      
Sbjct: 76  RSAAEAGSPAQFKGIADSYAELIDEVRQLNRRGPTPH--PKPNPIIAKLDEIGRSAWSAT 133

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D      +LG +              +  L SL  Q+Y VG   +P+++LI+F+ GA+I
Sbjct: 134 ADIAVFLQMLGALGVAVLGVLRRPRSLR--LTSLTYQVYRVGWQAIPIMVLITFLIGAII 191

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGA+ + +D++ IL LREIGVL+ A+M+AGRSGSA  AE+GSMK+ EEID
Sbjct: 192 AQQGIFHFRKFGADSYVVDMVGILVLREIGVLIVAIMVAGRSGSAYTAELGSMKMREEID 251

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ TMGLD V +LI PRI AL+I+LP+L  + + +A+ G  +  W Y  +  +VF +R H
Sbjct: 252 ALSTMGLDPVEVLILPRIIALVIALPILAFIGSMAALYGGLLTAWFYGGMQPSVFIARLH 311

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              +L +   G+ KAPFMA  IGIVA  EG  V   + SLG + TT VV+SI +VI++D 
Sbjct: 312 EAVSLNSFQVGMWKAPFMALVIGIVACSEGLRVKGSAESLGLQTTTSVVKSIFLVIVLDG 371

Query: 363 LFAIFYFAIGI 373
           LFA+F+ +IG+
Sbjct: 372 LFAVFFASIGM 382


>gi|70733612|ref|YP_257252.1| ABC transporter permease [Pseudomonas fluorescens Pf-5]
 gi|68347911|gb|AAY95517.1| ABC transporter, permease protein, putative [Pseudomonas
           fluorescens Pf-5]
          Length = 382

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 122/367 (33%), Positives = 191/367 (52%), Gaps = 5/367 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G+W     S++         +     S  +DL+ +  +DT GA L++  +    
Sbjct: 19  AQLRIGGDWTLAHYSDLKRLSQSLDGRY--DSSTHIDLNGLGALDTAGASLLVELLGAER 76

Query: 67  GKIKLQGVS-THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                +    T      +L+   +        P +    +    L   IG  +     D+
Sbjct: 77  LGQSAEHPDCTLSAADRALLHTVYTSLNDFCVPVKEPEISVSVQLLSRIGSAVYTVWQDT 136

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +GL++           +++     ++  +   G+   P+V L++F+ GAV+A  
Sbjct: 137 LKVLGFIGLILETLARGLLRPKRWRI--TPVVAHIEQTGLDAAPIVALLTFLVGAVVAFL 194

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           GA  L+ FGA IF++DL++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEEIDAIR
Sbjct: 195 GATVLANFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEIDAIR 254

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+GLD V +L+ PR+ AL++SLP+LT LA  S I+G ++V     DI  A+F S  HS  
Sbjct: 255 TLGLDPVELLVLPRVLALLVSLPMLTFLAMLSGIVGGAVVCALSLDISPAMFLSLLHSDI 314

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GL+KAP  A  I  +   EGF V   + S+G   T+ VVQSI +VI+ID++ A
Sbjct: 315 GVKHFLLGLVKAPIFAFLIAAIGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVIDAVAA 374

Query: 366 IFYFAIG 372
           +F+  +G
Sbjct: 375 LFFMEMG 381


>gi|307297001|ref|ZP_07576817.1| protein of unknown function DUF140 [Sphingobium chlorophenolicum
           L-1]
 gi|306877527|gb|EFN08755.1| protein of unknown function DUF140 [Sphingobium chlorophenolicum
           L-1]
          Length = 376

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 114/370 (30%), Positives = 195/370 (52%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G TV R +GN     + ++ + +       I+     +DLS +  +DTIGA ++   +
Sbjct: 19  REGRTVIRLSGNLSIACLHDLPNRLDA-----IEGPVDTIDLSGVDHMDTIGAWVLHRTI 73

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K  + G     E+L + +              R      ++ +   IG+ +V   
Sbjct: 74  KRLDCK--ITGDKCDAERLITTVGSVDE-----PVNIRPDHEPPWQRVVGQIGEAVVNSG 126

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                     G  +  T        +F+    +++++   VGVS + ++ L+SF+ G VI
Sbjct: 127 TTLLGLLGFFGGTLVATWNVIRHPGRFRIN--AVVQRFEVVGVSALGIIGLMSFLIGIVI 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+D
Sbjct: 185 AQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVD 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PR  A+++ +PLL+  A+  AIIG   +     DIP   F  R  
Sbjct: 245 AMRTIGVSPMEALVLPRTLAVVVMMPLLSFYASIVAIIGGGFLCAVSLDIPPITFVQRLR 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+I +VI++D+
Sbjct: 305 EVVPIHDLWVGLIKAPVFGVIIALAGCFQGMQVKANAEEVGLRTTAAVVQAIFLVIVLDA 364

Query: 363 LFAIFYFAIG 372
            FA+F+  +G
Sbjct: 365 FFAVFFTWVG 374


>gi|217969575|ref|YP_002354809.1| hypothetical protein Tmz1t_1154 [Thauera sp. MZ1T]
 gi|217506902|gb|ACK53913.1| protein of unknown function DUF140 [Thauera sp. MZ1T]
          Length = 385

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 113/373 (30%), Positives = 197/373 (52%), Gaps = 5/373 (1%)

Query: 1   MSENGIT-VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           ++ +G+  V R  G+W     + +         +     +  V+L+ +  +DT GA L+ 
Sbjct: 16  LAGDGVAAVLRLRGDWTLAHHAALRRQADAL--RGRIDAATRVELAELGTLDTAGARLLH 73

Query: 60  YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +        L        +  +L+          ++   +    +  ++  HIG  ++
Sbjct: 74  GLLGGERVAALLADEGALSRERRALLKAVADAIEGREERPAADEGYALGDVLAHIGHTML 133

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
            F     +    +GL++           +++    +L+  +   G+  VP++ L++F+ G
Sbjct: 134 VFWRHVSALTGFIGLILETALRVSVQPRRWRV--TALVANLERTGLDAVPIIALLTFLVG 191

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A  GA  L  FGA IF++DL++   LRE GVLLTA+++AGR+ S+  A+IGSM+ NE
Sbjct: 192 AVVAFLGATVLQNFGASIFTVDLVAYSFLREFGVLLTAIIVAGRTASSFTAQIGSMRANE 251

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDAIR +GLD V +L+ PR++AL+++LP+LT +A  + I+G  +V     DI   +F S
Sbjct: 252 EIDAIRVLGLDPVELLVLPRVYALLVALPILTFVAMIAGIVGGMLVSAMTLDISPVLFLS 311

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R      L + + G+ KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI+
Sbjct: 312 RIEDNVGLIHFWVGMAKAPIFAFLIAVIGCLEGFRVQGSAQSVGEHTTSAVVQSIFVVIV 371

Query: 360 IDSLFAIFYFAIG 372
           +D++ A+F   +G
Sbjct: 372 VDAIAALFCMEMG 384


>gi|330806719|ref|YP_004351181.1| Putative ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327374827|gb|AEA66177.1| Putative ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 382

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/363 (31%), Positives = 193/363 (53%), Gaps = 7/363 (1%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM--EKYHGK 68
             G+W     +++   +  ++      ++  +DL+ +  +DT GA L++  +  E+    
Sbjct: 23  VGGDWTLAHYAQL-KRLSESLRGQYDENTL-IDLNGLGALDTAGASLLVELLGSERLGKT 80

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            +    S    +  +L+   +        P +         L   IG+ + K   D+   
Sbjct: 81  TEHPDCSLPAAE-RALLQTVYCSLTDFCVPVKEPQVGVLTQLLTRIGRAVEKVWQDTLQL 139

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL++           +++     ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 140 LGFVGLILETLARNLLRPRRWRM--TPMVVHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 197

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 198 VLADFGASIFTVDLVAFSFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 257

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD V +L+ PR+ AL+++LP+LT LA  S IIG  +V      I  A+F +   S   + 
Sbjct: 258 LDPVELLVIPRVLALLVALPMLTFLAMLSGIIGGGVVCALSLGISPAMFLTLLQSDIGVQ 317

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G++KAP  A  I  V   EGF V   + S+G   T+ VVQSI +VI++D++ A+F+
Sbjct: 318 HFLVGMVKAPIFAFLIAAVGCLEGFKVSGSAESVGAHTTSSVVQSIFVVIVLDAVAALFF 377

Query: 369 FAI 371
             +
Sbjct: 378 MEM 380


>gi|313496513|gb|ADR57879.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 374

 Score =  264 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 118/364 (32%), Positives = 187/364 (51%), Gaps = 7/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +     ++      A  DLS +  +DT GA L+   +      
Sbjct: 17  LRITGDWTLAHYASLKRESERLRSQCPADTVA--DLSQLGRLDTAGASLLAELLGSERLS 74

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +    + L       +        P +    N    L   IG+ +     DS   
Sbjct: 75  RCTHALPEASQALL---KNVYCSVQDYCIPVKEPERNVLLLLLERIGRAVGTLWQDSMQL 131

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 132 LGFVGVILETLLRRAFQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 189

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 190 VLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 249

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S   + 
Sbjct: 250 LNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAMFLSLLQSDIGVQ 309

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F+
Sbjct: 310 HFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFF 369

Query: 369 FAIG 372
             +G
Sbjct: 370 MEMG 373


>gi|148545417|ref|YP_001265519.1| hypothetical protein Pput_0160 [Pseudomonas putida F1]
 gi|148509475|gb|ABQ76335.1| protein of unknown function DUF140 [Pseudomonas putida F1]
          Length = 377

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 118/364 (32%), Positives = 188/364 (51%), Gaps = 7/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W     + +  +      ++  + + I DLS +  +DT GA L+   +      
Sbjct: 20  LRITGDWTLAHYANLKRESERL--RTQCAANTIADLSQLGRLDTAGASLLAELLGSERLS 77

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +    + L       +        P +    N    L   IG  +     DS   
Sbjct: 78  RCTHALPEASQALL---KNVYCSVQDYCIPVKEPERNVLLLLLERIGCAVGTLWQDSMQL 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 135 LGFVGVILETLLRRAFQPHRWR--FTPVVAHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 193 VLADFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ + +L+ PR+ AL+ISLPLLT +A    I+G ++V     DI  A+F S   S   + 
Sbjct: 253 LNPMELLVVPRVLALLISLPLLTFVAMICGIVGGAVVCALTLDISPAMFLSLLQSDIGVQ 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F+
Sbjct: 313 HFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFF 372

Query: 369 FAIG 372
             +G
Sbjct: 373 MEMG 376


>gi|114570554|ref|YP_757234.1| hypothetical protein Mmar10_2004 [Maricaulis maris MCS10]
 gi|114341016|gb|ABI66296.1| protein of unknown function DUF140 [Maricaulis maris MCS10]
          Length = 384

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 118/371 (31%), Positives = 185/371 (49%), Gaps = 5/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E   T+    G+W    I    D+ + A+  S    S +VD+S +  +DT GA L+    
Sbjct: 19  EGERTILEPHGDWVIDTIGR-HDNAIRAVEASADPCSIVVDVSHLGRVDTAGAYLLGRAT 77

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            K                +  LI     +       +   F   F      +G  I    
Sbjct: 78  RKCPTPDADFHFVGQHRTVRRLIEEVRMRTQVCGPDEVPTF--GFIKALARLGAGIEVAY 135

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            ++       G  ++         ++F+  L   +  M  VGV+ +P+V  ++F  GAV+
Sbjct: 136 QEAVDTFAFFGKTLTTGLSCFIQPWRFR--LTPTVWAMEEVGVNALPIVATLTFFIGAVV 193

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L  FGA +F++DL+ +  LRE GVL+TA+M+A RS SA  A IG+MK+ +EID
Sbjct: 194 AYMGATLLQSFGASVFTVDLVGLAVLREFGVLITAIMLAARSDSAFTASIGAMKMQQEID 253

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R +GLD    L+ PR+ A ++  PLLT  A  + I G  +V W   DI  A+FF+R H
Sbjct: 254 AMRVLGLDPYEALVLPRVVACVLMAPLLTFGAMVAGIFGGMLVAWTAQDISPALFFTRLH 313

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           S   +++ + G+ KAP     + I+  ++G  V     SLG++VT  VVQSI  +I++++
Sbjct: 314 SEIDISHFWVGMSKAPVFGMVVAIIGCRQGMQVQGDVESLGRRVTASVVQSIFAIIVLEA 373

Query: 363 LFAIFYFAIGI 373
           LFA+ Y  + I
Sbjct: 374 LFAMMYLELEI 384


>gi|13470959|ref|NP_102528.1| permease of ABC transporter [Mesorhizobium loti MAFF303099]
 gi|14021702|dbj|BAB48314.1| permease of ABC transporter [Mesorhizobium loti MAFF303099]
          Length = 395

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 149/369 (40%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E G+    F+G W +  ++ + D  +  I K     +  +DLS I +IDT GA LI   +
Sbjct: 28  EAGVLGCAFSGIWTTRTVA-LIDADMRKIEKRSGFKTLALDLSKIEKIDTAGAWLIDRLV 86

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +  K     +    E    L+        +  +   +   N        +G+++ +  
Sbjct: 87  SAFEKKNVEVRLQGQSEIASILLDAVGEAVRREPESGPARPPNIIIRALEAVGRRVYEMR 146

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +D  +  +ILG  I          +       ++  Q+  +GV  +PVV+L+S + GA++
Sbjct: 147 DDFLASMNILGATIRGAQMKLGRGHAVNP--AAIFNQIDRMGVGAIPVVVLMSAIVGAIV 204

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA+QLS FGA+IF +DL+ +L LRE+GVL+TA+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 205 AQQGAYQLSYFGADIFVVDLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMREEVD 264

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ + +L+ PR+ AL+I+LP LTI+ANF+A+ G  +  W Y DIP A F  R  
Sbjct: 265 ALKVIGLNPIGVLVFPRLVALVIALPCLTIIANFAALGGGIVAAWLYSDIPPAAFIDRLR 324

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L+ IF GLIKAPFMA  IG +A  EG  VG  + SLG+ VT  VV+SI +VII+D 
Sbjct: 325 VAIDLSTIFAGLIKAPFMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVIILDG 384

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 385 LFAMFYAAI 393


>gi|78777725|ref|YP_394040.1| hypothetical protein Suden_1528 [Sulfurimonas denitrificans DSM
           1251]
 gi|78498265|gb|ABB44805.1| conserved hypothetical protein [Sulfurimonas denitrificans DSM
           1251]
          Length = 373

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 106/371 (28%), Positives = 188/371 (50%), Gaps = 8/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +     +F G      + +   ++        + ++ ++DL  ++ +D+ G+  +    
Sbjct: 11  SDNKLSLKFKGELTLYNLMKYKKEIDKIAFS--KENAVVIDLLELSFLDSAGSIFLNNLQ 68

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     ++ H   +  ++     +KI      +       +N    IG+K  K  
Sbjct: 69  KELELKELKVDITCHNRDVLDMLELIRVQKITL----KKIAKKKKRNRVEKIGEKSYKAY 124

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
               S    +G + S+   +  S    +     +  +M    +  + ++ L SF+ G V+
Sbjct: 125 LGILSFMAFMGELFSHKLRYLISFKNIRH--KEIAFEMNECAIKALGIISLTSFLIGVVV 182

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A Q A+QL  +GA IF +D++ +  LRE+  L+TA++IAGRSGSA  A+IG+MKI +E+D
Sbjct: 183 AYQSAYQLKLYGANIFIVDMLGLSILRELSPLITAIVIAGRSGSAFTAQIGAMKITQELD 242

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG D  R L+ P+I AL+I++PLL  +++  AIIG  IV     +I   +F  RF+
Sbjct: 243 AMQTMGFDPYRFLVVPKIIALMITMPLLIFVSDIMAIIGGMIVANLDLNITVDMFLDRFN 302

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +   G+ K PF A  I  +A+ +G  V   + S+G   T  VV+SI  VII D+
Sbjct: 303 EVINIKHFIVGISKGPFFAFLIATIAIYQGLLVKDDTQSIGLNTTKSVVESIFAVIICDA 362

Query: 363 LFAIFYFAIGI 373
           +F+I +  +GI
Sbjct: 363 IFSIAFTNLGI 373


>gi|254502466|ref|ZP_05114617.1| conserved domain protein [Labrenzia alexandrii DFL-11]
 gi|222438537|gb|EEE45216.1| conserved domain protein [Labrenzia alexandrii DFL-11]
          Length = 382

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 131/371 (35%), Positives = 205/371 (55%), Gaps = 6/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G      +G+W    +++    +        +     +D+S +  +DT GA LI    
Sbjct: 18  SEGHQSLILSGDWTVSTLADADQQISKL--NVAKDKLTCIDVSEVDHLDTSGAWLIHRTR 75

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +     +   ++       SL     +      +P RS F  +        G+++V+  
Sbjct: 76  GQLEFSGRKVQLTGVTPVRESLFHEIEKHHPPRWQPDRSGF--TIVGFLEATGRQMVEVY 133

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D+ +  HILG +            + +    ++  Q     +  VP+V L+SF+ GA+I
Sbjct: 134 KDTLAMLHILGSLGIVLSTVLLQPKRLRSI--AIAVQFDRSCIGAVPIVALMSFLIGAII 191

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +QQG F L QFGA+IF +DL  IL LREIGV+LTA+M+AGRSGSA  AE+G+M++ EE+D
Sbjct: 192 SQQGGFYLRQFGADIFVVDLAGILVLREIGVILTAIMVAGRSGSAFTAELGAMRMQEEVD 251

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL    +L+ PRI AL+I+LP+LT +A+ SA+ GA ++ W Y DIP A F ++  
Sbjct: 252 ALHVIGLSVTEVLVLPRILALMIALPILTFVADISALFGAGLITWAYLDIPPAAFLTQLQ 311

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           S  T+     G+IKAPFMA  +G++A  EG  V   S SLG+  T  VV++I +VI++D 
Sbjct: 312 SAITVNTFVVGIIKAPFMALIVGLIACVEGLKVEGSSESLGRHTTMAVVKAIFLVIVVDG 371

Query: 363 LFAIFYFAIGI 373
           +FA+F+ AIG+
Sbjct: 372 MFAMFFAAIGV 382


>gi|171322064|ref|ZP_02910936.1| protein of unknown function DUF140 [Burkholderia ambifaria MEX-5]
 gi|171092626|gb|EDT37930.1| protein of unknown function DUF140 [Burkholderia ambifaria MEX-5]
          Length = 427

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 96/366 (26%), Positives = 164/366 (44%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   +        +  DLS I  +D +G + +     +   
Sbjct: 72  TVRLYGQWTALALARNRGAVARRVAGIATGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 131

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                 +S     +F  I             + +             G  +  F      
Sbjct: 132 DG--VALSPTQRTIFERIERLDS-------QREAPERVVHFGPITRFGFMLFAFAEHLQG 182

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + GLVI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 183 GIAMFGLVILDALSVLRRPNTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 240

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 241 QQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 300

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 301 GIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDINYFVRSLPGVVPI 360

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 361 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 420

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 421 FQNVGL 426


>gi|104779408|ref|YP_605906.1| ABC transporter permease [Pseudomonas entomophila L48]
 gi|95108395|emb|CAK13089.1| putative ABC transporter, permease protein [Pseudomonas entomophila
           L48]
          Length = 374

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 118/366 (32%), Positives = 188/366 (51%), Gaps = 7/366 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
           T    AG+W     + +  +     ++    D   VDLS +  +DT GA L+   +    
Sbjct: 15  TRLHIAGDWTLAHYASLKRECERLGSQY--GDDTQVDLSQLGRLDTAGASLLAELLGSER 72

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                  +      L       +        P +         L   IG+ + +   D+ 
Sbjct: 73  LSHCTDDLPDASRALL---KNVYCSVQDYCIPVKQPEQPVLLLLLARIGRAVDQLWQDTR 129

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                +GL++          ++++     ++  +   G+   P+V L++F+ GAV+A  G
Sbjct: 130 QVLGFIGLILETLLLRLFQPHRWRV--TPVVAHLEQTGLDAAPIVALLTFLVGAVVAFLG 187

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA IF++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT
Sbjct: 188 ATVLAAFGATIFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRT 247

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PR+ AL+I+LPLLT LA    ++G ++V     DI  A+F S   S   
Sbjct: 248 LGLNPIELLVVPRVLALLIALPLLTFLAMLCGLVGGAVVCALTLDISPAMFLSLLQSDIG 307

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+
Sbjct: 308 VQHFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAAL 367

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 368 FFMEMG 373


>gi|296284592|ref|ZP_06862590.1| putative ABC transport system permease protein [Citromicrobium
           bathyomarinum JL354]
          Length = 370

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 116/370 (31%), Positives = 191/370 (51%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           + G TV R  G +    I+ +   +    +     D A      ++EIDT+GA       
Sbjct: 13  DGGRTVLRLKGPYLLSTIANVDRGLRKLDDDIDVIDLA-----EVSEIDTVGAWFACTLA 67

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +   I+    S   ++L + +  +      +     +            +G+K+ +  
Sbjct: 68  RNHSASIE--NASERADRLLTAVGESANSSDVS-----APRLPLLTRAPEAMGEKVFEAG 120

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
               S     G +++          +F+    +++ Q   VGV+ +P++ L+SF+ G VI
Sbjct: 121 RGIVSVVGFFGQILAGAASLIRHPRRFRH--RAMVHQFESVGVNALPIIGLMSFLIGIVI 178

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA QL  FGAE  +++L+  + LRE+GVL+TA+M+AGRSGSA  A+IG+MK+ EEID
Sbjct: 179 AQQGAVQLQAFGAEALTVNLVGRITLRELGVLMTAIMVAGRSGSAFAAQIGTMKLTEEID 238

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  V +L+ PR+ A +  + LL   A+  AIIG ++V      IPF  F  R H
Sbjct: 239 AMRTIGISPVEVLVIPRLVACVFMMILLGFYASCMAIIGGAVVSDVMLGIPFWTFLMRIH 298

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                 +++ G+IKAP     +G+    +G  V  +S  +G + T  VVQ+I  VI++D+
Sbjct: 299 EVVPAHDVWVGMIKAPVFGLIVGMSGCYQGMQVRGNSEEVGLRTTKAVVQAIFTVIVLDA 358

Query: 363 LFAIFYFAIG 372
            FA+F+  IG
Sbjct: 359 FFAVFFTGIG 368


>gi|325273982|ref|ZP_08140141.1| hypothetical protein G1E_12667 [Pseudomonas sp. TJI-51]
 gi|324100871|gb|EGB98558.1| hypothetical protein G1E_12667 [Pseudomonas sp. TJI-51]
          Length = 374

 Score =  263 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 117/364 (32%), Positives = 185/364 (50%), Gaps = 7/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R AG+W     + +  D      +      A  DLS +  +DT GA L+   +      
Sbjct: 17  LRIAGDWTLAHYASLKRDSERLRAQYTPDTVA--DLSQLGRLDTAGASLLAELLGTERLS 74

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +      L       ++       P +    N    L   IG  +     DS   
Sbjct: 75  RCTHDLPEASRALL---KNVYQSVQDYCIPVKEPERNVLLLLLERIGCAVGTLWQDSMQL 131

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G+++          ++++     ++  +   G+   P+V L++F+ GAV+A  GA 
Sbjct: 132 LGFIGVILETLLRRALQPHRWRI--TPVVAHIEQTGLDAAPIVALLTFLVGAVVAFLGAT 189

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA +F++DL++   LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIRT+G
Sbjct: 190 VLADFGATVFTVDLVAFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRTLG 249

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ + +L+ PR+ AL+I+LPLLT +A    I+G ++V      I  A+F S   S   + 
Sbjct: 250 LNPMELLVVPRVLALLITLPLLTFVAMLCGIVGGAVVCALSLGISPAMFLSLLQSDIGVQ 309

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   GL KAPF A  I  +   EGF V   + S+G   T+ VVQSI +VI++D++ A+F+
Sbjct: 310 HFLVGLAKAPFFAFLIAAIGCLEGFKVSGSAESVGAHTTSAVVQSIFVVIVLDAVAALFF 369

Query: 369 FAIG 372
             +G
Sbjct: 370 MEMG 373


>gi|299068161|emb|CBJ39380.1| putative abc-type transport system, permease component abc
           transporter protein (resistance to organic solvents)
           [Ralstonia solanacearum CMR15]
          Length = 374

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 96/371 (25%), Positives = 175/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++  + +    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAYLSGDWTTLALAERAGVRSARRQIRTGLNTANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +L        ++   ++                      N    +G  ++ F 
Sbjct: 75  GNRWP--ELLDARPDQRRMIDRVARLD-------PGGWKKRIAPRINPVAVLGNAMLDFA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G ++ +   F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 EHLRIGVAMVGQLVFDLLRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I + A   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALAACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|332187454|ref|ZP_08389192.1| hypothetical protein SUS17_2546 [Sphingomonas sp. S17]
 gi|332012615|gb|EGI54682.1| hypothetical protein SUS17_2546 [Sphingomonas sp. S17]
          Length = 368

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 112/364 (30%), Positives = 186/364 (51%), Gaps = 14/364 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            RF GN     + ++ + +              +DLS +  IDT+GA L+  F  +    
Sbjct: 17  LRFTGNLSLATLGDLPERLDREEASVQ-----RIDLSQVDRIDTVGAWLVHRFAARNDAA 71

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           I+  G+  +   L   +    +      +P      + F  +   +G  ++         
Sbjct: 72  IE--GLDENQRNLVDKVVEADQPVAMRPQP-----ISPFARVAGEVGDAVITAFKTLYGL 124

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G  +           +F+    +++ +   VGVS + ++ L+SF+ G VIAQQGA 
Sbjct: 125 LGFMGATVIAGFAVLRHPRRFR--FNAVVHEFETVGVSALAIIGLMSFLIGIVIAQQGAV 182

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL QFGAE+F+I+L+  L LRE+GVL+TA+M+AGRSGSA  A++G+MK+ EEIDA+R +G
Sbjct: 183 QLRQFGAEVFTINLVGRLTLRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEIDAMRVIG 242

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  +  L+ PR  A +  +PLL   ++  A+IG   +      IP   F +R      + 
Sbjct: 243 VSPMEALVLPRTIAAVTLMPLLGFYSSLIAMIGGCFLAAVSLGIPPVTFIARIREVVPIT 302

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +++ GLIKAP     I I    +G  V   +  +G + T  VVQ+I +VI++D+ FA+F+
Sbjct: 303 DLYVGLIKAPVFGAIIAIAGCFQGMQVKSDAEQVGLRTTAAVVQAIFLVIVLDAFFAVFF 362

Query: 369 FAIG 372
             +G
Sbjct: 363 TWLG 366


>gi|313682999|ref|YP_004060737.1| hypothetical protein Sulku_1877 [Sulfuricurvum kujiense DSM 16994]
 gi|313155859|gb|ADR34537.1| protein of unknown function DUF140 [Sulfuricurvum kujiense DSM
           16994]
          Length = 373

 Score =  262 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 109/371 (29%), Positives = 178/371 (47%), Gaps = 18/371 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM---Y 60
           +       +G+W    +S+ A ++   I  S+       D+S ITEID+ G  L      
Sbjct: 16  DAHMQILCSGSWTIEHLSDAARELEALIPLSL----VTWDMSGITEIDSSGIALWQLTNR 71

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
             E+     +       + +LF L+           KP R     +  +  Y +GK+  +
Sbjct: 72  TFEERGHTCETVNEREDLSRLFRLL---------YSKPFRDVPIPAVPSSLYRLGKETYE 122

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
                 +    LG                +    S+   +   G   +P++ L +F+ G 
Sbjct: 123 IFRGIGTFLAFLGEAFILFFYTLRHPRLIRY--RSIGVHILETGARALPIIALSAFLIGV 180

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q   QL +FGA+IF +D++ I   RE+  L+TA+++AGRSGSA  A+IG+MK+ +E
Sbjct: 181 VVAYQSVVQLQKFGADIFIVDMIGISLTRELAPLITAIVVAGRSGSAFTAQIGTMKMTQE 240

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RTMG D    L+ PR+ AL+I +PLL   A+   I G  ++   +  + F+ F  R
Sbjct: 241 IDAMRTMGFDPFTFLVWPRVIALMIIMPLLIFFADMVGIFGGMVIAQVHSHLSFSEFIHR 300

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 L +   GLIK PF A  I  V+   GF V +++ S+G+  T  VV +I +VI  
Sbjct: 301 LQGALALKHYLIGLIKGPFFAFLIAFVSTYRGFQVSMNTESIGQYTTKSVVNAIFLVIAC 360

Query: 361 DSLFAIFYFAI 371
           D++F++    +
Sbjct: 361 DAIFSVLLTEL 371


>gi|238759499|ref|ZP_04620662.1| ABC transporter, permease protein [Yersinia aldovae ATCC 35236]
 gi|238702274|gb|EEP94828.1| ABC transporter, permease protein [Yersinia aldovae ATCC 35236]
          Length = 381

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 116/364 (31%), Positives = 183/364 (50%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G W       +   V     +     SA+ D S +  +DT GA L+   + +    
Sbjct: 21  VYIRGEWVLAHYRFLEPKVAQL--RVDLPASAMFDFSQLGGLDTAGATLLATLLGELRVS 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      ++   L+    +                +  L   IG+ +     D  S 
Sbjct: 79  NLRELAPRLPDERRVLLETVSQVLPNLVPQLTVKPQPFWIGLLVPIGQSVDNLWQDFKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFVGLTLEALLGTVFRPARWRV--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F +   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMICGIFGGMVVCALALDISPTMFLTIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HLLVGISKAPIFAFLIAIIGCLEGFKVSGSAESVGMHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|254247077|ref|ZP_04940398.1| hypothetical protein BCPG_01856 [Burkholderia cenocepacia PC184]
 gi|124871853|gb|EAY63569.1| hypothetical protein BCPG_01856 [Burkholderia cenocepacia PC184]
          Length = 425

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 169/366 (46%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   I        +  DLS I  +D +G + +     +   
Sbjct: 70  TVRLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 129

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R   ++    L    G  I  F      
Sbjct: 130 AGVALSATQ-----RTIFERIERLDSEREAPERIVRFDPVTRL----GLAIFAFGEHLQG 180

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                 +   +Y  G   +P+  L++F+ G V++   A
Sbjct: 181 GIAMFGRVILDALSVLRRPKTMP--WKEISANIYSAGAQALPITALVAFLIGIVLSYLSA 238

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 239 QQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 298

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 299 GIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKLVLGIDINYFVRSLPGVVPI 358

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 359 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 418

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 419 FQNVGL 424


>gi|17545032|ref|NP_518434.1| hypothetical protein RSc0313 [Ralstonia solanacearum GMI1000]
 gi|17427322|emb|CAD13841.1| putative abc-type transport system involved in resistance to
           organic solvents, permease component abc transporter
           protein [Ralstonia solanacearum GMI1000]
          Length = 374

 Score =  262 bits (670), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 96/371 (25%), Positives = 175/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++  + +    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAYLSGDWTTLALAERAGVRSARRQIRAGLNTANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +L        ++   ++                      N    +G  ++ F 
Sbjct: 75  GNRWP--ELLDARPDQRRMIDRVARLD-------PGGWKKRIAPRINPVTVLGNAMLDFA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G ++ +   F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 RHLRIGVAMVGQLMFDLLRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALGGGILAARFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I + A   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALTACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|239813318|ref|YP_002942228.1| hypothetical protein Vapar_0299 [Variovorax paradoxus S110]
 gi|239799895|gb|ACS16962.1| protein of unknown function DUF140 [Variovorax paradoxus S110]
          Length = 388

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 96/372 (25%), Positives = 181/372 (48%), Gaps = 13/372 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEI--ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++G +    +G W +  +S       +   +  +  +D    DL  I ++D IGA+L+  
Sbjct: 25  QDGRSWTVASGRWTTLAMSSRSAWQALSKDLAGAPPADGRAWDLRPIEQLDHIGAQLLWD 84

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                        +S   + +   ++       +   P  +     F     H G + ++
Sbjct: 85  HWRHRWPATLE--LSPQHKAVLDQVAQFTVGTPEEPPPTLAERLRHF----SHTGARGLE 138

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D      ++G +  +      + +  +G        +Y  G + + +  L+  + G 
Sbjct: 139 VARD---FVGLIGQLALDACTLLRAPH--RGPWRDFSGHLYQFGATALHITALVGLLIGV 193

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A   + QL Q+GAE F ++++ +  +RE+G +L AV+IAGRSGSAI A+IG M++ EE
Sbjct: 194 VLAYLISQQLRQYGAEAFVVNILGLSLIRELGPVLAAVLIAGRSGSAITAQIGVMRVTEE 253

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     L+ PR+ AL I++PL+++  + +A++G  +      DI  A F S 
Sbjct: 254 LDAMRVMGIPHGFRLVMPRVMALAIAMPLISLWTSMAALLGGMLAADAALDISPAYFLSA 313

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 ++N++  L K+      I ++    G  V  ++ SLG+  T+ VV SI+ VI++
Sbjct: 314 LPRAVPISNLWLALAKSAVFGILIALIGCYFGMKVKPNTESLGRGTTSSVVTSITAVILV 373

Query: 361 DSLFAIFYFAIG 372
           D+LFA+ +  +G
Sbjct: 374 DALFAVLFKGVG 385


>gi|116051201|ref|YP_789968.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218890596|ref|YP_002439460.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
 gi|254236173|ref|ZP_04929496.1| hypothetical protein PACG_02138 [Pseudomonas aeruginosa C3719]
 gi|254241899|ref|ZP_04935221.1| hypothetical protein PA2G_02620 [Pseudomonas aeruginosa 2192]
 gi|115586422|gb|ABJ12437.1| putative permease of ABC transporter [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126168104|gb|EAZ53615.1| hypothetical protein PACG_02138 [Pseudomonas aeruginosa C3719]
 gi|126195277|gb|EAZ59340.1| hypothetical protein PA2G_02620 [Pseudomonas aeruginosa 2192]
 gi|218770819|emb|CAW26584.1| probable permease of ABC transporter [Pseudomonas aeruginosa
           LESB58]
          Length = 381

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 114/366 (31%), Positives = 185/366 (50%), Gaps = 4/366 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G+W     + +  +V     +S  + +A  DLS +  +DT GA L+   +    
Sbjct: 19  ARVRAIGDWTLAHYTALEREVTRL--RSEVAGNASFDLSQLGALDTAGAALLAELLGAER 76

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                +       +  +L+           +P++     +   L   IG  +  F     
Sbjct: 77  LADLAELEPGLPRERQALLKTVGHALHDFCEPEKPKPPTTAIELLARIGCAMETFWLHLK 136

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +GL +            ++     L+  +   G+  VP++ L++F+ GAVIA  G
Sbjct: 137 ALLGFIGLTLETLFRSLVRPASWRV--TPLVANIEKSGLDAVPIIALLTFLVGAVIAFLG 194

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA I++++L+    LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIR 
Sbjct: 195 ATVLANFGATIYTVNLVVFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRA 254

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PR+ AL++SLP+LT +     I+G   V     DIP A+F S       
Sbjct: 255 LGLNPIELLVLPRVLALLVSLPMLTFVGMLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIG 314

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   G+ KAP  A  I ++   EGF V   + S+G+  TT VV SI +VI++D+L A+
Sbjct: 315 VQHFLVGISKAPLFAFLIAVIGCLEGFKVSGSAQSVGEHTTTSVVHSIFVVILLDALAAL 374

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 375 FFMEMG 380


>gi|260752530|ref|YP_003225423.1| hypothetical protein Za10_0287 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856391|ref|YP_162753.2| hypothetical protein ZMO1018 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258551893|gb|ACV74839.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283775390|gb|AAV89642.2| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 366

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 122/364 (33%), Positives = 187/364 (51%), Gaps = 15/364 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G      +  +++ +         SD  ++DLS +  +DT GA L+    +  + +
Sbjct: 16  LALQGVLTLAHLDSLSNTL------QTLSDVKVIDLSNLHRMDTAGAWLVHKLAQDNNAE 69

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           +K  G ++ +  +   IS   R      K       +        +GK  V         
Sbjct: 70  VK--GTNSAVAHILDQISHYDRPLPPEPKA-----VSPLIYTLTGVGKNTVHVWYTIVGL 122

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
            +  G ++ +         + +  L ++I QM  VGV+ + +V L+S + G VIAQQGA 
Sbjct: 123 VNFFGALLVSIWHTICHPSRLR--LTAIICQMETVGVNALAIVGLMSILVGVVIAQQGAV 180

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL QFGAEI+SI+L+  L  RE+GVL+TA+M+AGRSGSA  A+IGSM + EEIDA+R +G
Sbjct: 181 QLRQFGAEIYSINLVGRLSFRELGVLMTAIMVAGRSGSAFAAQIGSMNLAEEIDAMRIIG 240

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  +  L+ PR  A II +PLL   A  +A+IG  ++ W   DIP   FF+R        
Sbjct: 241 VSPMESLVLPRFLASIIMMPLLGFYATIAAVIGGGLLCWTVLDIPPTTFFTRLREVIPYT 300

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL+KAP     I I    +G  V  ++  LG   T  VV SI +VI++D+ FA+F+
Sbjct: 301 DVAVGLVKAPIFGALIAIAGCFQGTQVKGNAEQLGYCTTKAVVHSIFLVIVLDAFFAVFF 360

Query: 369 FAIG 372
             IG
Sbjct: 361 SEIG 364


>gi|260463968|ref|ZP_05812164.1| protein of unknown function DUF140 [Mesorhizobium opportunistum
           WSM2075]
 gi|259030343|gb|EEW31623.1| protein of unknown function DUF140 [Mesorhizobium opportunistum
           WSM2075]
          Length = 395

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 149/369 (40%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E G+    F+G W +  ++ + D  +  I K     +  +DLS I +IDT GA LI   +
Sbjct: 28  EGGVLGCAFSGVWTTRTVA-LIDADMRKIEKRSGFKTLALDLSKIEKIDTAGAWLIDRLV 86

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +  K     +    E    L+        +  +   +   N        +G+++ +  
Sbjct: 87  SVFEKKNVEVQLQGRSEIASILLDAVGEAVRREPESGPARPPNIVLRALEAVGRRVYEMR 146

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +D  +  +ILG  I          +       ++  Q+  +GV  +PVV+L+S + GA++
Sbjct: 147 DDFLASMNILGATIRGAQMKLGRGHAVNP--AAIFNQIDRMGVGAIPVVVLMSAIVGAIV 204

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGA+QLS FGA+IF +DL+ +L LRE+GVL+TA+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 205 AQQGAYQLSYFGADIFVVDLVGVLILRELGVLMTAIMIAGRSGSAITAEIGSMKMREEVD 264

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ + +L+ PR+ AL+I+LP LTI+ANF+A+ G     W Y DIP A F  R  
Sbjct: 265 ALKVIGLNPIGVLVFPRLVALVIALPCLTIIANFAALGGGIAAAWLYSDIPPAAFLDRLR 324

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L+ IF GLIKAPFMA  IG +A  EG  VG  + SLG+ VT  VV+SI +VII+D 
Sbjct: 325 VAIDLSTIFAGLIKAPFMAMIIGTIASVEGMKVGGSAESLGQHVTASVVKSIFVVIILDG 384

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 385 LFAMFYAAI 393


>gi|83748501|ref|ZP_00945522.1| ABC transporter permease protein [Ralstonia solanacearum UW551]
 gi|207742154|ref|YP_002258546.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum IPO1609]
 gi|83724805|gb|EAP71962.1| ABC transporter permease protein [Ralstonia solanacearum UW551]
 gi|206593542|emb|CAQ60469.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum IPO1609]
          Length = 374

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 96/371 (25%), Positives = 176/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++   ++    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAYLSGDWTTLALAERAGVRSARRQIRAGLDNANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +         ++   ++                      N    +G  ++ F 
Sbjct: 75  GNRWP--EHLDARADQRRMIDRVARLD-------PGGWKKRIAPRINPVTVLGGAMIDFA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +       ++G ++ +   F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 DHLRIGVAMVGQLMFDLLRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|103485974|ref|YP_615535.1| hypothetical protein Sala_0481 [Sphingopyxis alaskensis RB2256]
 gi|98976051|gb|ABF52202.1| protein of unknown function DUF140 [Sphingopyxis alaskensis RB2256]
          Length = 368

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 112/368 (30%), Positives = 191/368 (51%), Gaps = 15/368 (4%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                RF G      + ++   +            A +DLSAI  IDT+GA ++      
Sbjct: 14  DGVEVRFTGRLTLARLGDLPARLDAL------GPIATLDLSAIDRIDTVGAWIVTRTAAD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           +  +  + G S   ++L   ++       K++         ++  +   IG   V   N+
Sbjct: 68  HDAR--ITGASADAQRLLDALAS-----DKSEYRVHRDRRPAWVRMLEQIGTASVAVWNE 120

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                   G +I        +  + +    +++ +   VGV  +P++ L+SF+ G VIAQ
Sbjct: 121 LLGIVGFFGAMIVAIFNQIRARRRLR--WNAIVTRFQTVGVDALPIIGLMSFLIGIVIAQ 178

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QGA QL QFG E+F+I+L+    +RE+G+L+TA+M+AGRSGSA  A+IG+MK+ EE+DA+
Sbjct: 179 QGAVQLEQFGLEVFTINLVGRASIRELGLLMTAIMVAGRSGSAFAAQIGTMKLTEEVDAM 238

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+G+  +  ++ PR+ A  I++PLL   A+  AI G  +  W   DIP   +  R    
Sbjct: 239 RTIGVSPMEAIVLPRVAASTITMPLLGFYASLCAIAGGGLFCWVGLDIPPLTYIQRLREI 298

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + + +  LIKAP     IG+    EG  V  ++  +G++ T+ VV +I +VI++D+ F
Sbjct: 299 IPMTDFWIMLIKAPVFGILIGVTGCYEGMQVRQNAEEVGQRTTSAVVAAIFLVIVLDAFF 358

Query: 365 AIFYFAIG 372
           A+F+ ++G
Sbjct: 359 AVFFSSLG 366


>gi|327478710|gb|AEA82020.1| ABC transporter permease [Pseudomonas stutzeri DSM 4166]
          Length = 385

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 111/363 (30%), Positives = 188/363 (51%), Gaps = 5/363 (1%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G+W     + +  +V     ++   + + ++LS +  +DT GA L++  +       
Sbjct: 27  RIVGDWTLAHYAALRREVQRL--RARIDERSQIELSGLGALDTAGAGLLVELLGPERIAA 84

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
                     +  +L+       +       S     F  +  HIG+ +        +  
Sbjct: 85  IEAWAPQLPAERLALLRTVATA-LDQPDAAESPRGYEFGYVLAHIGRTVAAVWKQQRALL 143

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             +GL +           +++  L SL   +   G+  VP+V L++F+ GAV+A  GA  
Sbjct: 144 GFIGLTLQTLLLTLPRPRRWR--LTSLAVHIEQTGLDAVPIVALLTFLVGAVVAFLGATV 201

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L+ FGA I++++L+    LRE GVLL A+++AGRS SA  A+IGSMK NEE+DAIRT+GL
Sbjct: 202 LADFGATIYTVNLVGFSFLREFGVLLAAILLAGRSASAFAAQIGSMKSNEEVDAIRTLGL 261

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
             + +L+ PR+ A++I+LP+LT +   S I G  +V     DI   +FF+       +++
Sbjct: 262 SPIELLVLPRVLAMLITLPILTFVGMLSGIAGGLVVCVLALDISPTMFFNIMARDIAVSH 321

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              GL KAP  A  I ++   EGF V   + S+G+  T+ VVQ+I +VI++D++ A+F+ 
Sbjct: 322 FLVGLGKAPVFAFVIAVIGCLEGFKVSGSAQSVGEHTTSSVVQAIFMVILLDAIAALFFM 381

Query: 370 AIG 372
            +G
Sbjct: 382 EMG 384


>gi|241761770|ref|ZP_04759856.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373684|gb|EER63244.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 366

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 123/364 (33%), Positives = 188/364 (51%), Gaps = 15/364 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G      +  +++ + M       SD  ++DLS +  +DT GA L+    +  + +
Sbjct: 16  LALQGVLTLAHLDSLSNTLQML------SDVKVIDLSNLHRMDTAGAWLVHKLAQDNNAE 69

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
           +K  G ++ +  +   IS   R      K       +        +GK  V         
Sbjct: 70  VK--GTNSAVAHILDQISHYDRPLPPEPKA-----VSPLIYTLTGVGKNTVHVWYTIVGL 122

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
            +  G ++ +         + +  L ++I QM  VGV+ + +V L+S + G VIAQQGA 
Sbjct: 123 VNFFGALLVSIWHTICHPSRLR--LTAIICQMETVGVNALAIVGLMSILVGVVIAQQGAV 180

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL QFGAEI+SI+L+  L  RE+GVL+TA+M+AGRSGSA  A+IGSM + EEIDA+R +G
Sbjct: 181 QLRQFGAEIYSINLVGRLSFRELGVLMTAIMVAGRSGSAFAAQIGSMNLAEEIDAMRIIG 240

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  +  L+ PR  A II +PLL   A  +A+IG  ++ W   DIP   FF+R        
Sbjct: 241 VSPMESLVLPRFLASIIMMPLLGFYATIAAVIGGGLLCWTVLDIPPTTFFTRLREVIPYT 300

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL+KAP     I I    +G  V  ++  LG   T  VV SI +VI++D+ FA+F+
Sbjct: 301 DVAVGLVKAPIFGALIAIAGCFQGTQVKGNAEQLGYCTTKAVVHSIFLVIVLDAFFAVFF 360

Query: 369 FAIG 372
             IG
Sbjct: 361 SEIG 364


>gi|152984282|ref|YP_001347296.1| ABC transporter permease [Pseudomonas aeruginosa PA7]
 gi|150959440|gb|ABR81465.1| probable permease of ABC transporter [Pseudomonas aeruginosa PA7]
          Length = 381

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 114/366 (31%), Positives = 184/366 (50%), Gaps = 4/366 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G+W     + +  +V     +S  +  A  DLS +  +DT GA L+   +    
Sbjct: 19  ARVRAIGDWTLAHYTALEREVTRL--RSQVAGDASFDLSQLGALDTAGAALLAELLGAER 76

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                +       +  +L+           +P++     +   L   IG  +  F     
Sbjct: 77  LADLAELEPGLPRERQALLKTVGHALHDFCEPEKPKPPTTAIELLARIGCAMETFWLHLK 136

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +GL +            ++     L+  +   G+  VP++ L++F+ GAVIA  G
Sbjct: 137 ALLGFIGLTLETLLRSLVRPASWRV--TPLVANIEKSGLDAVPIIALLTFLVGAVIAFLG 194

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA I++++L+    LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIR 
Sbjct: 195 ATVLANFGATIYTVNLVVFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRA 254

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PR+ AL++SLP+LT +     I+G   V     DIP A+F S       
Sbjct: 255 LGLNPIELLVLPRVLALLVSLPMLTFVGMLCGIVGGMTVCAWSLDIPPAMFLSIMEDGIG 314

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   G+ KAP  A  I ++   EGF V   + S+G+  TT VV SI +VI++D+L A+
Sbjct: 315 VQHFLVGISKAPLFAFLIAVIGCLEGFKVSGSAQSVGEHTTTSVVHSIFVVILLDALAAL 374

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 375 FFMEMG 380


>gi|294010007|ref|YP_003543467.1| ABC-type transport system permease component LinK [Sphingobium
           japonicum UT26S]
 gi|292673337|dbj|BAI94855.1| ABC-type transport system permease component LinK [Sphingobium
           japonicum UT26S]
          Length = 376

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 114/370 (30%), Positives = 193/370 (52%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G TV R +GN     + ++ D +       I+     +DLS +  +DTIGA ++   +
Sbjct: 19  REGRTVIRLSGNLSIACLHDLPDRLDA-----IEGPVDTIDLSDVGHMDTIGAWVLHRAI 73

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++      + G     E+L + +              R      ++ +   IG+ +V   
Sbjct: 74  KRLDCG--ITGDKCDAERLIATVGSVDE-----PVNIRPDHEPPWQRVVGQIGEAVVNSG 126

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                     G  +  T        +F+    +++++   VGVS + ++ L+SF+ G VI
Sbjct: 127 TTLLGLLGFFGGTLVATWNVIRHPGRFRIN--AVVQRFEVVGVSALGIIGLMSFLIGIVI 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+D
Sbjct: 185 AQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVD 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PR  A+++ +PLL   ++  AIIG   +     DIP   F  R  
Sbjct: 245 AMRTIGVSPMEALVLPRTLAVVVMMPLLGFYSSIVAIIGGGFLCAVSLDIPPITFVQRLR 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+I +VI+ID+
Sbjct: 305 EVVPIHDLWVGLIKAPVFGVIIALAGCFQGMQVKANAEEVGLRTTAAVVQAIFLVIVIDA 364

Query: 363 LFAIFYFAIG 372
            FA+F+  +G
Sbjct: 365 FFAVFFTWVG 374


>gi|29654061|ref|NP_819753.1| ABC transporter permease [Coxiella burnetii RSA 493]
 gi|161830426|ref|YP_001596961.1| ABC transporter, permease protein [Coxiella burnetii RSA 331]
 gi|165924016|ref|ZP_02219848.1| ABC transporter, permease protein [Coxiella burnetii RSA 334]
 gi|212212807|ref|YP_002303743.1| ABC transporter permease protein [Coxiella burnetii CbuG_Q212]
 gi|29541327|gb|AAO90267.1| ABC transporter permease protein [Coxiella burnetii RSA 493]
 gi|161762293|gb|ABX77935.1| ABC transporter, permease protein [Coxiella burnetii RSA 331]
 gi|165916539|gb|EDR35143.1| ABC transporter, permease protein [Coxiella burnetii RSA 334]
 gi|212011217|gb|ACJ18598.1| ABC transporter permease protein [Coxiella burnetii CbuG_Q212]
          Length = 377

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 114/368 (30%), Positives = 189/368 (51%), Gaps = 13/368 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAEL---IMYFMEKY 65
               G+W    +S + D + +   K   S+  I+    IT++D+ GA L   ++  ++  
Sbjct: 20  LFCLGDWTVSHLSPLEDQLPLYAEKL--SEKVIIHADKITKMDSAGALLFYTLINHLKSL 77

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
              I++ G+S + + L  LI    +   +     ++        + Y +G+  V      
Sbjct: 78  GKAIEITGLSENAQSLLKLIGNESKFLRQPLPSSKTP------GVVYLLGEWAVTKWRVL 131

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +G V +  G+        +    +++R +   G   +P+V L+SF+ G V+  Q
Sbjct: 132 IDFLTFVGEVATTAGQGILKPQ--RIQWRAILRAIEETGYQALPIVALLSFLVGVVLTYQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  + A+IF +D+     LRE G L+TA++ AGR+ +A  A+IG+MK+NEEIDA+ 
Sbjct: 190 IALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMKVNEEIDALN 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG+  +  L+ P+I ALIISL LLT+ A+     G+ I+     DI +  F  RFH   
Sbjct: 250 TMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLAFLDRFHHAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GLIKAP     I  V   +GF VG  ++S+G+K T   VQSI ++II D++F+
Sbjct: 310 AVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFLIIIADAIFS 369

Query: 366 IFYFAIGI 373
           + +   GI
Sbjct: 370 VIFSLRGI 377


>gi|116690919|ref|YP_836542.1| hypothetical protein Bcen2424_2901 [Burkholderia cenocepacia
           HI2424]
 gi|116649008|gb|ABK09649.1| protein of unknown function DUF140 [Burkholderia cenocepacia
           HI2424]
          Length = 447

 Score =  261 bits (668), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 168/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   I        +  DLS I  +D +G + +     +   
Sbjct: 92  TVRLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 151

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R   ++    L    G  I  F      
Sbjct: 152 AGVALSATQ-----RTIFERIERLDSEREAPERIVRFDPVTRL----GLAIFAFGEHLQG 202

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 203 GITMFGRVILDALSVLRRPKTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 260

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 261 QQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 320

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 321 GIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKLVLGIDINYFVRSLPGVVPI 380

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 381 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 440

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 441 FQNVGL 446


>gi|154706662|ref|YP_001424136.1| ABC transporter permease protein [Coxiella burnetii Dugway
           5J108-111]
 gi|154355948|gb|ABS77410.1| ABC transporter permease protein [Coxiella burnetii Dugway
           5J108-111]
          Length = 377

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 113/368 (30%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAEL---IMYFMEKY 65
               G+W    +S + D +   +     S+  I+    IT++D+ GA L   ++  ++  
Sbjct: 20  LFCLGDWTVSHLSPLEDQLP--LCAEKLSEKVIIHADKITKMDSAGALLFYTLINHLKSL 77

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
              I++ G+S + + L  LI    +   +     ++        + Y +G+  V      
Sbjct: 78  GKAIEITGLSENAQSLLKLIGNESKFLRQPLPSSKTP------GVVYLLGEWAVTKWRVL 131

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +G V +  G+        +    +++R +   G   +P+V L+SF+ G V+  Q
Sbjct: 132 IDFLTFVGEVATTAGQGILKPQ--RIQWRAILRAIEETGYQALPIVALLSFLVGVVLTYQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  + A+IF +D+     LRE G L+TA++ AGR+ +A  A+IG+MK+NEEIDA+ 
Sbjct: 190 IALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMKVNEEIDALN 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG+  +  L+ P+I ALIISL LLT+ A+     G+ I+     DI +  F  RFH   
Sbjct: 250 TMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLAFLDRFHHAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GLIKAP     I  V   +GF VG  ++S+G+K T   VQSI ++II D++F+
Sbjct: 310 AVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFLIIIADAIFS 369

Query: 366 IFYFAIGI 373
           + +   GI
Sbjct: 370 VIFSLRGI 377


>gi|300692713|ref|YP_003753708.1| abc-type transport system, permease abc transporter protein
           (resistance to organic solvents) [Ralstonia solanacearum
           PSI07]
 gi|299079773|emb|CBJ52450.1| putative abc-type transport system, permease component abc
           transporter protein (resistance to organic solvents)
           [Ralstonia solanacearum PSI07]
          Length = 374

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 96/371 (25%), Positives = 175/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++  +++    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAYLSGDWTTLALAERAGVRSARRQIRAGLNNANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +         ++   ++                      N    +G  +  F 
Sbjct: 75  GNRWP--ERLDARPDQRRMIDRVARLD-------PGGWKKRIAPRINPVMVLGGAMFDFA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G ++ +   F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 GHLQIGVAMVGQLMFDLLRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|146277759|ref|YP_001167918.1| hypothetical protein Rsph17025_1720 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556000|gb|ABP70613.1| protein of unknown function DUF140 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 366

 Score =  261 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/364 (29%), Positives = 195/364 (53%), Gaps = 9/364 (2%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           + +G      ++    ++  A           +D+ A+  +DT GA  I+   ++     
Sbjct: 12  QISGRLTIETLARTRHNLASA------EREGRLDMGAVEALDTAGAWAILSAQKRAEAGG 65

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
           +   +    E    L++      +   +P+R        +    +G+++   +  S    
Sbjct: 66  RPFEIVNLSEAHRHLLATVADA-MPEPEPRRRTIPGRPGDGLAQLGQEVAGGLRGSLDSM 124

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
              G V+++ G       + +  L  L+  M   G + VP+V L+ F+ G V+A QG+ Q
Sbjct: 125 AFFGQVVAHLGGLLIHPRRLR--LTPLVHHMQEAGWNAVPIVTLMGFLIGIVLAFQGSTQ 182

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L  FGAE++ +DL++I  LRE+G+LLTA+++AGRSGSA  A IGSMK+ EEIDA+R +GL
Sbjct: 183 LKAFGAEVYVVDLVAISILRELGILLTAIIVAGRSGSAFTAAIGSMKMREEIDAMRVLGL 242

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
           D +  L+ PR+ AL+I LP+L  +A+ + ++G +++ W    I   +F ++  +   + +
Sbjct: 243 DPIDRLVLPRLIALVILLPVLGFIASMAGLVGGALMAWIDLGITPGMFRTQLLADTDVNH 302

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              GL+KAPF A  I ++   +G  V  ++ SLG   +  VVQ+I +VI++D+LF++F+ 
Sbjct: 303 AIIGLVKAPFFAVIIAVIGCHQGMQVSGNAESLGSHTSRSVVQAIFLVIVVDALFSVFFA 362

Query: 370 AIGI 373
             G+
Sbjct: 363 VWGL 366


>gi|182681137|ref|YP_001829297.1| hypothetical protein XfasM23_0579 [Xylella fastidiosa M23]
 gi|182631247|gb|ACB92023.1| protein of unknown function DUF140 [Xylella fastidiosa M23]
 gi|307579585|gb|ADN63554.1| ABC transporter permease [Xylella fastidiosa subsp. fastidiosa
           GB514]
          Length = 396

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 118/368 (32%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                  +G+W    +          + +S  +    ++   I ++D+ GA  ++ F  +
Sbjct: 41  DRGQIHLSGSWVLANLL-----TASELLQSYSNSIQHINARNIDQLDSAGALQLLRFTTR 95

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K +          L S I     +  K +          F      +G  +VK   +
Sbjct: 96  TGLKNEAIEFREEHRPLISTIEILDDEHPKPE------RDYGFLAALERLGIAVVKTRRN 149

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +    +      +F+    S +  M  VG+  VP+V+++S++ GAVIA 
Sbjct: 150 IIDVCSFLGENLVKIAQLAREPRRFRI--TSTVHHMEQVGLDAVPLVVVLSYLVGAVIAF 207

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEIF ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI
Sbjct: 208 LGSTILRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAI 267

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +T+GLD + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ SR H T
Sbjct: 268 QTLGLDPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHET 327

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   G+ KAP  A  IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L 
Sbjct: 328 MQLRHFIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALA 387

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 388 ALWFMRMG 395


>gi|94496554|ref|ZP_01303130.1| hypothetical protein SKA58_17657 [Sphingomonas sp. SKA58]
 gi|94423914|gb|EAT08939.1| hypothetical protein SKA58_17657 [Sphingomonas sp. SKA58]
          Length = 369

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 111/370 (30%), Positives = 188/370 (50%), Gaps = 14/370 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +G TV R +GN     + ++   +       +Q     VD+S +  IDTIGA  +    
Sbjct: 12  RDGGTVIRLSGNLAIACLHDLPARLDA-----VQGPINAVDVSQVDHIDTIGAWTVHSAA 66

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++ +    + G +   ++L   +                   +    +   IG  ++   
Sbjct: 67  KRLNAP--ITGANEDAQRLIEAVGTLDEPFSLRP-----DKVSPLTRVVGQIGDAVISAG 119

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                     G  +           +F+    +++++   VGVS + ++ L+SF+ G VI
Sbjct: 120 TTLMGLLGFFGASLVAAWGLIRHPSRFRVN--AVVQRFEVVGVSALGIIGLMSFLIGIVI 177

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  A++G+MK+ EEID
Sbjct: 178 AQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEID 237

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+G+  +  L+ PR  A+++ +PLL   A+  A+IG   +     DIP   F  R  
Sbjct: 238 AMRTIGVSPMEALVMPRTLAVVVMMPLLGFYASIVAVIGGGFLCAVALDIPPITFVQRLR 297

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GLIKAP     I +    +G  V  ++  +G + T  VVQ+I +VI+ID+
Sbjct: 298 EVVPITDLWVGLIKAPVFGIIIALSGCYQGMQVKANAEEVGLRTTAAVVQAIFLVIVIDA 357

Query: 363 LFAIFYFAIG 372
            FA+F+  +G
Sbjct: 358 FFAVFFTWVG 367


>gi|71274907|ref|ZP_00651195.1| Protein of unknown function DUF140 [Xylella fastidiosa Dixon]
 gi|71898795|ref|ZP_00680963.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|71901849|ref|ZP_00683912.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|170729829|ref|YP_001775262.1| ABC transporter permease [Xylella fastidiosa M12]
 gi|71164639|gb|EAO14353.1| Protein of unknown function DUF140 [Xylella fastidiosa Dixon]
 gi|71728377|gb|EAO30545.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|71731381|gb|EAO33444.1| Protein of unknown function DUF140 [Xylella fastidiosa Ann-1]
 gi|167964622|gb|ACA11632.1| ABC transporter permease [Xylella fastidiosa M12]
          Length = 372

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 117/368 (31%), Positives = 187/368 (50%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                  +G+W    +          + +S  +    ++   I ++D+ GA  ++ F  +
Sbjct: 17  DRGQIHLSGSWVLANVL-----TASELLQSYSNSIQHINARNIDQLDSAGALQLLRFATR 71

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K +          L S I     +  K +          F      +G  +VK   +
Sbjct: 72  TGLKNEAIEFREEHRPLISTIEILDDEHPKPE------RDYGFLAALERLGIAVVKTRRN 125

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +    +      +F+    S +  M  VG+  VP+V+++S++ GAVIA 
Sbjct: 126 IIDVCSFLGENLVKIAQLAREPRRFRI--TSTVHHMEQVGLDAVPLVVVLSYLVGAVIAF 183

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEIF ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI
Sbjct: 184 LGSTILRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAI 243

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +T+GLD + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ SR H T
Sbjct: 244 QTLGLDPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHET 303

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               +   G+ KAP  A  IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L 
Sbjct: 304 MQFRHFIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALA 363

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 364 ALWFMRMG 371


>gi|149187032|ref|ZP_01865339.1| ABC-type transport system permease component [Erythrobacter sp.
           SD-21]
 gi|148829321|gb|EDL47765.1| ABC-type transport system permease component [Erythrobacter sp.
           SD-21]
          Length = 369

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 118/369 (31%), Positives = 205/369 (55%), Gaps = 14/369 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            G +V   +G +    +  + +D+     + +    A +DLS ++EIDT+GA L      
Sbjct: 13  EGGSVLALSGPYLVSTVGAVDEDL-----RGLDEPLARIDLSEVSEIDTVGAWLACQLAS 67

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           ++    ++ G S    +L   ++      + +++   +     +  +   +G+K+    +
Sbjct: 68  RHGA--EITGASERATRLLGALT-----GMDSEQALSAPRLPVWSRVPEAMGEKMFNARS 120

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
            +      LG  + + G    +  +F+    +L+ Q+  VGVS +P++ L+SF+ G VIA
Sbjct: 121 GAIGVISFLGAALISAGNLIRNPRRFRTV--ALVHQVELVGVSALPIIGLMSFLIGIVIA 178

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQGA QL+ FGAE  +++L+  + LRE+GVL+TA+M+AGRSGSA  A++G+MK+ EE+DA
Sbjct: 179 QQGAVQLAAFGAETLTVNLVGRITLRELGVLMTAIMVAGRSGSAFAAQLGTMKLTEEVDA 238

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+G+  +  L+ PRI + ++ +PLL   A+  AIIG ++V      IPF  F SR   
Sbjct: 239 MRTIGISPMEALVIPRILSAVLMMPLLGFYASCMAIIGGAVVGDLMLGIPFWTFLSRIQE 298

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                +++ GLIKAP     +G+     G  V  +S  +GK+ T  VV +I  VI++D+ 
Sbjct: 299 VVPTYDVWVGLIKAPVFGLIVGLAGCYNGMQVEGNSEEVGKRTTLSVVAAIFAVIVLDAF 358

Query: 364 FAIFYFAIG 372
           FA+F+  +G
Sbjct: 359 FAVFFTELG 367


>gi|300705335|ref|YP_003746938.1| ABC transporter permease [Ralstonia solanacearum CFBP2957]
 gi|299072999|emb|CBJ44356.1| putative abc-type transport system, permease component abc
           transporter protein (resistance to organic solvents)
           [Ralstonia solanacearum CFBP2957]
          Length = 374

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 96/371 (25%), Positives = 176/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++   ++    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAYLSGDWTTLALAERAGVRGARRQIRAGLDNANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +         ++   ++                      N    +G  ++ F 
Sbjct: 75  GNRWP--EHLDARADQRRMIDRVARLD-------PGGWKKHIAPRINPVTVLGGAMLDFA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +       ++G ++ +   F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 DHLQIGVAMVGQLMFDLLRFVRAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI+IVI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITIVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|15837904|ref|NP_298592.1| hypothetical protein XF1303 [Xylella fastidiosa 9a5c]
 gi|9106294|gb|AAF84112.1|AE003963_9 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 396

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 118/368 (32%), Positives = 187/368 (50%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                  +G+W    +          + +S  +    ++   I ++D+ GA  ++ F  +
Sbjct: 41  DRGQIHLSGSWVLANVL-----TASELLQSYSNSIQHINARNIDQLDSAGALQLLRFATR 95

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K    G       L S I     +  K +          F      +G  +VK   +
Sbjct: 96  TGLKNDAIGFREEHRPLISTIEILDDEYPKPE------RDYGFLAALERLGIAVVKTRRN 149

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +    +      +F+    S +  M  VG+  VP+V+++S++ GAVIA 
Sbjct: 150 IVDVCSFLGENLVKIAQLAREPRRFRI--TSTVHHMEQVGLDAVPLVVVLSYLVGAVIAF 207

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEIF ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI
Sbjct: 208 LGSTILRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAI 267

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +T+GLD + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ SR H T
Sbjct: 268 QTLGLDPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHET 327

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               +   G+ KAP  A  IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L 
Sbjct: 328 MQFRHFIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALA 387

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 388 ALWFMRMG 395


>gi|300312192|ref|YP_003776284.1| organic solvents resistance ABC transporter permease
           [Herbaspirillum seropedicae SmR1]
 gi|300074977|gb|ADJ64376.1| ABC-type transport system involved in resistance to organic
           solvents, permease component protein [Herbaspirillum
           seropedicae SmR1]
          Length = 380

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 108/365 (29%), Positives = 193/365 (52%), Gaps = 4/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V    G+W       ++  +  A  +    +  +++ SA++  DT+GA+L++  +     
Sbjct: 19  VLHVEGDWTLRNYRALSRQIAQA--RPALGEQTVLEFSALSAFDTVGAKLLVDLLGVPAA 76

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             + Q  ST      +L++     K                ++   +G   +     +  
Sbjct: 77  LRQTQADSTLAPAWRALLAVVAEAKAIAMPKPAPPRQAWITDMLERVGAATLSLRACALG 136

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +GL +           +++    +++ Q+   G+  VP+V L++F+ GAV+A  GA
Sbjct: 137 LLGFMGLCLQTLLSSFWRPSRWRV--TAVVAQIEQTGLDAVPIVSLLTFMVGAVVAFLGA 194

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L+ FGA I+++DL++   LRE  VLLTA+++AGR+ S+  A+IGSMK NEEIDAIR +
Sbjct: 195 TVLANFGASIYTVDLVAFSFLREFAVLLTAILMAGRTASSFTAQIGSMKANEEIDAIRAL 254

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD +++L+ PR+ AL++++P LT +A  S + G ++V     DI   +F S       +
Sbjct: 255 GLDPIKLLVLPRLIALLVAMPALTFIAMLSGLFGGAMVCALSLDISPTMFLSLLQQDVGI 314

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   G++KAP  A  + ++   EGF V   + S+G+  T+ VVQSI +VI++D+L A+F
Sbjct: 315 RHFILGMVKAPLFAFVVAVIGCNEGFKVSGSAQSVGQHTTSSVVQSIFVVILLDALAALF 374

Query: 368 YFAIG 372
           +  +G
Sbjct: 375 FMEMG 379


>gi|28198464|ref|NP_778778.1| ABC transporter permease [Xylella fastidiosa Temecula1]
 gi|28056548|gb|AAO28427.1| ABC transporter permease [Xylella fastidiosa Temecula1]
          Length = 372

 Score =  260 bits (665), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 118/368 (32%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                  +G+W    +          + +S  +    ++   I ++D+ GA  ++ F  +
Sbjct: 17  DRGQIHLSGSWVLANLL-----TASELLQSYSNSIQHINARNIDQLDSAGALQLLRFTTR 71

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              K +          L S I     +  K +          F      +G  +VK   +
Sbjct: 72  TGLKNEAIEFREEHRPLISTIEILDDEHPKPE------RDYGFLAALERLGIAVVKTRRN 125

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  LG  +    +      +F+    S +  M  VG+  VP+V+++S++ GAVIA 
Sbjct: 126 IIDVCSFLGENLVKIAQLAREPRRFRI--TSTVHHMEQVGLDAVPLVVVLSYLVGAVIAF 183

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G+  L  FGAEIF ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI
Sbjct: 184 LGSTILRNFGAEIFVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKSREEIDAI 243

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +T+GLD + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ SR H T
Sbjct: 244 QTLGLDPIDLLVIPRLIALLVMLPLLTFIAMIAGLAGGITVGAFDLGIPPQMYLSRMHET 303

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +   G+ KAP  A  IG++   EG  V   + S+GK  T+ VVQ+IS+VIIID+L 
Sbjct: 304 MQLRHFIIGMSKAPLFALIIGLIGCLEGLKVTGTAQSVGKHTTSSVVQTISLVIIIDALA 363

Query: 365 AIFYFAIG 372
           A+++  +G
Sbjct: 364 ALWFMRMG 371


>gi|301062341|ref|ZP_07203004.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300443545|gb|EFK07647.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 390

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 87/373 (23%), Positives = 175/373 (46%), Gaps = 6/373 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +SE      +F G+W           ++  ++          D   ++  D+     +  
Sbjct: 24  LSEQKTLQIKFQGDWILENKRPSISALIKQMDSEAAVRQITFDTLGLSRWDSALLICLTK 83

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
            +EK   K          E  F L+           + +     N   +  + +G + V 
Sbjct: 84  IIEKASQKDIPLDGKGLPEGAFKLLDLASTV----PEKKGVHKKNGRPSFLFQVGSESVA 139

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F N        +G   +   +F     +F+     L+R +   G+  +P+V LIS + G 
Sbjct: 140 FFNSFLEALGFVGEAFNAFSKFLTGKARFRR--SDLMRIIQDCGIEALPIVSLISLLVGL 197

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++A  GA QL+ FGA+I+  +L+ I  +R +G ++  +++AGR+G+A  A++G+M++NEE
Sbjct: 198 ILAFVGAVQLTMFGAQIYVANLVGIAMVRVMGAVMAGIIMAGRTGAAFAAQLGTMQVNEE 257

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA +TMG+  +  L+ PR+ AL + +PLL + A+   I+G  IV     D+    ++++
Sbjct: 258 IDAFKTMGISPMEFLVLPRMLALTLMMPLLCLYADLMGILGGFIVGVGMLDLNMMEYYNQ 317

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +  TL++++ G++++      + +     G   G  ++++G   T+ VV  I  +I+ 
Sbjct: 318 TKAAVTLSDLWIGIVQSAVFGMLVALAGCLRGMQCGRSASAVGDATTSAVVTGIVSIIVA 377

Query: 361 DSLFAIFYFAIGI 373
            ++  +    +GI
Sbjct: 378 TAVITVITNMMGI 390


>gi|120554124|ref|YP_958475.1| hypothetical protein Maqu_1197 [Marinobacter aquaeolei VT8]
 gi|120323973|gb|ABM18288.1| protein of unknown function DUF140 [Marinobacter aquaeolei VT8]
          Length = 382

 Score =  260 bits (664), Expect = 3e-67,   Method: Composition-based stats.
 Identities = 113/373 (30%), Positives = 190/373 (50%), Gaps = 12/373 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +E G    +F+G+W     S +            ++ +   D S +  +DT GA L++  
Sbjct: 19  AEFGGHTLKFSGDWTLSHYSVLNRQTTAL---KPRAAACNPDFSGLGRLDTAGASLMVKL 75

Query: 62  ME--KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
           +        ++   +      L   ++        NQ        N        IGKK+ 
Sbjct: 76  LGSDALISALQRAELPDEQRALIQAVAEAM-----NQPSAAVATVNPVVAFLAEIGKKVT 130

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                    A  +G  +           +++      +  ++  G++ +P+V L++F+ G
Sbjct: 131 TLGQLVWLLAGFIGQTLGTLFYILPRPTRWRI--TPFVAALHDTGLNALPIVALLTFLVG 188

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A  GA  L  FGA I+++DL++   LRE GVLL A+++AGR+ SA  A+IG+MK+NE
Sbjct: 189 AVVAFLGATVLEDFGATIYTVDLVAFSFLREFGVLLAAILLAGRTASAFTAQIGAMKVNE 248

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DAIRT+GL+ V +L+ PR+ A++ SLP+LT +   S ++G ++V     DIP + F +
Sbjct: 249 ELDAIRTLGLNPVELLVVPRVLAMMFSLPILTFIGMISGMVGGAVVCAVALDIPPSQFIA 308

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                  L +   GL KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI+
Sbjct: 309 IVERDIALKHFLVGLGKAPVFAFLIAVIGCLEGFKVAGSAQSVGEHTTSSVVQSIFMVIL 368

Query: 360 IDSLFAIFYFAIG 372
           +DS+ A+F+  +G
Sbjct: 369 LDSVAALFFMEMG 381


>gi|152980330|ref|YP_001354931.1| ABC transport system permease protein [Janthinobacterium sp.
           Marseille]
 gi|151280407|gb|ABR88817.1| ABC transport system permease protein [Janthinobacterium sp.
           Marseille]
          Length = 374

 Score =  259 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 100/371 (26%), Positives = 177/371 (47%), Gaps = 13/371 (3%)

Query: 4   NGITVFRFAGNWKSPEI--SEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           N       AG+W+   +      D +   +    + D    DLS I  +D IGA+L+   
Sbjct: 14  NDQATVIAAGSWQVRALIDPGAMDKLTATLRGVRKVDETRWDLSGIEALDYIGAQLLWNA 73

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             K         ++   E  F  +  T   ++K     R + ++++           ++ 
Sbjct: 74  WGKKRPPQLT--LAPQHESFFQRLEQTGTLQVKRPPQHRWYTFSAYLQFK-------LRM 124

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            +       ++G ++ + G F       +G    +   +++ G   + +  L+ F+ G V
Sbjct: 125 ADHMLGFITLIGQLVMDMGRFIRQPQ--RGPWKEISANIFHTGYQALGITALVGFLIGVV 182

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   A QL QFG +IF ++++ +  +RE+G LL A+++AGRSGS+I A++G M++ EE+
Sbjct: 183 LSYLSAQQLHQFGGDIFLVNILGMSVIRELGPLLAAILVAGRSGSSITAQLGVMRVTEEL 242

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MGL     LI P++ AL IS+PLL +  +  A+IG          + F  F    
Sbjct: 243 DAMLVMGLPHGYRLIMPKVIALAISMPLLVVWTDAMALIGGMAAANVELGLSFKYFLREL 302

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                LAN + GL K       I +VA   G  +  ++ SLG+  T  VV +I++VI+ D
Sbjct: 303 PDAVPLANYWIGLGKGVVFGSLIALVACHFGLRIKPNTESLGEGTTISVVTAITVVILAD 362

Query: 362 SLFAIFYFAIG 372
           ++FAI +  +G
Sbjct: 363 AVFAIVFSGVG 373


>gi|254470335|ref|ZP_05083739.1| ABC transporter permease protein [Pseudovibrio sp. JE062]
 gi|211960646|gb|EEA95842.1| ABC transporter permease protein [Pseudovibrio sp. JE062]
          Length = 382

 Score =  259 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 136/372 (36%), Positives = 209/372 (56%), Gaps = 6/372 (1%)

Query: 2   SENGITVF-RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +E+G  +    +G W   +     ++++  +  S+      VDL A++ +DT GA L+  
Sbjct: 15  AEDGALLLLTASGAWGIRQ-GATCENLINQVAASLTHSVICVDLKAVSFLDTAGAWLLQR 73

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
           F  +   + +        E+   L+    R+++ N   + S   NSF N    +G+   +
Sbjct: 74  FQMEQAEQGREVKFLYEDERFDILLKEVDRQEVDNPTEEHSG--NSFLNYLEAVGEATRQ 131

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D+     +LG + +          + +    S+  Q     +  VP+V L+SF+ G 
Sbjct: 132 LGRDTRDILAMLGSLTATITAAATHPSRLRPI--SIGVQFQRSCMGAVPIVCLMSFLIGG 189

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           +IAQQG F L QFGAEIF +DL  IL LREIGV+LTA+M+AGRSGSA  AE+GSMK+ EE
Sbjct: 190 IIAQQGGFYLKQFGAEIFVVDLSGILVLREIGVILTAIMVAGRSGSAYTAELGSMKMQEE 249

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA++  GL    +LI PR+ AL+I+LP+L  LAN +A+ GA +  W Y  I    F ++
Sbjct: 250 IDALQVTGLRVTEVLILPRLVALMIALPILVFLANIAALFGAGLTCWWYLGIVPHSFIAQ 309

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +  T+  +  G++KAPFMA  IG++A  EG  V   S SLG+  T  VV+SI +VI++
Sbjct: 310 LQAAVTVDTLMVGIVKAPFMALIIGLIACMEGMKVEGSSESLGRHTTVSVVKSIFMVIVV 369

Query: 361 DSLFAIFYFAIG 372
           D +FA+F+ +IG
Sbjct: 370 DGVFAVFFASIG 381


>gi|153209306|ref|ZP_01947341.1| ABC transporter, permease protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212219048|ref|YP_002305835.1| ABC transporter permease protein [Coxiella burnetii CbuK_Q154]
 gi|120575422|gb|EAX32046.1| ABC transporter, permease protein [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212013310|gb|ACJ20690.1| ABC transporter permease protein [Coxiella burnetii CbuK_Q154]
          Length = 377

 Score =  259 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 113/368 (30%), Positives = 188/368 (51%), Gaps = 13/368 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAEL---IMYFMEKY 65
               G+W    +S + D + +   K   S+  I+    I ++D+ GA L   ++  ++  
Sbjct: 20  LFCLGDWTVSHLSPLEDQLPLYAEKL--SEKVIIHADKIIKMDSAGALLFYTLINHLKSL 77

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
              I++ G+S + + L  LI    +   +     ++        + Y +G+  V      
Sbjct: 78  GKAIEITGLSENAQSLLKLIGNESKFLRQPLPSSKTP------GVVYLLGEWAVTKWRVL 131

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +G V +  G+        +    +++R +   G   +P+V L+SF+ G V+  Q
Sbjct: 132 IDFLTFVGEVATTAGQGILKPQ--RIQWRAILRAIEETGYQALPIVALLSFLVGVVLTYQ 189

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  + A+IF +D+     LRE G L+TA++ AGR+ +A  A+IG+MK+NEEIDA+ 
Sbjct: 190 IALQLDSYNADIFVVDITGAAILREFGPLITAIIAAGRTSTAFTAQIGTMKVNEEIDALN 249

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG+  +  L+ P+I ALIISL LLT+ A+     G+ I+     DI +  F  RFH   
Sbjct: 250 TMGVVPIEHLVLPKIIALIISLTLLTVWADIFGTFGSMIMAKSQLDIGYLAFLDRFHHAI 309

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GLIKAP     I  V   +GF VG  ++S+G+K T   VQSI ++II D++F+
Sbjct: 310 AVRHYIAGLIKAPVFGLIIATVGCFQGFQVGASADSVGQKTTQSAVQSIFLIIIADAIFS 369

Query: 366 IFYFAIGI 373
           + +   GI
Sbjct: 370 VIFSLRGI 377


>gi|84516868|ref|ZP_01004226.1| ABC transporter, inner membrane subunit [Loktanella vestfoldensis
           SKA53]
 gi|84509336|gb|EAQ05795.1| ABC transporter, inner membrane subunit [Loktanella vestfoldensis
           SKA53]
          Length = 380

 Score =  259 bits (663), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 123/373 (32%), Positives = 198/373 (53%), Gaps = 13/373 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++        G         +  DV+       +    +VD++ ++ +DT GA  ++   
Sbjct: 19  DSDGARLSVQGRLTIDSFEHLDRDVIAQQASRAE----VVDIAQLSHMDTAGAWFLLDLA 74

Query: 63  EK--YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
            +        + G S     L   +      K    KP          +    +G+++  
Sbjct: 75  GRTSAGAASVITGASDAQTLLIEAVRTNLPPKAAGAKPAV-----RLVDHFETLGRRVAL 129

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
             + +      LG VI+            +  L S++     VG+  VP+V L++F+ G 
Sbjct: 130 AGSHALEMLSFLGQVIAAMARVIRHPRALR--LTSVVHHCQQVGLQAVPIVALMAFLIGV 187

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A QG+ QL QFGAE+F +DL++I  LRE+G+LLTA+++AGRSGSA  A IGSMK+ EE
Sbjct: 188 VLAFQGSAQLRQFGAEVFVVDLIAISILRELGILLTAIIVAGRSGSAFTAAIGSMKMREE 247

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RT+GLD V IL+ PR+ AL++ LP L ++AN S + G +++ W   D+  AVF +R
Sbjct: 248 IDAMRTLGLDPVAILVVPRVLALVLMLPALGLIANVSGLFGGALMSWIELDVSPAVFQAR 307

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             S   + +   G+IKAP  A  IGI+   +G  VG  + SLG++ +  VV +I +VI+ 
Sbjct: 308 LVSNTDVWHFNVGMIKAPVFALIIGIIGCYQGMKVGGDAESLGRQTSASVVMAIFMVIVA 367

Query: 361 DSLFAIFYFAIGI 373
           D+LF+IF+  +G+
Sbjct: 368 DALFSIFFAIVGV 380


>gi|222823161|ref|YP_002574734.1| ABC transporter permease (DUF140 domain protein) [Campylobacter
           lari RM2100]
 gi|222538382|gb|ACM63483.1| putative ABC transporter, permease protein (DUF140 domain protein)
           [Campylobacter lari RM2100]
          Length = 370

 Score =  259 bits (662), Expect = 4e-67,   Method: Composition-based stats.
 Identities = 107/369 (28%), Positives = 185/369 (50%), Gaps = 16/369 (4%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGA---ELIMYFME 63
            +F   G W    + ++               + I D + +  IDT G      +   ++
Sbjct: 14  CIFSVFGIWDKTSVGKLEK------LDFPTQKNIIFDFTNLDFIDTAGIRYFLALENELK 67

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +   ++    + +   +LF L    ++    + + +      + K+   ++GKK+V+   
Sbjct: 68  QKGFELSRVNLKSEHAKLFELCQKHYKSFCDSYEDK-----KTIKDFFENLGKKVVESFT 122

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                 + +GL+I+          K +    + +  +    ++ +P+++L S + G V+A
Sbjct: 123 LLVQFLNFIGLIIATCFNTLFHLKKLR--FRAFLYHVENSAINALPIIMLTSLLVGVVLA 180

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            Q A+QL+QFGA I+ +DLM I   RE+  L++A++IAGRS S+  A+IG MK+ +EIDA
Sbjct: 181 YQAAYQLAQFGANIYIVDLMGISATRELAPLISAIVIAGRSASSYTAQIGVMKLTDEIDA 240

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++TMG      +I PR+ AL +++PL+ I+A+  +IIG  IV W   +I  + F SRF  
Sbjct: 241 MKTMGFKESEFIILPRVLALALAMPLVVIVADILSIIGGIIVAWFSLEISASEFMSRFKE 300

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              L +I  GLIKAP     I  +A   GF V   + S+G   T  VV +I  VI  D++
Sbjct: 301 AVELKHIIIGLIKAPIFGFLIASIACFRGFFVQKTTESIGVYTTKSVVNAIFWVIAFDAI 360

Query: 364 FAIFYFAIG 372
           F++F    G
Sbjct: 361 FSVFLTKAG 369


>gi|159044594|ref|YP_001533388.1| hypothetical protein Dshi_2050 [Dinoroseobacter shibae DFL 12]
 gi|157912354|gb|ABV93787.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 384

 Score =  259 bits (662), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 126/374 (33%), Positives = 209/374 (55%), Gaps = 15/374 (4%)

Query: 1   MSENGITVF-RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           +S++   V    +G+     ++++   +         + S  +DLS I  IDT GA L+ 
Sbjct: 25  LSQDEAGVAGALSGDLTIYGVADLQRQLAAR-----PAGSLTLDLSGIGRIDTAGAWLLA 79

Query: 60  YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
                    ++L G    + +L + +      K + + P+R+    +  +    +G+++V
Sbjct: 80  ELAR--GEGVRLVGAPDKVARLIANV-----AKAEPEHPERTETPPTLTDRLERLGRQVV 132

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +          +LGLV++  G       +F+    +L+     VG+  VP+V L++F+ G
Sbjct: 133 EGTKFLGGLTGMLGLVLARFGRALRHPREFRM--TALVHHCEEVGLRAVPIVALMAFLIG 190

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A QGA QL QFGAE+F +DL+SI  LRE+G+LLTA+++AGR+ S+  A IGSMK+ E
Sbjct: 191 IVLAFQGASQLRQFGAEVFVVDLISISILRELGILLTAIIVAGRTASSFTAAIGSMKMRE 250

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+RT+GLD   +L  PR+ AL+I LP+L ++AN S ++G +++ W    I  A+F +
Sbjct: 251 EIDAMRTLGLDPAMLLFLPRVLALLIMLPILGLIANLSGLLGGALMSWIELGISPAMFQT 310

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R      + +   GL+KAPF A  IG+V    G  V  ++ SLG+  +  VV +I  VI+
Sbjct: 311 RLIEGTDINHAVVGLVKAPFFAILIGVVGCHAGMQVEGNAESLGRMTSGAVVTAIFAVIV 370

Query: 360 IDSLFAIFYFAIGI 373
            D+ F+IF+  +GI
Sbjct: 371 TDAAFSIFFAQMGI 384


>gi|107102741|ref|ZP_01366659.1| hypothetical protein PaerPA_01003808 [Pseudomonas aeruginosa PACS2]
          Length = 372

 Score =  259 bits (661), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 114/366 (31%), Positives = 185/366 (50%), Gaps = 4/366 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G+W     + +  +V     +S  + +A  DLS +  +DT GA L+   +    
Sbjct: 10  ARVRAIGDWTLAHYTALEREVTRL--RSEVAANASFDLSQLGALDTAGAALLAELLGAER 67

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                +       +  +L+           +P++     +   L   IG  +  F     
Sbjct: 68  LADLAELEPGLPRERQALLKTVGHALHDFCEPEKPKPPTTAIELLARIGCAMETFWLHLK 127

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +GL +            ++     L+  +   G+  VP++ L++F+ GAVIA  G
Sbjct: 128 ALLGFIGLTLETLFRSLVRPASWRV--TPLVANIEKSGLDAVPIIALLTFLVGAVIAFLG 185

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA I++++L+    LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIR 
Sbjct: 186 ATVLANFGATIYTVNLVVFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRA 245

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PR+ AL++SLP+LT +     I+G   V     DIP A+F S       
Sbjct: 246 LGLNPIELLVLPRVLALLVSLPMLTFVGMLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIG 305

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   G+ KAP  A  I ++   EGF V   + S+G+  TT VV SI +VI++D+L A+
Sbjct: 306 VQHFLVGISKAPLFAFLIAVIGCLEGFKVSGSAQSVGEHTTTSVVHSIFVVILLDALAAL 365

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 366 FFMEMG 371


>gi|170748370|ref|YP_001754630.1| hypothetical protein Mrad2831_1952 [Methylobacterium radiotolerans
           JCM 2831]
 gi|170654892|gb|ACB23947.1| protein of unknown function DUF140 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 384

 Score =  259 bits (661), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 134/371 (36%), Positives = 210/371 (56%), Gaps = 8/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +G       G W + + +   +     I  + ++    VDLS I  +DT+GA ++   
Sbjct: 21  SADGR--LALDGRWTADQ-APTVEAAAARIAAAGRAGPVAVDLSGIERLDTLGAWVLERT 77

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +               +   L+     ++     P+    +     L    G++ V+ 
Sbjct: 78  RAEIEQAGSALTYLGARPEHRILLGEVRLREPDAPPPR---RHGPVVGLLDATGRRTVQG 134

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +    LG +I+  G        F+G   +LI Q+  V ++G P+++LISF+ G +
Sbjct: 135 GHEFVTALAFLGELIAACGRVALRPGTFRGN--ALINQIQQVALNGTPIIVLISFLVGGI 192

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +AQQG FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSAI AEIGSM++ EE+
Sbjct: 193 VAQQGIFQLQRFGAQTFVVNLIGLLILREMGVLLTSIMVAGRSGSAITAEIGSMRMREEV 252

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R MGLD V ILI PR+ AL+I LP+LT++ + +A+ G  +    Y  +    F  R 
Sbjct: 253 DALRVMGLDPVEILIVPRVLALMIGLPMLTLIGDLAALAGGGLTAMLYGGLTLDQFLVRL 312

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            +   + ++  GLIKAPFMA  IG++A  EGFAV   + SLG+ VT  VV+SI +VI++D
Sbjct: 313 QAAVGVHHVMVGLIKAPFMALTIGVIATIEGFAVEGSAESLGRHVTASVVKSIFMVIVLD 372

Query: 362 SLFAIFYFAIG 372
            LFA+F+ AI 
Sbjct: 373 GLFAVFFAAID 383


>gi|220924819|ref|YP_002500121.1| hypothetical protein Mnod_4961 [Methylobacterium nodulans ORS 2060]
 gi|219949426|gb|ACL59818.1| protein of unknown function DUF140 [Methylobacterium nodulans ORS
           2060]
          Length = 386

 Score =  258 bits (660), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 124/370 (33%), Positives = 204/370 (55%), Gaps = 4/370 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +     R +G W + +   +             +    +DLS ++ +DT+GA ++     
Sbjct: 21  SDGVQARLSGRWTADQAPAVEAAAAGIAASPAGAGRIQIDLSGLSRLDTLGAWVLERTRS 80

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +     +    +    +   L+     ++ +    +R        +L   +G  + +   
Sbjct: 81  EIAAAGRAVEYAGARPEHRILLREVAYREPETAPARRRGLGP--VDLLAGLGAGMRQLGA 138

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +  S    LG V++      A    F+    + + QM  + + G P+++LI+F+ G ++ 
Sbjct: 139 EGLSWLGFLGEVVAACLRVLARPRSFRR--AAFVNQMEQIALRGTPIIMLIAFLVGCIVT 196

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG  QL +FGA+ F ++++ IL LRE+GVLLTA+M+AGRSGSA  AEIGSM++ EE+DA
Sbjct: 197 QQGIIQLQRFGAQSFVVNMIGILTLRELGVLLTAIMVAGRSGSAFTAEIGSMRMREEVDA 256

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MGLD + ILI PRI AL+++LP+L  LA+ +A+ G ++    Y ++    F +R  +
Sbjct: 257 LRVMGLDPIEILIVPRILALMMALPMLGFLADLAALAGGALTSLAYGNLSLDAFLARLQN 316

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +  +   GLIKAPFMA  IGI+A  EGF V   + SLG+ VT  VV+SI +VI++D +
Sbjct: 317 AVSYRHALVGLIKAPFMALIIGIIATSEGFRVEGSAESLGRHVTASVVKSIFMVIVLDGV 376

Query: 364 FAIFYFAIGI 373
           FAIF+ AI +
Sbjct: 377 FAIFFAAIDL 386


>gi|157736379|ref|YP_001489062.1| ABC transporter, permease protein [Arcobacter butzleri RM4018]
 gi|157698233|gb|ABV66393.1| ABC transporter, permease protein [Arcobacter butzleri RM4018]
          Length = 370

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 107/365 (29%), Positives = 182/365 (49%), Gaps = 12/365 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
                 W    +  I   +   +    ++    +D + + E D+     ++ F+  +  K
Sbjct: 18  LTLLNIWNKQTLPNIIKKIE--LLNFSKNSKLNIDFANLKECDSSAIIYLISFLNTFEEK 75

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                 + + E++F      ++ K+  ++ +  FF          +GKK      +S   
Sbjct: 76  NITILNNKNHEKIFDFYKKHYQTKVLEEEKKNLFF--------EDLGKKSYDIYKESKEF 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G V         +  K +    ++++ +       + +V + SF+ G VIA QG+ 
Sbjct: 128 IGFIGKVFYFFIYAIFNPSKIR--FKAMLKYIETSAFDALLIVAVTSFLVGVVIAYQGSV 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL +FGA IF ++++SI   REI  L+TA++IAGRS S+  AEIG+MKI EEIDA++TM 
Sbjct: 186 QLEKFGANIFIVEMISITIFREIAPLVTAIVIAGRSASSYTAEIGAMKITEEIDAMKTMN 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
            +    L  PRI+AL ISLPLL   A+   + G  ++     D+ F  F +R H+   L 
Sbjct: 246 FEPTLFLTLPRIFALCISLPLLVFFADIIGVFGGMVIASSSLDVTFIEFINRLHNEVPLK 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  G+ KA F   AI I+    GF V  ++ S+GK  T  VV +I +VI+ID++F++ +
Sbjct: 306 HLILGVFKALFFGFAIAIIGCYRGFQVQNNTTSIGKFTTMSVVNAIFVVILIDAVFSVIF 365

Query: 369 FAIGI 373
             +GI
Sbjct: 366 TQMGI 370


>gi|254292866|ref|YP_003058889.1| hypothetical protein Hbal_0490 [Hirschia baltica ATCC 49814]
 gi|254041397|gb|ACT58192.1| protein of unknown function DUF140 [Hirschia baltica ATCC 49814]
          Length = 380

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 111/370 (30%), Positives = 197/370 (53%), Gaps = 6/370 (1%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G  V    G W +  +  I   +    +K + S    +D+S + + DT GA ++   + +
Sbjct: 16  GDPVMVLEGAWTAFTVGAIDKPLRQLTSKDV-SKDVSLDVSQLEDFDTAGAYVVDRTLRQ 74

Query: 65  YHGK-IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                  L  +      + SL++  +    K +  +++   + F  L   +G   V  + 
Sbjct: 75  LGAPSGSLAKIVGDTHSVISLLTAVN--AAKPEPVKKAKDRHGFTQLLDRVGHGTVDALK 132

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +       +G   +       +  K +    S++  M   G++ +P+V ++SF  G VIA
Sbjct: 133 EGWGILEFIGEAFTTVFFLLLNPKKIR--WTSVVAIMEEAGLNALPIVSMLSFFIGIVIA 190

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G   L  FGA++F+++++  L LRE G++LTA+++AGR+ S+  AEIG+MK+ EE+DA
Sbjct: 191 FLGVNLLQSFGAQVFTVEMVGFLMLREFGLVLTAILLAGRTDSSFTAEIGAMKMREEVDA 250

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MGL+ + +L++PR+ AL++  P L+  A  S ++G  +V+W   DI  A+F  R   
Sbjct: 251 MRVMGLNPMEVLVAPRLIALLVMTPFLSFFAMISGLVGGLLVMWGVMDISPAMFIQRIQD 310

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           T    N + G++KAP  A  I +V  ++G  V     SLG++ T+ VVQ+I +VI+ID++
Sbjct: 311 TVPGQNFWVGIVKAPVFATVIALVGCRQGLLVSGDVQSLGQRTTSSVVQAIFLVIVIDAI 370

Query: 364 FAIFYFAIGI 373
           FAI Y  +G+
Sbjct: 371 FAILYMEMGL 380


>gi|78067712|ref|YP_370481.1| ABC transporter, inner membrane subunit [Burkholderia sp. 383]
 gi|77968457|gb|ABB09837.1| ABC transporter, inner membrane subunit [Burkholderia sp. 383]
          Length = 374

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 100/366 (27%), Positives = 171/366 (46%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   +        +  DLS I  +D +G + +     +   
Sbjct: 19  TVRLYGQWTALALARNRGAVARRVASIASGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                 V+       ++     R   + + P+R   ++    L    G+ I  F      
Sbjct: 79  PGVALSVTQ-----RTIFERIERLDSEREAPERVVRFDPVTRL----GQAIFGFGEHLQG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + GLVI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGLVILDALSVLRRPKTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL I++PLL +  N  A+ G ++       I    F         +
Sbjct: 248 GIPHGLRLILPRVLALGIAMPLLVMWTNIVALTGGALAAKLVLGIDVNYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGVGKGIVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|206559095|ref|YP_002229855.1| hypothetical protein BCAL0697 [Burkholderia cenocepacia J2315]
 gi|198035132|emb|CAR51006.1| putative membrane protein [Burkholderia cenocepacia J2315]
          Length = 374

 Score =  258 bits (660), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 99/366 (27%), Positives = 169/366 (46%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   +        +  DLS I  +D +G + +     +   
Sbjct: 19  TVRLTGQWTALALARNRGAVARRVASIATGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R    +    L    G+ I  F      
Sbjct: 79  AGVALSATQ-----RTIFERIERLDSEREAPERVVRVDPVTRL----GQAIFSFGEHLQG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + GLVI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGLVILDALSVLRRPQTMP--WRETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     L+ PR+ AL +++PLL +  N  A+ G +I       I    F         +
Sbjct: 248 GIPHGLRLVLPRVLALGVAMPLLVMWTNIIALTGGAIAAKFVLGIDVNYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|77463402|ref|YP_352906.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           2.4.1]
 gi|77387820|gb|ABA79005.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           2.4.1]
          Length = 366

 Score =  258 bits (660), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 108/363 (29%), Positives = 191/363 (52%), Gaps = 9/363 (2%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
             G      + E    +              +D++A+  +DT GA  ++   ++     +
Sbjct: 13  LRGRLTIETLPETQRSLGSVGAGE------QIDMAAVEALDTAGAWALLQAQKRAEAAGQ 66

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
              +    E    L+       +   + +R        +   ++G+++ + +  S +   
Sbjct: 67  ALEIVNLSESHRHLLETV-AAAMPEPERRRRTIPGRPDDGLANLGQEVAQGLRGSLTSVG 125

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
             G V+++ G       + K  L  L+  M   G + VP+V L+ F+ G V+A QG+ QL
Sbjct: 126 FFGEVVTHLGALVLHPTRLK--LTPLVHHMQEAGWNAVPIVSLMGFLIGIVLAFQGSTQL 183

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
             FGAE++ +DL++I  LRE+G+LLTA+++AGRS SA  A IGSMK+ EEIDA+R +GLD
Sbjct: 184 KSFGAEVYVVDLVAISILRELGILLTAIIVAGRSASAFTAAIGSMKMREEIDAMRVLGLD 243

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
            +  L+ PR+ AL+I LP L  +A+ + ++G  ++ W    I   +F ++  +   +++ 
Sbjct: 244 PIDRLVLPRLIALVILLPALGFIASLAGLVGGGLMAWIDLGITPGMFRTQLLADTDVSHA 303

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             GL+KAPF A  I ++   +G  V  ++ SLG   +  VVQ+I +VI++D+LF+IF+  
Sbjct: 304 IIGLVKAPFFAVIIAVIGCHQGMQVSGNAESLGSHTSRSVVQAIFLVIVVDALFSIFFAV 363

Query: 371 IGI 373
            G+
Sbjct: 364 WGL 366


>gi|91786141|ref|YP_547093.1| hypothetical protein Bpro_0230 [Polaromonas sp. JS666]
 gi|91695366|gb|ABE42195.1| protein of unknown function DUF140 [Polaromonas sp. JS666]
          Length = 383

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 88/363 (24%), Positives = 174/363 (47%), Gaps = 11/363 (3%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
             G      ++   + +      + ++ +   DLS + ++D +GA+++     +      
Sbjct: 32  LTGRLVWDTLTAQLEILRRHAAPAGEASTVRWDLSGLEKLDHLGAQVLWNHWGRDW---- 87

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
                    Q+            K          + +K+L   +G + +  ++ S     
Sbjct: 88  -----PAQLQVEPSQRAVLETVAKFAVVPPKPRGSDWKDLLVLLGNRALDLVDHSKGLVR 142

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
           ++G ++ +         +       L   +Y++G + +P+  L+ F+ G V+A   + QL
Sbjct: 143 LVGQLLLDIIRLVRHPKEGP--WRDLSGHLYHIGATALPITALVGFLIGVVLAYLISQQL 200

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
            QFGA+ + ++++ I  +RE+G +L A++IAGRSGSAI A+IG M++ EE+DA+R MG+ 
Sbjct: 201 RQFGADAYIVNILGISLIRELGPVLAAILIAGRSGSAITAQIGVMRVTEELDAMRVMGIA 260

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
               L+ PR  AL + +PL+++    +A++G  +       +  + F +        AN+
Sbjct: 261 RGFRLVMPRALALAVVMPLISVWTTIAALLGGMLAADISMGVTPSYFINSLPRAVDAANL 320

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
                K+      I +V    G  V  ++ SLG+  T  VV SI++VI++D+LFA+ + +
Sbjct: 321 TLATGKSVVFGVLIAMVGCHYGLRVKPNTESLGQGTTASVVTSITVVILVDALFAVVFKS 380

Query: 371 IGI 373
           +GI
Sbjct: 381 VGI 383


>gi|260219765|emb|CBA26623.1| hypothetical protein Csp_H39530 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 387

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 91/378 (24%), Positives = 181/378 (47%), Gaps = 16/378 (4%)

Query: 1   MSEN-GITVFRFAGNWKSPEISE--IADDVVMAINKSIQ--SDSAIVDLSAITEIDTIGA 55
           ++++         G W +  +S   +   +  A+       + +   DL     ID  GA
Sbjct: 21  LAQDPEGPRVILRGRWTADALSAKHVWQPLEKALQGVPGNGAPAVAWDLREAQRIDHTGA 80

Query: 56  ELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIG 115
           +++     +               Q   L      +  K   P        +  L   +G
Sbjct: 81  QVLWNAWGRQWPAKL---------QAEPLQKALLDRVAKFTVPTPPVERLDWHALLVSLG 131

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           +K+ +  +       ++G ++ +  +      +       +   +Y +G + +P+  L+ 
Sbjct: 132 RKLARVESHLGGMVRLIGQLMLDVLQLLRHPLQGP--WRDVSGHLYRIGATALPITALVG 189

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
           F+ G V+A   + QL Q+GA+ F ++++ +  +RE+G +L A+++AGRSGSAI A+IG M
Sbjct: 190 FLIGVVLAYLMSKQLRQYGADSFIVNILGMSLIRELGPVLAAILVAGRSGSAITAQIGVM 249

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ EE+DA+R MG+     L+ PR  A+ I++PL+ +    +A++G  +       +  A
Sbjct: 250 RVTEELDAMRVMGIPKGFRLVMPRTLAMAIAMPLVAVWTTMAALLGGMLASDLSMGLTPA 309

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            FF+    T  ++N++  L+K+      I ++A   G  V   + SLG+  T  VV SI+
Sbjct: 310 YFFTALPKTVEISNLWLSLVKSCVFGVLISLLACHHGLRVKPDTQSLGEGTTASVVSSIT 369

Query: 356 IVIIIDSLFAIFYFAIGI 373
           +VI++D+LFA+ + ++G+
Sbjct: 370 MVILVDALFAVIFKSVGL 387


>gi|238028752|ref|YP_002912983.1| hypothetical protein bglu_1g32160 [Burkholderia glumae BGR1]
 gi|237877946|gb|ACR30279.1| Hypothetical protein bglu_1g32160 [Burkholderia glumae BGR1]
          Length = 390

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 102/386 (26%), Positives = 178/386 (46%), Gaps = 27/386 (6%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAI----------------VDLSAI 47
           +G  + R +G W +  ++     VV    K  +   A                  DLSAI
Sbjct: 15  DGGKIVRLSGQWTALALARDRGVVVRRAEKLARGQVARGRRSREPAAADGPARRWDLSAI 74

Query: 48  TEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSF 107
             +D +G + +       H       ++ +   +F  I      +   +   R       
Sbjct: 75  ERLDHVGGQALWRVWG--HRLPDGVVLTDNQRIVFERIERLDEAREAPEPVVR------- 125

Query: 108 KNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSG 167
            +    +G  + +F         + G VI + G               +   +Y  G   
Sbjct: 126 HDPVTRLGLAMFQFGEHLFGGVAMFGRVILDLGAIARRPKTMP--WTEISANVYNAGAKA 183

Query: 168 VPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSA 227
           +P+  L++F+ G V++   A QL QFGA  + ++++ +  +RE+G +L+A+++AGRSGSA
Sbjct: 184 LPITALVAFLIGIVLSYLSAQQLQQFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSA 243

Query: 228 IVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIW 287
           I A+IG M++ EE+DA+R MG+     ++ PR+ AL +++PLL +  N  A+ G ++   
Sbjct: 244 ITAQIGVMRVTEELDAMRVMGIPHGLRIVLPRVLALGVAMPLLVMWTNIVALSGGALAAK 303

Query: 288 KYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVT 347
               I F  F         +AN++ GL K       I +V    GF +  +S SLG+  T
Sbjct: 304 FALGIDFNFFMRSLPGVVPIANLWIGLGKGVVFGMLIALVGCHFGFRIKANSQSLGEGTT 363

Query: 348 TCVVQSISIVIIIDSLFAIFYFAIGI 373
           T VV SI++VI+ D++FAI +  +G+
Sbjct: 364 TSVVSSITVVILADAVFAILFQNVGL 389


>gi|146280488|ref|YP_001170641.1| ABC transporter permease [Pseudomonas stutzeri A1501]
 gi|145568693|gb|ABP77799.1| probable permease of ABC transporter [Pseudomonas stutzeri A1501]
          Length = 362

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 112/363 (30%), Positives = 187/363 (51%), Gaps = 5/363 (1%)

Query: 10  RFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
           R  G+W     + +  +V     ++   + + ++LS +  +DT GA L+   +       
Sbjct: 4   RIVGDWTLAHYAALRREVQRL--RARIDERSQIELSGLGALDTAGAGLLAELLGPERIAA 61

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
                     +  +L+       +       S     F  +  HIG+ +        +  
Sbjct: 62  IEAWAPQLPAERLALLRTVATA-LDQPDAAESPRGYEFGYVLAHIGRTVAAVWKQQRALL 120

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
             +GL +           +++  L SL   +   G+  VP+V L++F+ GAV+A  GA  
Sbjct: 121 GFIGLTLQTLLLTLPRPRRWR--LTSLAVHIEQTGLDAVPIVALLTFLVGAVVAFLGATV 178

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L+ FGA I++++L+    LRE GVLL A+++AGRS SA  A+IGSMK NEEIDAIRT+GL
Sbjct: 179 LADFGATIYTVNLVGFSFLREFGVLLAAILLAGRSASAFAAQIGSMKSNEEIDAIRTLGL 238

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
             + +L+ PR+ A++I+LP+LT +   S I G  +V     DI   +FF+       +++
Sbjct: 239 SPIELLVLPRVLAMLITLPILTFVGMLSGIAGGLVVCVLALDISPTMFFNIMARDIAVSH 298

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
              GL KAP  A  I ++   EGF V   + S+G+  T+ VVQ+I +VI++D++ A+F+ 
Sbjct: 299 FLVGLGKAPVFAFVIAVIGCLEGFKVTGSAQSVGEHTTSSVVQAIFMVILLDAIAALFFM 358

Query: 370 AIG 372
            +G
Sbjct: 359 EMG 361


>gi|190892035|ref|YP_001978577.1| probable ABC transporter, permease protein [Rhizobium etli CIAT
           652]
 gi|190697314|gb|ACE91399.1| probable ABC transporter, permease protein [Rhizobium etli CIAT
           652]
          Length = 389

 Score =  258 bits (659), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 153/370 (41%), Positives = 227/370 (61%), Gaps = 5/370 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S+      R +GNW+S  +  +  D    +++  ++ +  VDLS IT+IDT G  L+   
Sbjct: 23  SDGSGQHVRLSGNWRSAYVHLVLRDFEKLLHQ--KTGNLTVDLSEITDIDTAGIWLLCRL 80

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +          +  +++    ++    +P+     +    +   IGK     
Sbjct: 81  KKEEEAAGRTVRFEGTNPHIDEMLAM-FSEEPAKPEPEPKEKVSLAARILAPIGKMTYDV 139

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +  +ILG  +                  S++ Q+ ++GV  VP+++L+SF+ GA+
Sbjct: 140 WDNLAAAMYILGSAVRGAQMKFGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSFLIGAI 197

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 198 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEI 257

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA++V W Y  I FA F +R 
Sbjct: 258 DALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAVVAWGYSGITFANFLARL 317

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D
Sbjct: 318 HEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKAIFVVILMD 377

Query: 362 SLFAIFYFAI 371
            LFA+FY AI
Sbjct: 378 GLFAMFYAAI 387


>gi|239831972|ref|ZP_04680301.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
 gi|239824239|gb|EEQ95807.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301]
          Length = 391

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 150/368 (40%), Positives = 214/368 (58%), Gaps = 3/368 (0%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +G+   R  G W S  +  + DD V  +  + + ++ I+D+S ++ +DT GA LI    +
Sbjct: 25  DGVRHIRMNGRWVSQSV-NLVDDKVRRLENADKREATIIDISGVSGLDTAGAWLIERLRQ 83

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +   +     +    +    L+    +   +     R        +    +G  +V   +
Sbjct: 84  RLVAQQVEVQLEGVRQSWLPLMEEVGQAVERTLDIPRQKKPFFLISFLAALGGGVVSLGS 143

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D     HILG  I                  +++ QM  +GV  +P++IL+S + GA+IA
Sbjct: 144 DFKMAMHILGATIRGAQ--LKYGRGSGIPFAAIVTQMDRMGVGAIPIIILMSTIVGAIIA 201

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE DA
Sbjct: 202 QQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETDA 261

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  +GL+ V +L+ PR+ AL+I LPLLTI+++ +A+IGA  V W Y +I    F SR H 
Sbjct: 262 LTVIGLNPVGVLVFPRLVALVIVLPLLTIVSDLAALIGAGGVAWFYSNISPDAFISRLHD 321

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D L
Sbjct: 322 AVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDGL 381

Query: 364 FAIFYFAI 371
           FA+FY AI
Sbjct: 382 FAMFYAAI 389


>gi|295690462|ref|YP_003594155.1| hypothetical protein Cseg_3097 [Caulobacter segnis ATCC 21756]
 gi|295432365|gb|ADG11537.1| protein of unknown function DUF140 [Caulobacter segnis ATCC 21756]
          Length = 386

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 107/371 (28%), Positives = 195/371 (52%), Gaps = 11/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G      +G+W +  + +    +  A++     D+   DL+ +   DT GA  I+   
Sbjct: 27  QDGRPTAVLSGDWTARGLFDAGLRLAEALDGV---DNPTFDLTGVNRCDTAGAYAILRAA 83

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K +       + +L  L++   +      K + +   + F+ L   IG+ +    
Sbjct: 84  DE-RLKPEDVKARHGVVRLLQLVAAAIQV-----KSEPAVRPSGFRALLERIGRGVFGLF 137

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +D+ S    LG +++  G       + +     ++      G+  +P+V   +F  GAV+
Sbjct: 138 SDAFSTMAFLGHLLTAVGRSIVDPRRIR--WAPIVALCERAGLDAMPIVATTTFFIGAVV 195

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L+ FGA+++S++L+ I  +RE  +L+TA+++AGRS S+  AEIGSMK+N+EID
Sbjct: 196 ALLGANMLTDFGAQVYSVELIGISVMREFNILITAILLAGRSASSFAAEIGSMKMNQEID 255

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MG+D    L+ PR  AL++++P+LT +A  + + G  +V+W   D+    F  R  
Sbjct: 256 AMQVMGVDPYEALVLPRFAALLLTIPILTFVATIAGLAGGILVVWIVLDLSPNFFLQRIV 315

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                 + + GL KAP MA  I  +  ++G  VG    +LG++VT  VV +I  +I+ID+
Sbjct: 316 DYVGPTHFWIGLSKAPVMAAVIAAIGCRQGMEVGQDVEALGRRVTAAVVHAIFAIILIDA 375

Query: 363 LFAIFYFAIGI 373
           +FA+ Y  + I
Sbjct: 376 VFALIYMELDI 386


>gi|297538919|ref|YP_003674688.1| hypothetical protein M301_1733 [Methylotenera sp. 301]
 gi|297258266|gb|ADI30111.1| protein of unknown function DUF140 [Methylotenera sp. 301]
          Length = 378

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 99/365 (27%), Positives = 174/365 (47%), Gaps = 5/365 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G W +  +  I + +      +    + + D S +  +D  GA ++         +
Sbjct: 19  LTLSGAWVASTLHNIVEKI--HAIPTTIELNIVADGSGVEALDMSGAWVMQSLFSLLKAQ 76

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +     +    +     +   +  PQ +        L  HIG    + + ++   
Sbjct: 77  GNSITLIGFKPEFVERLKVVTYEFSHHANPQNNIEIKPPT-LLEHIGMATTEALKEAKDL 135

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G V S      A   + +     ++  +   G++ VP+V +++F+ G V+A Q A 
Sbjct: 136 LSFVGEVSSVFLASFADPQRIR--WRPILFNIREAGLNAVPIVGILAFLLGVVVAYQSAD 193

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL  +GA IF +DL+ I  LRE   L+ A++IAGRSGSA  A+IG+M + EEIDA+R +G
Sbjct: 194 QLRHYGANIFVVDLIGISMLREFAPLIAAIIIAGRSGSAYAAQIGTMSVTEEIDAMRILG 253

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  + +L+ P++  L ISLPLLT+ A+   I G  +      D+ F  F  R      + 
Sbjct: 254 IAPMEMLVLPKLIGLAISLPLLTVWADMLGIFGGMLTASAQLDVSFVDFVGRLVKAVEMT 313

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
               GL KA   A  I ++   +GF     ++++G++ T  VVQSI +VI+ D+LF++ +
Sbjct: 314 TYTVGLGKAFVFAIIITMIGCFQGFRTKGGADNVGRQTTRSVVQSIFLVIVADALFSVLF 373

Query: 369 FAIGI 373
             + I
Sbjct: 374 SILKI 378


>gi|256828281|ref|YP_003157009.1| protein of unknown function DUF140 [Desulfomicrobium baculatum DSM
           4028]
 gi|256577457|gb|ACU88593.1| protein of unknown function DUF140 [Desulfomicrobium baculatum DSM
           4028]
          Length = 380

 Score =  257 bits (657), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 104/363 (28%), Positives = 176/363 (48%), Gaps = 14/363 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME---KY 65
               G        EI D +               DLS +T +D  GA +I+       K 
Sbjct: 24  LSLRGIIDLRTTPEIMDRLAQL--PLPLPRRIRADLSGVTRMDDCGALVILQLRRMAEKN 81

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
              +K+ G   H+++L   +            PQ      +  +     G K +   N +
Sbjct: 82  GCDLKMHGTPGHVQELLDFLRLDD-------PPQSVGIKRAKPDFMTRFGIKTLDVTNQA 134

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +    +G V+           + +  L   +  M  VGV  +P+V LISF+ G ++A  
Sbjct: 135 VTHVSFVGEVVVTLLSLLRHPDRLR--LGDTVLYMQRVGVDALPIVGLISFLLGLIMAFM 192

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL QFGA I+   L+++  +RE+G ++TA+++AGRSGSA  AEIG+MK++EE+DA+ 
Sbjct: 193 SAVQLQQFGANIYVASLVALAMVRELGPIMTAILVAGRSGSAFAAEIGTMKVSEEVDALV 252

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMG      L++P+I A ++ +PLL + +N  AI G  ++     D+    + ++  +T 
Sbjct: 253 TMGFKPAMFLVAPKIIASVLVVPLLAMYSNLFAIAGGLLIGVTTLDLTVNAYMAQTMNTL 312

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           ++ +I  GL K+   A  I  V   +G+ V   + S+G+  T+ VV  I +VI++DS+ A
Sbjct: 313 SIFDINWGLFKSAIFAVLIATVGCFKGYQVRGGAASVGQATTSAVVTGIFLVILVDSILA 372

Query: 366 IFY 368
           +  
Sbjct: 373 VIL 375


>gi|238796784|ref|ZP_04640289.1| ABC transporter, permease protein [Yersinia mollaretii ATCC 43969]
 gi|238719272|gb|EEQ11083.1| ABC transporter, permease protein [Yersinia mollaretii ATCC 43969]
          Length = 381

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 119/364 (32%), Positives = 186/364 (51%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +  +V+            I DL+ +  +DT GA L+   + +    
Sbjct: 21  VAARGDWVLAHYRALEPEVMQLRANLPSG--VIFDLNQLGALDTAGATLLALLLGEARVG 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      E+   L+    R          +     +  L  +IG+ +V    D  S 
Sbjct: 79  NLRELAPKLPEERRVLLETVSRVLPDLSPEPSTKAPPFWLELLSNIGRSMVNLWEDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFIGLTLEALLGTLFRPARWRM--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|327190640|gb|EGE57728.1| putative ABC transporter, permease protein [Rhizobium etli
           CNPAF512]
          Length = 383

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 153/370 (41%), Positives = 227/370 (61%), Gaps = 5/370 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S+      R +GNW+S  +  +  D    +++  ++ +  VDLS IT+IDT G  L+   
Sbjct: 17  SDGSGQHVRLSGNWRSAYVHLVLRDFEKLLHQ--KAGNLTVDLSEITDIDTAGIWLLCRL 74

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++     +          +  +++    ++    +P+     +    +   IGK     
Sbjct: 75  KKEEEAAGRTVRFEGTNPHIDEMLAM-FSEEPAKPEPEPKEKVSLAARILAPIGKMTYDV 133

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            ++  +  +ILG  +                  S++ Q+ ++GV  VP+++L+SF+ GA+
Sbjct: 134 WDNLAAAMYILGSAVRGAQMKFGRGSGVSP--ASIVNQIDHMGVRAVPIILLMSFLIGAI 191

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAE+F +DL+ ILQLREIGVLLT++MIAGRSGSAI AEIGSMK+ EEI
Sbjct: 192 IAQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTSIMIAGRSGSAITAEIGSMKMREEI 251

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ + +LI PR+ AL I+LPLLT+LANF+++ GA++V W Y  I FA F +R 
Sbjct: 252 DALKVMGLNPIGVLIFPRLVALTIALPLLTVLANFASLAGAAVVAWGYSGITFANFLARL 311

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           H   TL+ + +G+IKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV++I +VI++D
Sbjct: 312 HEAVTLSTVLSGMIKAPFMALVIGIVAAVEGLKVGGSAESLGQHVTASVVKAIFVVILMD 371

Query: 362 SLFAIFYFAI 371
            LFA+FY AI
Sbjct: 372 GLFAMFYAAI 381


>gi|82703102|ref|YP_412668.1| hypothetical protein Nmul_A1981 [Nitrosospira multiformis ATCC
           25196]
 gi|82411167|gb|ABB75276.1| Protein of unknown function DUF140 [Nitrosospira multiformis ATCC
           25196]
          Length = 378

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 90/370 (24%), Positives = 171/370 (46%), Gaps = 12/370 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +GI      GN     + E    +   +++   +     DL+ I  +D  GA L+     
Sbjct: 20  DGIPRVIVEGNCTLTALGERIRPIAAELSEYATAPEIRWDLTQIARMDDAGAVLLWRGWG 79

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
               +  L       E+LF  +  T     +    +              +GK +     
Sbjct: 80  NQRPRYLLV--RPEHERLFDRLEETWTPPSEAAPDRLWP--------IMVLGKAVFLLWE 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  ++G ++           +       +   +Y  G   + +  L+ F+ G V++
Sbjct: 130 HLVGLVILMGQLVLEIKYLAGRPSRIP--WREISANLYRTGAQALGITALVGFLIGVVLS 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              + QL  FGA +F ++++ I  +RE+G +L A+++AGRSGS++ A++G M++ EE+DA
Sbjct: 188 YLSSRQLQIFGAHVFIVNILGISVIRELGPMLAAILVAGRSGSSMTAQLGVMRVTEELDA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MG+     LI P++ AL +++PL+ +  +  A+IG   V      + +  F SR   
Sbjct: 248 LTVMGIPHSLRLILPKVIALGLAMPLVVLWTSAVALIGGMTVAELQLGLGYKFFLSRLPD 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              ++N++ GL K      AI +++   G  +  ++ SLG+  T  VV SI++VIIID++
Sbjct: 308 AVAVSNLWLGLGKGIVCGMAIALISCHFGLRIKSNTESLGEGTTNSVVTSITVVIIIDAI 367

Query: 364 FAIFYFAIGI 373
           FA+ +  +G+
Sbjct: 368 FAVIFSDVGL 377


>gi|154243867|ref|YP_001409440.1| hypothetical protein Xaut_5005 [Xanthobacter autotrophicus Py2]
 gi|154162989|gb|ABS70204.1| protein of unknown function DUF140 [Xanthobacter autotrophicus Py2]
          Length = 344

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 129/346 (37%), Positives = 193/346 (55%), Gaps = 7/346 (2%)

Query: 26  DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLI 85
                      +    V+LS IT +DT GA L+      +  +  +  VS+   +   L+
Sbjct: 4   RWDAVCAAHADAKVVSVNLSGITRMDTFGAILLERLCGAWEQEGSVPQVSSLDPRYQRLM 63

Query: 86  SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCAS 145
               R   +     R       + +   +G ++V    D     + +G V+S  G     
Sbjct: 64  QELERSDSRPHPQTRRS-----EGILERLGHEVVNTAKDGLDLLNFIGAVVSAMGRVAVR 118

Query: 146 SYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSI 205
              F+    S + Q+  VG   VP+++LI+F+ G++IAQQ  F   +FGA+IF +D++ +
Sbjct: 119 PRSFR--FTSTVAQLDRVGFRAVPIILLITFLVGSIIAQQSIFHFRRFGADIFVVDMVGV 176

Query: 206 LQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALII 265
           L LRE+GVL+ ++MIAGRSGSA  AE+GSM++ EE+DA++ MGLD + +L+ PRI ALII
Sbjct: 177 LVLRELGVLIVSIMIAGRSGSAYTAELGSMRMREEVDALKVMGLDPIEVLVVPRILALII 236

Query: 266 SLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIG 325
            LPLLT L + +A+IG  +V W Y  I   VF  R      L     G+ KAPFMA AIG
Sbjct: 237 GLPLLTFLGSMAALIGGGLVAWFYGGITPNVFIDRLKQAIDLTQFEVGMYKAPFMAAAIG 296

Query: 326 IVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
           +VA  EG  VG  + SLG+  T  VV++I +VI++D LFA+F+ +I
Sbjct: 297 LVACLEGLKVGGSAESLGQHTTASVVKAIFLVIVMDGLFAVFFASI 342


>gi|223040212|ref|ZP_03610491.1| ABC transport system permease [Campylobacter rectus RM3267]
 gi|222878573|gb|EEF13675.1| ABC transport system permease [Campylobacter rectus RM3267]
          Length = 378

 Score =  257 bits (656), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 185/371 (49%), Gaps = 9/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G        +W     ++I      A+  S + D  +++   + E+D   A  +   +
Sbjct: 17  SGGKLAINLKNDWTYKLPAQIWTQ-TAALIGSRKFDKIVLNFKDVKELDYAAALFLKNTL 75

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +L  ++ H +++F+ I+        N K ++       +N    IGK +  F 
Sbjct: 76  LNARKNYELVNLTPHAQRIFASINSE-----VNPKIKQIINAKPHENPLSQIGKNLAAFF 130

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
              C+  +  G  +    +           +  ++      G+  V +V L SF+ G V+
Sbjct: 131 AGFCAFLNFTGEFLVKFSKIFMLK---NIRVKEILAYFEDAGIKSVFIVCLTSFLIGIVL 187

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG+  L +FGA I  +++M +L LREI  L+ A+++AGR  S+  A+IG MKI EEID
Sbjct: 188 AYQGSNLLERFGATIIIVEMMGLLTLREIAPLIAAIIVAGRLASSFTAQIGVMKITEEID 247

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG D  + L+ PR+ ALI+++PL+  LA+ + I G  +V+  Y +I F  + +RF 
Sbjct: 248 AMKTMGFDPFKFLVLPRVIALIVAMPLIVFLADVAGIFGEMVVMENYLNIGFDSYLARFE 307

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GL KAPF    I  +    GF +  ++ S+G   T  VV +I  VI++D+
Sbjct: 308 QEVEIKHLYVGLFKAPFFGVVIAFIGCMRGFQISGNTQSVGTYTTVSVVNAIFGVIMVDA 367

Query: 363 LFAIFYFAIGI 373
           LF++ +  +GI
Sbjct: 368 LFSVIFTHLGI 378


>gi|126462257|ref|YP_001043371.1| hypothetical protein Rsph17029_1489 [Rhodobacter sphaeroides ATCC
           17029]
 gi|126103921|gb|ABN76599.1| protein of unknown function DUF140 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 366

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 109/363 (30%), Positives = 191/363 (52%), Gaps = 9/363 (2%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
             G      + E    +              +D++A+  +DT GA  I+   ++     +
Sbjct: 13  LRGRLTIETLPETQRSLGSV------GAGGQIDMAAVEALDTAGAWAILQAQKRAEAAGQ 66

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
              +    E    L+       +   + +R        +   ++G+++ + +  S +   
Sbjct: 67  ALEIVNLSESHRHLLETV-AAAMPEPERRRRTIPGRPDDGLANLGQEVAQGLRGSLTSVG 125

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
             G V+++ G       + K  L  L+  M   G + VP+V L+ F+ G V+A QG+ QL
Sbjct: 126 FFGEVVAHLGALVLHPTRLK--LTPLVHHMQEAGWNAVPIVSLMGFLIGIVLAFQGSTQL 183

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
             FGAE++ +DL++I  LRE+G+LLTA+++AGRS SA  A IGSMK+ EEIDA+R +GLD
Sbjct: 184 KSFGAEVYVVDLVAISILRELGILLTAIIVAGRSASAFTAAIGSMKMREEIDAMRVLGLD 243

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
            +  L+ PR+ AL+I LP L  +A+ + ++G  ++ W    I   +F ++  +   +++ 
Sbjct: 244 PIDRLVLPRLIALVILLPALGFIASLAGLVGGGLMAWIDLGITPGMFRTQLLADTDVSHA 303

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             GL+KAPF A  I ++   +G  V  ++ SLG   +  VVQ+I +VI++D+LF+IF+  
Sbjct: 304 IIGLVKAPFFAVIIAVIGCHQGMQVSGNAESLGSHTSRSVVQAIFLVIVVDALFSIFFAV 363

Query: 371 IGI 373
            G+
Sbjct: 364 WGL 366


>gi|90417915|ref|ZP_01225827.1| possible permease protein, ABC-type transporter [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90337587|gb|EAS51238.1| possible permease protein, ABC-type transporter [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 377

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 138/371 (37%), Positives = 213/371 (57%), Gaps = 3/371 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +G  V R +G+W +  +  + D V  A    +     +VD   +  IDT GA L+   +
Sbjct: 10  RDGGLVLRASGDWLARTVGSVEDTVAEAGAADL-GRQVVVDCGDVARIDTAGALLLEKLV 68

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +   +    E+   L     +   + +        N   +L    G+  V   
Sbjct: 69  RGLGANGRDVRLEAVSERDQPLFDVVRKALDRERPQPEKRKTNRILDLVAATGRGSVAVK 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ++     +I+G  +    +      + +    ++  Q+  +G+  VP++ L+SF+ GA+I
Sbjct: 129 DEIVVALNIIGGAMVGGVQRLTGKTQIRP--AAIFAQVEQMGLRAVPIIFLMSFLIGAII 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL +FG E+++++L +IL LREIGVLLTA+MIAGRSGSAI AEIGSMK+ EEID
Sbjct: 187 AQQGAFQLRRFGGELYAVNLAAILILREIGVLLTAIMIAGRSGSAITAEIGSMKMREEID 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ + +L+ PR+ AL+I LPLL  +AN + ++GA + +  Y DI FA F     
Sbjct: 247 ALHVIGLNPIGVLVFPRLVALVIVLPLLAFIANLAGLLGAMLTLNIYSDISFASFGQGVQ 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            +  +  +F+G+IKAPFMA  IG++A  EG  VG  + SLG +VT  VV+SI +VI++D 
Sbjct: 307 YSVDMFTVFSGVIKAPFMAVMIGLIASAEGMKVGGSAESLGLRVTASVVKSIFLVILMDG 366

Query: 363 LFAIFYFAIGI 373
           LFAIFY +IG+
Sbjct: 367 LFAIFYASIGL 377


>gi|326388333|ref|ZP_08209929.1| hypothetical protein Y88_3216 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326207065|gb|EGD57886.1| hypothetical protein Y88_3216 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 370

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 108/371 (29%), Positives = 190/371 (51%), Gaps = 13/371 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S        F+G      +  +   +     + I++  A +DL+ +  +DT+GA      
Sbjct: 11  SGENGDTLVFSGPMTVATLGGLDARL-----REIETPIARIDLADVPMMDTVGAWTCWRL 65

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                   ++       E+L   +           +P ++     +  +   +G  +   
Sbjct: 66  SRDTGA--EIVHPCEAAERLIGALEKVD----DGGEPTQAGGLPVWLRVPAKVGDTVFGL 119

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
              +       G ++  T        +F+    +L+ QM  VGV+ + +V L+SF+ G V
Sbjct: 120 AAGAVEVLGFFGQMLLATWGLLRHPGRFR--FNALVHQMELVGVNALAIVGLMSFLVGIV 177

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGA QL QFGAE+++++L+  L LRE+G+L+TA+M+AGRSGSA  A++G+MK+NEEI
Sbjct: 178 IAQQGAVQLRQFGAEVYTVNLVGRLTLRELGILMTAIMVAGRSGSAFAAQLGTMKLNEEI 237

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+RT+G+  +  L+ PRI A ++ LP+L + +    IIG + +     DIPF  F +R 
Sbjct: 238 DAMRTIGVSPMEALVLPRILATVLMLPVLGVYSAVVGIIGGAFLSSLTLDIPFFSFLARI 297

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                + +++ GL K P     + +    +G  V  ++  +G + T+ VV +I  VI++D
Sbjct: 298 REVVPVHDVWVGLFKGPVFGLIVSVAGCYQGMQVKANAEEVGLRTTSAVVMAIFTVIVLD 357

Query: 362 SLFAIFYFAIG 372
           + FA+F+  +G
Sbjct: 358 AFFAVFFTEVG 368


>gi|296445994|ref|ZP_06887944.1| protein of unknown function DUF140 [Methylosinus trichosporium
           OB3b]
 gi|296256512|gb|EFH03589.1| protein of unknown function DUF140 [Methylosinus trichosporium
           OB3b]
          Length = 382

 Score =  256 bits (655), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 129/369 (34%), Positives = 206/369 (55%), Gaps = 5/369 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +     F  AG+W      +I       +     +  A+VDL  ++ +DT GA +I   +
Sbjct: 17  DGAAVSFALAGDWVLAAAMDIERAAEKMVADGRGATRAVVDLVHVSRLDTAGAWVIGRAL 76

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++         V     +   L+   H ++ +          +   ++   +G+ +V   
Sbjct: 77  DELARAGVEASVEGARPEHELLLREAHFRRFET---DSRPRSSLCIDILADLGRSVVTAG 133

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D+ + A  LG  ++ TG   A + +F+    S +  +   G+  VP++ LI+ + GA++
Sbjct: 134 RDAFAGAVFLGEFVAVTGRAVAIARRFR--FTSFVYHLENFGLRSVPIIALINLLVGAIV 191

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG FQL +FGA  +++DL+ +L LRE+GVLL+++MIAGRSGSAI AE+GSMK+ EEID
Sbjct: 192 AQQGIFQLRRFGASTYAVDLIGVLVLRELGVLLSSIMIAGRSGSAITAELGSMKMREEID 251

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MGL  +  L++PRI AL++++PLL  +A+ SA+ G  +V W Y  I    +     
Sbjct: 252 ALRVMGLSPMDALVTPRILALVVAMPLLAFIADMSALFGGLLVCWGYEGISPVAYLEWLQ 311

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           +         G+IKAPFMA  IGIV+  EG +    + SLG+ VT  VV+SI +VI++D 
Sbjct: 312 AAIGRNTFMVGIIKAPFMAFTIGIVSAMEGMSTKGSAESLGRHVTAAVVKSIFMVIVLDG 371

Query: 363 LFAIFYFAI 371
           LFAIF+ +I
Sbjct: 372 LFAIFFASI 380


>gi|311232876|gb|ADP85730.1| protein of unknown function DUF140 [Desulfovibrio vulgaris RCH1]
          Length = 401

 Score =  256 bits (655), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 118/371 (31%), Positives = 197/371 (53%), Gaps = 8/371 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
               + RF+G W     +     +   +    +      DL+ +  +DT GA +I  F  
Sbjct: 38  GNTGILRFSGAWDVATAARARGQL-QHLAIPAECGDLTFDLTGVLRLDTAGALVITTF-- 94

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                ++ QG++  +    +  +   R   I   +       ++       IG  IV+  
Sbjct: 95  --RTALEKQGIAPLLHCAPAHNALIDRVAAIDMSEAPTVRHASALARTLNAIGASIVEET 152

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             +      +G+++ +        ++F+   +SL   M   GV  VP+V L+SF+ G V 
Sbjct: 153 EQAVGILAFMGMLVISLVGLVLRPWRFR--WVSLCSHMEQTGVQAVPIVALLSFLIGLVT 210

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA Q ++FGA++F I+L+ I  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE+ 
Sbjct: 211 AYMGAEQFARFGAQVFVINLLEISTLREMGVLLTALVVAGRSGSSFTAQIGAMVANEEVS 270

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R +GLD + +L+ PR+ AL++ LP+L  +A+   I+G  +  W    I  A F +RFH
Sbjct: 271 AMRALGLDPIEVLVVPRVLALVVMLPILAFIADIMGILGGGVAAWGTLGIDPANFTARFH 330

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L N   G+IKAPF A  I +V   +GF V   + S+G+  T  VV++I +VI++++
Sbjct: 331 EIVHLRNFVVGMIKAPFFALVIALVGCFQGFRVTGSAESVGRLTTQAVVEAIFMVIVLNA 390

Query: 363 LFAIFYFAIGI 373
           LFAI + ++G+
Sbjct: 391 LFAILFTSLGV 401


>gi|94263506|ref|ZP_01287318.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456144|gb|EAT06287.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 379

 Score =  256 bits (655), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 95/372 (25%), Positives = 176/372 (47%), Gaps = 11/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +GI      G  ++  I  +  ++   + K+      ++D+  +  +D  G  L+++F
Sbjct: 19  SADGILHAVVRGRMEAGSIGPLWQELASKLKKTRAG--LVLDVEKVDYLDMSGQALLLHF 76

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                   +   V         +         + +            +    +G+  V  
Sbjct: 77  SRLMQDSNRPVEVRGLRPDFRHIQEQIDCFDYRPKP------LQRRLSAVEELGRAAVNL 130

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D       +G  +S+     A     +     ++  M  VG   V ++ L+ F+ G +
Sbjct: 131 GRDIGQFFSFVGEFVSSLAYCLAHPGTVR--WKDVLSHMENVGGRAVFIIALMGFLIGVI 188

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IA Q A  L  FGAE+F   L+ +  +RE+G L+TA+++AGRSGSA  AEIG+MK NEEI
Sbjct: 189 IAFQTAITLKTFGAEMFVAKLLGLSMVRELGPLVTAIILAGRSGSAFAAEIGTMKTNEEI 248

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           +A++TMGL+ VR L+ PR+ A ++  PLL +     + IG ++V+    D     +  + 
Sbjct: 249 NALQTMGLNPVRFLVVPRMLATMLVTPLLCVFFLLFSFIGGALVM-LSMDFTLNSYVHQL 307

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            ++  +A+   G++K    +  +  V    G   G  ++++G+  T+ VV +I ++I+ D
Sbjct: 308 STSVGMADFLGGMVKVLVFSILVAWVGCVRGLQTGSGASAVGRSTTSAVVSAIILIILAD 367

Query: 362 SLFAIFYFAIGI 373
            +FA+ Y+ +GI
Sbjct: 368 GIFAVVYYMLGI 379


>gi|255322244|ref|ZP_05363390.1| ABC transport system permease [Campylobacter showae RM3277]
 gi|255300617|gb|EET79888.1| ABC transport system permease [Campylobacter showae RM3277]
          Length = 378

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 108/371 (29%), Positives = 183/371 (49%), Gaps = 9/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G        NW     ++I      A+  S + +  +++   I E+D   A       
Sbjct: 17  SGGKLTINLKNNWNYKLPAQIWTQ-TAALIGSKKFNKIVLNFKEIKELDYAAALFFKNTF 75

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +L  ++ H +++F+ I+        N K ++       +N    IGK +  F 
Sbjct: 76  LNACKNYELVNLTPHAQKIFASINSE-----INPKIKQIIDAKPHENPFSQIGKNLTAFF 130

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
              C+  +  G  +    +           +  ++      G+  V +V L SF+ G V+
Sbjct: 131 AGFCAFLNFTGEFLVKFSKIFMLK---NIRVKEILAYFEDAGIKSVFIVCLTSFLIGIVL 187

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG+  L  FGA I  +++M +L LREI  L+ A+++AGR  S+  A+IG MKI EEID
Sbjct: 188 AYQGSNLLESFGATIIIVEMMGLLTLREIAPLIAAIIVAGRLASSFTAQIGVMKITEEID 247

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG D  + L+ PR+ ALI+++PL+  LA+ + I G  +V+  Y +I F  + +RF 
Sbjct: 248 AMKTMGFDPFKFLVLPRVIALIVAMPLIVFLADVAGIFGEMVVMENYLNISFDSYLARFS 307

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + +++ GL KAPF    I  +    GF +G ++ S+G   T  VV +I  VI++D+
Sbjct: 308 QEVDIKHLYVGLFKAPFFGIVIAFIGCMRGFQIGGNTQSVGTYTTVSVVNAIFGVIMVDA 367

Query: 363 LFAIFYFAIGI 373
           LF+I +  +GI
Sbjct: 368 LFSIIFTQLGI 378


>gi|256061111|ref|ZP_05451265.1| hypothetical protein Bneo5_12197 [Brucella neotomae 5K33]
 gi|261325112|ref|ZP_05964309.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261301092|gb|EEY04589.1| conserved hypothetical protein [Brucella neotomae 5K33]
          Length = 391

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 153/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LP LTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPPLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|153009437|ref|YP_001370652.1| hypothetical protein Oant_2107 [Ochrobactrum anthropi ATCC 49188]
 gi|151561325|gb|ABS14823.1| protein of unknown function DUF140 [Ochrobactrum anthropi ATCC
           49188]
          Length = 391

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 151/369 (40%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G    R +G W S  +  + DD + ++ K+ +  + I+D+S ++ +DT GA LI    
Sbjct: 24  QDGARHIRLSGRWVSQSV-NLVDDKMRSLEKTDEHKATIIDVSGVSGLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    +    L+    +   +     R      F +    +G  ++   
Sbjct: 83  QRLVAKSADAQLEGVRQSWLPLMEEVGQAVERTLDIPRQKKPFFFISFLAALGGGVISMG 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P++IL+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGSGIPI--AAIVTQMDRMGVGAIPIIILMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTI+++ +A+IGA  V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVVLPLLTIISDLAALIGAGGVAWFYSNISPDAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|221069470|ref|ZP_03545575.1| protein of unknown function DUF140 [Comamonas testosteroni KF-1]
 gi|220714493|gb|EED69861.1| protein of unknown function DUF140 [Comamonas testosteroni KF-1]
          Length = 375

 Score =  256 bits (654), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 97/371 (26%), Positives = 175/371 (47%), Gaps = 10/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +G       G W + E+ +      +A            DL  +  +D IGA+L+   
Sbjct: 14  SRDGQQWAVPVGRWSAAELGDRHIWRRLAPQIRAVPKGVAWDLQQMVWLDHIGAQLLWEQ 73

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +      L   +          S   R    ++ P+     + +      +G+ ++  
Sbjct: 74  WGRTWPARLLTTKNQR--------SMLERVARFSEVPEAKPEPSGWMCEVNRLGQMVIDA 125

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                +   ++G ++ +      +   F+G    +   +Y  G + +P+  L+ F+ G V
Sbjct: 126 CGHFSNLIQLVGQLLLDCLRLLRNP--FRGPWRDISGHLYATGATALPITALVGFLIGVV 183

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A   A QL QFGAE F ++++ I  +RE+G LL A+++AGRSGSAI A+IG M++ EE+
Sbjct: 184 LAYLMALQLRQFGAESFIVNILGISLIRELGPLLAAILVAGRSGSAITAQIGVMRVTEEL 243

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MG+     L+ PR  AL +S+PL+ +    +A+ G  +      DI  + F    
Sbjct: 244 DAMQVMGISQGYRLVLPRALALAVSMPLVALWTILAALAGGMVAADLTMDITPSYFIQSL 303

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            +   + N+   + K+      I ++    G  V  ++ SLG+  T  VV SI++VII+D
Sbjct: 304 PAAVKIGNLVLAMGKSVVFGVLIALIGCHWGLKVEPNTQSLGRGTTAAVVSSITMVIIVD 363

Query: 362 SLFAIFYFAIG 372
           ++FAI +  +G
Sbjct: 364 AIFAILFRNVG 374


>gi|188580085|ref|YP_001923530.1| hypothetical protein Mpop_0817 [Methylobacterium populi BJ001]
 gi|179343583|gb|ACB78995.1| protein of unknown function DUF140 [Methylobacterium populi BJ001]
          Length = 382

 Score =  256 bits (654), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 136/373 (36%), Positives = 205/373 (54%), Gaps = 12/373 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           + G       G W + +     +     I    +    +VDLS +  +DT+GA ++    
Sbjct: 18  DAGDGRVILHGRWTADQ-GPAVESASARIAAQGRRQPVLVDLSGLARLDTLGAWVLERTR 76

Query: 63  ---EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
              E   G++   G       L   +        +  +P      N    L    G+++ 
Sbjct: 77  AEIEAAGGRLAYAGARPEHRILLGEMGL------REPEPAPRDARNPVVRLLDGTGRRVA 130

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +  N+  S    LG V++  G        F+    +L+ Q+  V + GVP+++LISF+ G
Sbjct: 131 RGGNEILSGIAFLGEVVAAGGRVARRPQTFRM--AALVNQLEQVALRGVPIIVLISFLVG 188

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            ++AQQG FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ E
Sbjct: 189 GIVAQQGIFQLQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMRE 248

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+R MGLD + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +
Sbjct: 249 EVDALRVMGLDPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTVDAFLA 308

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R  +  +  +   GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI+
Sbjct: 309 RLQAAVSFHHFAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIV 368

Query: 360 IDSLFAIFYFAIG 372
           +D LFA+F+ AI 
Sbjct: 369 LDGLFAVFFAAID 381


>gi|254714105|ref|ZP_05175916.1| Sulfate transporter/antisigma-factor [Brucella ceti M644/93/1]
 gi|254716838|ref|ZP_05178649.1| Sulfate transporter/antisigma-factor [Brucella ceti M13/05/1]
 gi|261218640|ref|ZP_05932921.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261321862|ref|ZP_05961059.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gi|260923729|gb|EEX90297.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261294552|gb|EEX98048.1| conserved hypothetical protein [Brucella ceti M644/93/1]
          Length = 391

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++GI V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGIRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+G LLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGGLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|225627497|ref|ZP_03785534.1| toulene ABC transporter permease protein [Brucella ceti str. Cudo]
 gi|260168729|ref|ZP_05755540.1| Sulfate transporter/antisigma-factor [Brucella sp. F5/99]
 gi|261758207|ref|ZP_06001916.1| sulfate transporter/antisigma-factor [Brucella sp. F5/99]
 gi|225617502|gb|EEH14547.1| toulene ABC transporter permease protein [Brucella ceti str. Cudo]
 gi|261738191|gb|EEY26187.1| sulfate transporter/antisigma-factor [Brucella sp. F5/99]
          Length = 391

 Score =  256 bits (653), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKYVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM   GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRTGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|170734244|ref|YP_001766191.1| hypothetical protein Bcenmc03_2910 [Burkholderia cenocepacia MC0-3]
 gi|169817486|gb|ACA92069.1| protein of unknown function DUF140 [Burkholderia cenocepacia MC0-3]
          Length = 374

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 168/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   I        +  DLS I  +D +G + +     +   
Sbjct: 19  TVRLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R   ++    L    G  I  F      
Sbjct: 79  AGVALSATQ-----RTIFERIERLDSEREAPERIVRFDPVTRL----GLAIFAFGEHLQG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGRVILDALSVLRRPKTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 248 GIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKLVLGIDINYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|94263144|ref|ZP_01286962.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93456515|gb|EAT06629.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 379

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 97/372 (26%), Positives = 178/372 (47%), Gaps = 11/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +GI      G  ++  I  +  ++   + K+      ++D+  +  +D  G  L+++F
Sbjct: 19  SADGILHAVVRGRMEAGSIGPLWQELASKLKKTRAG--LVLDVEKVDYLDMSGQALLLHF 76

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                       +         +     R    ++  QR        +    +G+  V  
Sbjct: 77  SRLMQDGNLPVEIRGLHPDFRHIQEQISRFDCHSKPAQRR------LSAVEELGRAAVNL 130

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D       +G  +S+     A     +     ++  M  VG   V ++ L+ F+ G +
Sbjct: 131 GRDIGQFFSFVGEFVSSLAYCLAHPGTVR--WKDVLSHMENVGGRAVFIIALMGFLIGVI 188

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IA Q A  L  FGAE+F   L+ +  +RE+G L+TA+++AGRSGSA  AEIG+MK NEEI
Sbjct: 189 IAFQTAITLKTFGAEMFVAKLLGLSMVRELGPLVTAIILAGRSGSAFAAEIGTMKTNEEI 248

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           +A++TMGL+ VR L+ PR+ A ++  PLL +     + IG ++V+    D     +  + 
Sbjct: 249 NALQTMGLNPVRFLVVPRMLATMLVTPLLCVFFLLFSFIGGALVM-LSMDFTLNSYVHQL 307

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            ++  +A+   G++K    +  +  V    G   G  ++++G+  T+ VV +I ++I+ D
Sbjct: 308 STSVGMADFLGGMVKVLVFSILVAWVGCVRGLQTGSGASAVGRSTTSAVVSAIILIILAD 367

Query: 362 SLFAIFYFAIGI 373
            +FA+ Y+ +GI
Sbjct: 368 GIFAVVYYMLGI 379


>gi|194364302|ref|YP_002026912.1| hypothetical protein Smal_0524 [Stenotrophomonas maltophilia
           R551-3]
 gi|194347106|gb|ACF50229.1| protein of unknown function DUF140 [Stenotrophomonas maltophilia
           R551-3]
          Length = 373

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 111/365 (30%), Positives = 188/365 (51%), Gaps = 13/365 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + R +G W        A+ +     + +      +D + I ++D+ G   ++    +   
Sbjct: 21  LIRLSGTWTLKTALAAAEVL-----RDVPDTLTGIDATGIEKMDSAGVLQVLRVAHRADL 75

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                      + L   I      + K +                 +G  +    ++  +
Sbjct: 76  GEDALQFRPDHQALVCTIEEVADDRPKPK------RDFGVLAALERLGVSVHATGHNIKA 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG  +           +F+  L + + QM  VG+  VP+V L+S++ GAVIA  G+
Sbjct: 130 LCSFLGENLVKAARLVKEPRRFR--LTATVHQMEQVGLDAVPLVALLSYLVGAVIAFLGS 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L  FGAEI+ ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDA+RT+
Sbjct: 188 TILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDAMRTL 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD + +L+ PR++AL+++LPLLT +A  + + G   V     DIP  ++ +R H T  +
Sbjct: 248 GLDPIDLLVLPRLFALLVTLPLLTFIAMVAGLAGGITVGAFDLDIPPQMYIARMHDTMEV 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            ++  GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+  A++
Sbjct: 308 RHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQSVGERTTSSVVQTISLVIIIDAFAALW 367

Query: 368 YFAIG 372
           +  + 
Sbjct: 368 FMHMD 372


>gi|268678744|ref|YP_003303175.1| hypothetical protein Sdel_0102 [Sulfurospirillum deleyianum DSM
           6946]
 gi|268616775|gb|ACZ11140.1| protein of unknown function DUF140 [Sulfurospirillum deleyianum DSM
           6946]
          Length = 376

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 108/373 (28%), Positives = 183/373 (49%), Gaps = 13/373 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +  G +V    G W    +  +         K     S   D S+I   DT G  L+++ 
Sbjct: 12  NSEGFSVI-VRGKWVKESVPLLQSAFTSLTCK--PHASYTFDFSSIETFDTHGIMLLLHH 68

Query: 62  MEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           ++K   +   ++  G S   + LFS+    +  ++   K +         +   ++G+ +
Sbjct: 69  IKKLEKEYCIVQTTGASDAFKTLFSICQTHYPHEVPRPKKE-----RMVLSFLENVGRTM 123

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           ++      S     G +    G         +  L + +  +   G   +P+++L SF+ 
Sbjct: 124 MEGYKTLASFFSFTGELSHAIGALFFKPANIR--LKATLYHIEQSGAGAIPIILLTSFLI 181

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G VIA QGA QL +FGA IF +++++I  +RE+  LLTA+++AGRS S+  A+IG MK+ 
Sbjct: 182 GVVIAYQGASQLEKFGANIFIVEMITISAVRELAPLLTAIVVAGRSASSYTAQIGVMKLT 241

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           +EIDA+ +MG      L+ PR++ALIISLPLL   A+  +  G  ++     D+ F  F 
Sbjct: 242 DEIDAMSSMGFSPWNFLVLPRLFALIISLPLLVFFADVVSTFGGMVIASTRLDVSFVEFI 301

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            R   T  L ++  GL+KAP   C I  +    GF +  ++ S+GK  T  VV +I  VI
Sbjct: 302 DRIKETVALKHLVIGLVKAPIFGCIIATIGCFRGFQITSNTESVGKYTTISVVNAIFWVI 361

Query: 359 IIDSLFAIFYFAI 371
            +D+L ++F   +
Sbjct: 362 AMDALISVFLTEL 374


>gi|160895814|ref|YP_001561396.1| hypothetical protein Daci_0365 [Delftia acidovorans SPH-1]
 gi|160361398|gb|ABX33011.1| protein of unknown function DUF140 [Delftia acidovorans SPH-1]
          Length = 376

 Score =  256 bits (653), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 92/372 (24%), Positives = 179/372 (48%), Gaps = 11/372 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +N        G+W + E+   A    + A     + D    +L  +  +D +GA+L+   
Sbjct: 15  DNDGQWALLTGSWGAAELGRRAQWRKLRAQLADAKGDDLGWNLEGLDWLDHVGAQLLWNH 74

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +         +   +    +  +   R    +++P       +       +G  ++  
Sbjct: 75  WGRR--------LPARLAASDAQRAMLERVGRFSKEPAPPPPRLNLLERIDSLGCLVINA 126

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                    ++G ++ +   F  + +  +G    +   +Y +G + +P+  L+ F+ G V
Sbjct: 127 CGHFAQMTRLIGQLLIDLLRFARAPH--RGPWRDISGHLYSMGATALPITALVGFLIGVV 184

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A   A QL QFGAE F ++++ I  +RE+G LL A+++AGR+GSAI A+IG M++ EE+
Sbjct: 185 LAYLMALQLRQFGAESFIVNILGISLIRELGPLLAAILVAGRTGSAITAQIGVMRVTEEL 244

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MG+     L+ PR  AL I++PL+++    +A+ G  +       +  A F    
Sbjct: 245 DAMQVMGIPHGFRLVLPRALALAIAMPLVSLWTTLAALAGGMLAADLTMGVTGAYFAEAL 304

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            +   + N++  + K+      I ++    G  V  ++ SLGK  T  VV +I++VI++D
Sbjct: 305 PAAVKIGNLWIAMGKSVVFGALIALIGCHWGLRVEPNTQSLGKGTTASVVTAITMVIVVD 364

Query: 362 SLFAIFYFAIGI 373
           ++FAI +  +GI
Sbjct: 365 AIFAILFKDVGI 376


>gi|300917987|ref|ZP_07134613.1| conserved hypothetical protein [Escherichia coli MS 115-1]
 gi|300414813|gb|EFJ98123.1| conserved hypothetical protein [Escherichia coli MS 115-1]
          Length = 381

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 114/364 (31%), Positives = 180/364 (49%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +   V             + DL+ +  +DT GA L+   + +    
Sbjct: 21  VYIRGDWVLAHYCVLEPRVAQLRANMPSGG--VFDLNQLGALDTAGATLLALLLGEDRVA 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      E+   L+                     +  +  + G+ +     D  S 
Sbjct: 79  NLRELAPKLPEERRILLETVSHVLPDLTPELSEKPTRFWLEMLANTGRSVDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFIGLALETLLGTLFRPSRWRI--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|46579026|ref|YP_009834.1| STAS domain-containing protein [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46448439|gb|AAS95093.1| STAS domain protein [Desulfovibrio vulgaris str. Hildenborough]
          Length = 406

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 118/371 (31%), Positives = 197/371 (53%), Gaps = 8/371 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
               + RF+G W     +     +   +    +      DL+ +  +DT GA +I  F  
Sbjct: 43  GNTGILRFSGAWDVATAARARGQL-QHLAIPAECGDLTFDLTGVLRLDTAGALVITTF-- 99

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                ++ QG++  +    +  +   R   I   +       ++       IG  IV+  
Sbjct: 100 --RTALEKQGIAPLLHCAPAHNALIDRVAAIDMSEAPTVRHASALARTLNAIGASIVEET 157

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             +      +G+++ +        ++F+   +SL   M   GV  VP+V L+SF+ G V 
Sbjct: 158 EQAVGILAFMGMLVISLVGLVLRPWRFR--WVSLCSHMEQTGVQAVPIVALLSFLIGLVT 215

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA Q ++FGA++F I+L+ I  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE+ 
Sbjct: 216 AYMGAEQFARFGAQVFVINLLEISTLREMGVLLTALVVAGRSGSSFTAQIGAMVANEEVS 275

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R +GLD + +L+ PR+ AL++ LP+L  +A+   I+G  +  W    I  A F +RFH
Sbjct: 276 AMRALGLDPIEVLVVPRVLALVVMLPILAFIADIMGILGGGVAAWGTLGIDPANFTARFH 335

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L N   G+IKAPF A  I +V   +GF V   + S+G+  T  VV++I +VI++++
Sbjct: 336 EIVHLRNFVVGMIKAPFFALVIALVGCFQGFRVTGSAESVGRLTTQAVVEAIFMVIVLNA 395

Query: 363 LFAIFYFAIGI 373
           LFAI + ++G+
Sbjct: 396 LFAILFTSLGV 406


>gi|238789963|ref|ZP_04633742.1| ABC transporter, permease protein [Yersinia frederiksenii ATCC
           33641]
 gi|238721911|gb|EEQ13572.1| ABC transporter, permease protein [Yersinia frederiksenii ATCC
           33641]
          Length = 381

 Score =  255 bits (652), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 115/364 (31%), Positives = 184/364 (50%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W     S +  +V         +   I DL+ +  +DT GA L+   +      
Sbjct: 21  VSVKGDWVLAHYSVLEPEVTQLRANLPHA--VIFDLNQLGALDTAGATLLALLLGDERIN 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      ++   L+          +        + +  L  + G+ +     D  S 
Sbjct: 79  KLRELAPKLPQERRVLLETVSHVLPGLEPESSEKPPSFWLELLANTGRSMDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFVGLTLEALFGTVFRPSRWRV--TSLIANVQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     +I   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMVCGIFGGMVVCALTLNISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|298530599|ref|ZP_07018001.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509973|gb|EFI33877.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 379

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 94/370 (25%), Positives = 176/370 (47%), Gaps = 11/370 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            GI      G  ++  I  +  ++   + K+      ++D+  +  +D  G  L+++F  
Sbjct: 21  EGILHAVVRGRMEAGSIGPLWKELASKLKKNRAG--LVLDVEKVDYMDMSGQALLLHFSR 78

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +   +     V     +L  +         + +  QR        +    +G+  V    
Sbjct: 79  QMQDRNLSVEVRGLRPELREIQEEIDCFDCRPRPMQRK------LSALEELGRAAVNLGR 132

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D+      +G  +S+           +     ++  M  VG   V ++ L+ F+ G +IA
Sbjct: 133 DTRQFFSFVGEFVSSFAYSLTHPGTVR--WKDVLSHMEAVGGRAVFIIALMGFLIGVIIA 190

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            Q A  L  FGAEIF   L+ +  +RE+G L+T++++AGRSGSA  AEIG+MK NEEI+A
Sbjct: 191 FQTAITLRAFGAEIFVAKLLGLSIVRELGPLVTSIILAGRSGSAFAAEIGTMKTNEEINA 250

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++TMGL  VR L+ PR+ A ++  PLL I     + IG ++V+    D     +  +  +
Sbjct: 251 LQTMGLSPVRFLVVPRMLAAMLVTPLLCIFFLLFSFIGGALVM-LSMDFTLTTYIHQLKT 309

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           +  + +    ++K    +  +  +    G   G  ++++G+  T+ VV +I ++I+ D +
Sbjct: 310 SVGMTDFLGSMVKVFVFSILVAWIGCVRGLQTGSGASAVGRSTTSAVVSAIVLIILADGI 369

Query: 364 FAIFYFAIGI 373
           FA+ Y+ +GI
Sbjct: 370 FAVVYYMLGI 379


>gi|238791990|ref|ZP_04635626.1| ABC transporter, permease protein [Yersinia intermedia ATCC 29909]
 gi|238728621|gb|EEQ20139.1| ABC transporter, permease protein [Yersinia intermedia ATCC 29909]
          Length = 381

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 114/364 (31%), Positives = 180/364 (49%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +   V             + DL+ +  +DT GA L+   + +    
Sbjct: 21  VYIRGDWVLAHYCVLEPRVAQLRANMPSGG--VFDLNQLGALDTAGATLLALLLGEDRVA 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      E+   L+                     +  +  + G+ +     D  S 
Sbjct: 79  NLRELAPKLPEERRILLETVSHVLPDLTPELSEKPARFWLEMLANTGRSVDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFIGLALETLLGTLFRPSRWRI--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|120603385|ref|YP_967785.1| hypothetical protein Dvul_2342 [Desulfovibrio vulgaris DP4]
 gi|120563614|gb|ABM29358.1| protein of unknown function DUF140 [Desulfovibrio vulgaris DP4]
          Length = 406

 Score =  255 bits (652), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 118/371 (31%), Positives = 196/371 (52%), Gaps = 8/371 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
               + RF+G W     +     +   +    +      DL+ +  +DT GA +I  F  
Sbjct: 43  GNTGILRFSGAWDVATAARARGQL-QHLAIPAECGDLTFDLTGVLRLDTAGALVITTF-- 99

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHR-KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                ++ QG++  +    +  +   R   I   +       ++       IG  IV+  
Sbjct: 100 --RTALEKQGIAPLLHCAPAHNALIDRVAAIDMSEAPTVRHASALARTLNAIGASIVEET 157

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
             +      +G+ + +        ++F+   +SL   M   GV  VP+V L+SF+ G V 
Sbjct: 158 EQAVGILAFMGMFVISLVGLVLRPWRFR--WVSLCSHMEQTGVQAVPIVALLSFLIGLVT 215

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA Q ++FGA++F I+L+ I  LRE+GVLLTA+++AGRSGS+  A+IG+M  NEE+ 
Sbjct: 216 AYMGAEQFARFGAQVFVINLLEISTLREMGVLLTALVVAGRSGSSFTAQIGAMVANEEVS 275

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R +GLD + +L+ PR+ AL++ LP+L  +A+   I+G  +  W    I  A F +RFH
Sbjct: 276 AMRALGLDPIEVLVVPRVLALVVMLPILAFIADIMGILGGGVAAWGTLGIDPANFTARFH 335

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L N   G+IKAPF A  I +V   +GF V   + S+G+  T  VV++I +VI++++
Sbjct: 336 EIVQLRNFVVGMIKAPFFALVIALVGCFQGFRVTGSAESVGRLTTQAVVEAIFMVIVLNA 395

Query: 363 LFAIFYFAIGI 373
           LFAI + ++G+
Sbjct: 396 LFAILFTSLGV 406


>gi|17987248|ref|NP_539882.1| toluene tolerance protein Ttg2B [Brucella melitensis bv. 1 str.
           16M]
 gi|17982923|gb|AAL52146.1| toluene tolerance protein ttg2b [Brucella melitensis bv. 1 str.
           16M]
          Length = 390

 Score =  255 bits (651), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 23  QDGMRVIHLSGPWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 81

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 82  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 141

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 142 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 199

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 200 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 259

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 260 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 319

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 320 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 379

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 380 LFAMFYAAI 388


>gi|189024185|ref|YP_001934953.1| Sulfate transporter/antisigma-factor [Brucella abortus S19]
 gi|189019757|gb|ACD72479.1| Sulfate transporter/antisigma-factor [Brucella abortus S19]
          Length = 390

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 23  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 81

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 82  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 141

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 142 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 199

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 200 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 259

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 260 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 319

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 320 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 379

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 380 LFAMFYAAI 388


>gi|134096148|ref|YP_001101223.1| putative transmembrane protein [Herminiimonas arsenicoxydans]
 gi|133740051|emb|CAL63102.1| Conserved hypothetical protein, putative ABC transporter
           [Herminiimonas arsenicoxydans]
          Length = 374

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 97/371 (26%), Positives = 175/371 (47%), Gaps = 13/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIA--DDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           N       AG+W+   ++       +   +  + ++++   DLS IT +D IGA+L+   
Sbjct: 14  NDNATATAAGSWQVRALAAPETMAAITAVLQTAGKAETVHWDLSQITALDYIGAQLLWNA 73

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             K         ++      F  +  T   + K    +  +   S   L +         
Sbjct: 74  WGKKRPAQLT--LAPQHADFFLRLEQTGPLEWKKPPQKYWYSLTSLLQLKH-------NI 124

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           ++       ++G +  + G F       +G    +   +++ G   + +  L+ F+ G V
Sbjct: 125 LDHLLGFISLIGQLTMDIGRFAREPQ--RGPWKEISANIFHAGYQALGITALVGFLIGVV 182

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   A QL QFG ++F ++++ +  +RE+G LL A+++AGRSGS+I A++G M++ EE+
Sbjct: 183 LSYLSAQQLHQFGGDVFLVNILGMSVIRELGPLLAAILVAGRSGSSITAQLGVMRVTEEL 242

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MGL     L+ P++ AL I++PLL +  +  A+IG          + +  F    
Sbjct: 243 DAMLVMGLPHGYRLVMPKVIALAIAMPLLVVWTDAMALIGGMAAANLELGLSYKYFIREL 302

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                LAN + GL K       I +VA   G  +  ++ SLG   T  VV +I+IVI+ D
Sbjct: 303 PDAVPLANYWIGLGKGVVFGALIALVACHFGLRIKPNTESLGAGTTISVVSAITIVILAD 362

Query: 362 SLFAIFYFAIG 372
           +LFAI +  +G
Sbjct: 363 ALFAIIFSKVG 373


>gi|254689249|ref|ZP_05152503.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 6 str.
           870]
 gi|260754755|ref|ZP_05867103.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260674863|gb|EEX61684.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
          Length = 391

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKYVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|317181149|dbj|BAJ58935.1| hypothetical protein HPF32_1353 [Helicobacter pylori F32]
          Length = 377

 Score =  255 bits (651), Expect = 9e-66,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  + S  Y     +   +GK IV+  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKESKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +P+ IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPISILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|238751983|ref|ZP_04613468.1| ABC transporter, permease protein [Yersinia rohdei ATCC 43380]
 gi|238709817|gb|EEQ02050.1| ABC transporter, permease protein [Yersinia rohdei ATCC 43380]
          Length = 381

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 115/364 (31%), Positives = 184/364 (50%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W      E+   V             + DL+ +  +DT GA L+   + +    
Sbjct: 21  VSAKGDWVLVHYRELEPQVAQLRANLPHG--VVFDLNQLGALDTAGAALLAVLLGEERIS 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      ++   L+    +     +          +  L    G+ +     D  S 
Sbjct: 79  HLRELAPNLPQERRVLLETVSQVLPNIEPESTEKPPAFWLELLAGTGRTVDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFVGLTLETLLGTLFRPSRWRV--TSLIANVQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     +I   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMVCGIFGGMVVCALELNISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G+  TT VVQSI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGEHTTTSVVQSIFVVILLDAIAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|163843287|ref|YP_001627691.1| hypothetical protein BSUIS_A1062 [Brucella suis ATCC 23445]
 gi|163674010|gb|ABY38121.1| protein of unknown function DUF140 [Brucella suis ATCC 23445]
          Length = 391

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 153/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY  I
Sbjct: 381 LFAMFYATI 389


>gi|225852524|ref|YP_002732757.1| hypothetical protein BMEA_A1060 [Brucella melitensis ATCC 23457]
 gi|256044678|ref|ZP_05447582.1| hypothetical protein Bmelb1R_09298 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256113572|ref|ZP_05454392.1| hypothetical protein Bmelb3E_12477 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256263986|ref|ZP_05466518.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 2
           str. 63/9]
 gi|260564024|ref|ZP_05834510.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 1
           str. 16M]
 gi|265991102|ref|ZP_06103659.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265994939|ref|ZP_06107496.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225640889|gb|ACO00803.1| protein of unknown function DUF140 [Brucella melitensis ATCC 23457]
 gi|260154040|gb|EEW89132.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 1
           str. 16M]
 gi|262766052|gb|EEZ11841.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263001886|gb|EEZ14461.1| conserved hypothetical protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263094130|gb|EEZ18052.1| sulfate transporter/antisigma-factor [Brucella melitensis bv. 2
           str. 63/9]
 gi|326409040|gb|ADZ66105.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326538749|gb|ADZ86964.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 391

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGPWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|23501899|ref|NP_698026.1| toulene ABC transporter permease [Brucella suis 1330]
 gi|62289942|ref|YP_221735.1| toulene ABC transporter permease [Brucella abortus bv. 1 str.
           9-941]
 gi|82699870|ref|YP_414444.1| sulfate transporter [Brucella melitensis biovar Abortus 2308]
 gi|237815443|ref|ZP_04594441.1| toulene ABC transporter, permease protein [Brucella abortus str.
           2308 A]
 gi|254697384|ref|ZP_05159212.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254706786|ref|ZP_05168614.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis
           M163/99/10]
 gi|254730282|ref|ZP_05188860.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 4 str.
           292]
 gi|256031600|ref|ZP_05445214.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis
           M292/94/1]
 gi|256159738|ref|ZP_05457485.1| Sulfate transporter/antisigma-factor [Brucella ceti M490/95/1]
 gi|256255000|ref|ZP_05460536.1| Sulfate transporter/antisigma-factor [Brucella ceti B1/94]
 gi|256257499|ref|ZP_05463035.1| Sulfate transporter/antisigma-factor [Brucella abortus bv. 9 str.
           C68]
 gi|256369443|ref|YP_003106951.1| toluene ABC transporter, permease protein, putative [Brucella
           microti CCM 4915]
 gi|260545309|ref|ZP_05821050.1| sulfate transporter/antisigma-factor [Brucella abortus NCTC 8038]
 gi|260757978|ref|ZP_05870326.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260761801|ref|ZP_05874144.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260883775|ref|ZP_05895389.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261222188|ref|ZP_05936469.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261314254|ref|ZP_05953451.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|265988688|ref|ZP_06101245.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265998152|ref|ZP_06110709.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|297248343|ref|ZP_06932061.1| ABC transport system permease [Brucella abortus bv. 5 str. B3196]
 gi|23347840|gb|AAN29941.1| toulene ABC transporter, permease protein, putative [Brucella suis
           1330]
 gi|62196074|gb|AAX74374.1| hypothetical toulene ABC transporter, permease protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82615971|emb|CAJ10994.1| Sulfate transporter/antisigma-factor antagonist STAS:Protein of
           unknown function DUF140 [Brucella melitensis biovar
           Abortus 2308]
 gi|237790280|gb|EEP64490.1| toulene ABC transporter, permease protein [Brucella abortus str.
           2308 A]
 gi|255999603|gb|ACU48002.1| toluene ABC transporter, permease protein, putative [Brucella
           microti CCM 4915]
 gi|260096716|gb|EEW80591.1| sulfate transporter/antisigma-factor [Brucella abortus NCTC 8038]
 gi|260668296|gb|EEX55236.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672233|gb|EEX59054.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260873303|gb|EEX80372.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260920772|gb|EEX87425.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261303280|gb|EEY06777.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|262552620|gb|EEZ08610.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|264660885|gb|EEZ31146.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|297175512|gb|EFH34859.1| ABC transport system permease [Brucella abortus bv. 5 str. B3196]
          Length = 391

 Score =  255 bits (651), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|294852390|ref|ZP_06793063.1| ABC transport system permease [Brucella sp. NVSL 07-0026]
 gi|294820979|gb|EFG37978.1| ABC transport system permease [Brucella sp. NVSL 07-0026]
          Length = 391

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 153/369 (41%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+++L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIIVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|306840506|ref|ZP_07473265.1| Sulfate transporter/antisigma-factor [Brucella sp. BO2]
 gi|306843893|ref|ZP_07476488.1| Sulfate transporter/antisigma-factor [Brucella sp. BO1]
 gi|306275648|gb|EFM57372.1| Sulfate transporter/antisigma-factor [Brucella sp. BO1]
 gi|306289521|gb|EFM60739.1| Sulfate transporter/antisigma-factor [Brucella sp. BO2]
          Length = 391

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 152/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G  V   +G+W S  + ++ DD +  I ++    +  +D+S I+ +DT GA LI    
Sbjct: 24  QDGARVIHLSGHWISQSV-QLVDDKMRGIEQAGGDKATTIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           +FA+FY AI
Sbjct: 381 MFAMFYAAI 389


>gi|330861182|emb|CBX71439.1| hypothetical protein YEW_CA08640 [Yersinia enterocolitica W22703]
          Length = 381

 Score =  254 bits (650), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 117/364 (32%), Positives = 185/364 (50%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +   V     ++ Q  S + DL+ +  +DT GA L+   +      
Sbjct: 21  VSIKGDWVLAHYRVLEPVVTQ--FRASQPQSVVFDLTQLGALDTAGATLLALLLGDERIN 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      E+  +L+    R              + +     + G+ +     D  S 
Sbjct: 79  HLRELAPKLPEERRTLLETVSRVLPDLASESSEKPPSFWLEFLANTGRSVDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFVGLTLEALFSTIFRPSRWRM--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|161618971|ref|YP_001592858.1| hypothetical protein BCAN_A1034 [Brucella canis ATCC 23365]
 gi|254704312|ref|ZP_05166140.1| hypothetical protein Bsuib36_10354 [Brucella suis bv. 3 str. 686]
 gi|260566441|ref|ZP_05836911.1| sulfate transporter/antisigma-factor [Brucella suis bv. 4 str. 40]
 gi|261754981|ref|ZP_05998690.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|161335782|gb|ABX62087.1| protein of unknown function DUF140 [Brucella canis ATCC 23365]
 gi|260155959|gb|EEW91039.1| sulfate transporter/antisigma-factor [Brucella suis bv. 4 str. 40]
 gi|261744734|gb|EEY32660.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
          Length = 391

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 153/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F S  H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISHLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|328543112|ref|YP_004303221.1| ABC transporter permease protein [Polymorphum gilvum SL003B-26A1]
 gi|326412858|gb|ADZ69921.1| ABC transporter permease protein [Polymorphum gilvum SL003B-26A1]
          Length = 381

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 127/371 (34%), Positives = 202/371 (54%), Gaps = 6/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +        +G+W      +    +   +  +    +  +DLS I+ +DT GA L+    
Sbjct: 17  DGDRLAVALSGDWTIHTAMDAEAAL--GVIDTSDVGTVRIDLSGISVLDTSGAWLLHRMR 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +         ++    +   L+S           P+   +  S  ++    G+ +V   
Sbjct: 75  GRIEFAGVRVILTGVAPKYELLLSEVDAHHPPPWSPE--RYRYSIVSVLETTGRHVVDAG 132

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D  +  HILG +            + +G   S+  Q     +  VP++ L+SF+ GA+I
Sbjct: 133 KDLVAMMHILGSLSVVVAGVLFRPGRLRGI--SIAVQFDKSCIGAVPIIALMSFLIGAII 190

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F L QFGA++F +DL  +L LREIGVLLTA+M+AGRSGSA  AE+GSMK+ EEID
Sbjct: 191 AQQGGFYLRQFGADLFVVDLAGVLVLREIGVLLTAIMVAGRSGSAFTAELGSMKMQEEID 250

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL    +LI PR+ AL++++P+LT +++ +A+ G+ +V W Y  IP A + +R  
Sbjct: 251 ALHVIGLSVTEVLILPRLLALMVAMPVLTFVSDIAALFGSGLVTWSYLGIPPAAYMARLE 310

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
              +      G++KAPFMA  IG++A  EG  VG  ++SLG+  T  VV++I +VI++D 
Sbjct: 311 EAISFQTFLVGMVKAPFMALIIGLIACVEGLKVGGSADSLGRHTTMSVVKAIFLVIVVDG 370

Query: 363 LFAIFYFAIGI 373
           LFAIF+ AI +
Sbjct: 371 LFAIFFAAIDV 381


>gi|317178170|dbj|BAJ55959.1| hypothetical protein HPF16_1362 [Helicobacter pylori F16]
          Length = 377

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKEGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +P+ IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPISILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|254701770|ref|ZP_05163598.1| Sulfate transporter/antisigma-factor [Brucella suis bv. 5 str. 513]
 gi|261752323|ref|ZP_05996032.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261742076|gb|EEY30002.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
          Length = 391

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 153/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V   Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSCLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|254693733|ref|ZP_05155561.1| hypothetical protein Babob3T_03544 [Brucella abortus bv. 3 str.
           Tulya]
 gi|261214007|ref|ZP_05928288.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260915614|gb|EEX82475.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
          Length = 391

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLAALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|94309017|ref|YP_582227.1| hypothetical protein Rmet_0072 [Cupriavidus metallidurans CH34]
 gi|93352869|gb|ABF06958.1| ABC transporter, inner membrane subunit [Cupriavidus metallidurans
           CH34]
          Length = 376

 Score =  254 bits (649), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 101/368 (27%), Positives = 166/368 (45%), Gaps = 14/368 (3%)

Query: 9   FRFAGNWKSPEISEIADDV---VMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
            +  G W +  ++   +           S     A   L  IT +D IGA+LI      +
Sbjct: 20  VQLQGEWTAVALAGCHEARGLRAQLHELSEAPRHAEWSLDGITRLDHIGAQLIWQAWNGH 79

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L         +    +            N    +G  ++ F+   
Sbjct: 80  M---------PDNVSLNDGQKRVFARIAGLRTEGWKKHMVERFNPVTIVGASVLSFLAQL 130

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG ++ +   F  +    +G    +   +Y VG   + +  L++F+ G V++  
Sbjct: 131 GVGVTMLGQLVFDLLRFLRAPQ--RGPWREISANIYNVGYKALGITALVAFLIGIVLSYL 188

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  F ++++ +  +RE+G +L A++IAGRSGSAI A+IG M++ EE+DA+ 
Sbjct: 189 SANQLRIFGASTFIVNILGMAVIRELGPVLAAILIAGRSGSAITAQIGVMRVTEELDAMS 248

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     L+ PR+ AL IS+PLL    +  A+ G  +      DI +  F  +     
Sbjct: 249 VMGISHGFRLVMPRVIALAISMPLLVAWTDLLALFGGMVAARLQLDISYVYFLRQLPDAV 308

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN++ GL K       I + A   G  V  ++ SLG+  T  VV SI++VII D++FA
Sbjct: 309 PVANLWFGLCKGVVFGMLIALTACHFGLRVKPNTQSLGQGTTASVVTSITVVIIADAVFA 368

Query: 366 IFYFAIGI 373
           I +  IGI
Sbjct: 369 ILFKDIGI 376


>gi|153951693|ref|YP_001398923.1| ABC transporter permease [Campylobacter jejuni subsp. doylei
           269.97]
 gi|152939139|gb|ABS43880.1| putative ABC transporter, permease protein [Campylobacter jejuni
           subsp. doylei 269.97]
          Length = 369

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 114/369 (30%), Positives = 187/369 (50%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   + EIDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKEIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSRFQTLFELCEKNYQRLNKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LRKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL+KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLVKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVILTSAGI 369


>gi|221639257|ref|YP_002525519.1| ABC transporter inner membrane subunit [Rhodobacter sphaeroides
           KD131]
 gi|221160038|gb|ACM01018.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           KD131]
          Length = 356

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 109/363 (30%), Positives = 191/363 (52%), Gaps = 9/363 (2%)

Query: 11  FAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
             G      + E    +              +D++A+  +DT GA  I+   ++     +
Sbjct: 3   LRGRLTIETLPETQRSLGSV------GAGGQIDMAAVEALDTAGAWAILQAQKRAEAAGQ 56

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
              +    E    L+       +   + +R        +   ++G+++ + +  S +   
Sbjct: 57  ALEIVNLSESHRHLLETV-AAAMPEPERRRRTIPGRPDDGLANLGQEVAQGLRGSLTSVG 115

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
             G V+++ G       + K  L  L+  M   G + VP+V L+ F+ G V+A QG+ QL
Sbjct: 116 FFGEVVAHLGALVLHPTRLK--LTPLVHHMQEAGWNAVPIVSLMGFLIGIVLAFQGSTQL 173

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
             FGAE++ +DL++I  LRE+G+LLTA+++AGRS SA  A IGSMK+ EEIDA+R +GLD
Sbjct: 174 KSFGAEVYVVDLVAISILRELGILLTAIIVAGRSASAFTAAIGSMKMREEIDAMRVLGLD 233

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
            +  L+ PR+ AL+I LP L  +A+ + ++G  ++ W    I   +F ++  +   +++ 
Sbjct: 234 PIDRLVLPRLIALVILLPALGFIASLAGLVGGGLMAWIDLGITPGMFRTQLLADTDVSHA 293

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
             GL+KAPF A  I ++   +G  V  ++ SLG   +  VVQ+I +VI++D+LF+IF+  
Sbjct: 294 IIGLVKAPFFAVIIAVIGCHQGMQVSGNAESLGSHTSRSVVQAIFLVIVVDALFSIFFAV 353

Query: 371 IGI 373
            G+
Sbjct: 354 WGL 356


>gi|123441584|ref|YP_001005570.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088545|emb|CAL11339.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 381

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 117/364 (32%), Positives = 185/364 (50%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W       +   V     ++ Q  S + DL+ +  +DT GA L+   +      
Sbjct: 21  VSIKGDWVLAHYRVLEPVVTQ--FRASQPQSVVFDLTQLGALDTAGATLLALLLGDERIN 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              +      E+  +L+    R              + +     + G+ +     D  S 
Sbjct: 79  HLRELAPKLPEERRTLLETVSRVLPDLASESSEKPPSFWLEFLANTGRSVDNLWQDIKSL 138

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA 
Sbjct: 139 LGFVGLTLEALFSTIFRPSRWRM--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGAT 196

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+G
Sbjct: 197 VLTTFGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLG 256

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L+ V +L+ PR+ AL+ISLP+LT +     I G  +V     DI   +F S   ++  L 
Sbjct: 257 LNPVELLVLPRVLALLISLPMLTFIGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQ 316

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+
Sbjct: 317 HFLVGISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFF 376

Query: 369 FAIG 372
             +G
Sbjct: 377 MEMG 380


>gi|238764189|ref|ZP_04625142.1| ABC transporter, permease protein [Yersinia kristensenii ATCC
           33638]
 gi|238697602|gb|EEP90366.1| ABC transporter, permease protein [Yersinia kristensenii ATCC
           33638]
          Length = 381

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 116/360 (32%), Positives = 184/360 (51%), Gaps = 4/360 (1%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G+W      ++   V     ++    S + DL+ +  +DT GA L+   + +        
Sbjct: 25  GDWVLAHYRDLEPVVAQ--FRTNPPPSVVFDLNQLGALDTAGATLLALLLGESRINNLRD 82

Query: 73  GVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHIL 132
                 E+   L+    R                +  L  + G+ +     D  S    +
Sbjct: 83  LAPKLPEERRILLETVSRVLPDLTAASSEKLPPFWLELLANTGRSVDNLWQDIKSLLGFV 142

Query: 133 GLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQ 192
           GL +           +++    SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ 
Sbjct: 143 GLTLEALFSTIFRPSRWRM--TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTT 200

Query: 193 FGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFV 252
           FGA IF++DL+    LRE  VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V
Sbjct: 201 FGAGIFTVDLVVFSFLREFAVLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPV 260

Query: 253 RILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFT 312
            +L+ PR+ AL++SLP+LT +     I G  +V     DI   +F S   ++  L +   
Sbjct: 261 ELLVLPRVLALLVSLPMLTFIGMVCGIFGGMVVCALTLDISPTMFLSIMQNSNGLQHFLV 320

Query: 313 GLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           G+ KAP  A  I I+   EGF V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 321 GISKAPIFAFLIAIIGCLEGFKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 380


>gi|240137395|ref|YP_002961866.1| putative ABC transporter, permease [Methylobacterium extorquens
           AM1]
 gi|240007363|gb|ACS38589.1| Putative ABC transporter, permease [Methylobacterium extorquens
           AM1]
          Length = 382

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 135/373 (36%), Positives = 205/373 (54%), Gaps = 12/373 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           + G       G W + +     +     I    ++   +VDLS +  +DT+GA ++    
Sbjct: 18  DAGGGRVILHGRWTADQ-GPAVESASARIAAQGRTQPVLVDLSGLARLDTLGAWVLERTR 76

Query: 63  ---EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
              E   G++   G       L   +        +  +P      N         G+++ 
Sbjct: 77  AEIEAAGGRLAYAGARPEHRILLGEMGL------REPEPVPQDTRNPALRFLDTTGQRVA 130

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +  N+  S    LG V++  G        F+    +L+ Q+  V + GVP+++LISF+ G
Sbjct: 131 RGGNEILSGIAFLGEVVAAGGRVARRPQTFRM--AALVNQLEQVALRGVPIIVLISFLVG 188

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            ++AQQG FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ E
Sbjct: 189 GIVAQQGIFQLQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMRE 248

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+R MGLD + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +
Sbjct: 249 EVDALRVMGLDPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTTDAFLA 308

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R  +  +  +   GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI+
Sbjct: 309 RLQAAVSFHHFAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIV 368

Query: 360 IDSLFAIFYFAIG 372
           +D LFA+F+ AI 
Sbjct: 369 LDGLFAVFFAAID 381


>gi|198282934|ref|YP_002219255.1| hypothetical protein Lferr_0798 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218665617|ref|YP_002425137.1| ABC transporter, permease protein, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|198247455|gb|ACH83048.1| protein of unknown function DUF140 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218517830|gb|ACK78416.1| ABC transporter, permease protein, putative [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 378

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 96/371 (25%), Positives = 172/371 (46%), Gaps = 17/371 (4%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G    R +G W    +         A+     S     DLSA+  +D+ GA L+    
Sbjct: 23  DDG--TLRLSGRWTLRRLGGRFAAQEAALRNI--SPEVCWDLSAVEVLDSAGALLLWRAW 78

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
             +     L       +Q  S+ +     +    +P+  +           +G  +++  
Sbjct: 79  GNH-----LPNNIRMADQHHSIFARLADIQPVAARPRHPWH------FLDQLGAFLIETG 127

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D      ++G ++   G        F      +   +   G + +P++ LI F+ G VI
Sbjct: 128 RDLWGLFLLMGALLLEFGRGLRHPRSFP--WREISATIVNTGPNSLPILTLIGFLIGVVI 185

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           + Q A  L+Q+GA I+ I++  +  LRE G L+TA++++GRSGSA  A+IG M + EE+D
Sbjct: 186 SFQSASTLAQYGANIYIINIAGLSILREFGPLITAIILSGRSGSAFTAQIGGMCVTEELD 245

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT G+  +R LI P++  L + +PLL +  +   + GA +V      I    F  +  
Sbjct: 246 ALRTFGIPPIRRLILPKVIGLALVMPLLVLWTDMVGLYGAMLVAKLELGISNRFFIQQMP 305

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                 N++ G++K       I  +A   G  V  ++ SL ++ T  VV SI+++I+ID+
Sbjct: 306 VVVPSFNLWLGVVKGALFGILIAWIAGFHGLKVKPNTTSLSRETTNSVVMSITVMILIDA 365

Query: 363 LFAIFYFAIGI 373
           + A+ +   GI
Sbjct: 366 ILALVFANTGI 376


>gi|218528881|ref|YP_002419697.1| hypothetical protein Mchl_0851 [Methylobacterium chloromethanicum
           CM4]
 gi|218521184|gb|ACK81769.1| protein of unknown function DUF140 [Methylobacterium
           chloromethanicum CM4]
          Length = 381

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 134/372 (36%), Positives = 204/372 (54%), Gaps = 12/372 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM- 62
           +        G W + +     +     I    ++   +VDLS +  +DT+GA ++     
Sbjct: 18  DAGGRVILHGRWTADQ-GPAVESASARIAAQGRTQPVLVDLSGLARLDTLGAWVLERTRA 76

Query: 63  --EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
             E   G++   G       L   +        +  +P      N         G+++ +
Sbjct: 77  EIEAAGGRLAYAGARPEHRILLGEMGL------REPEPVPQDTRNPVLRFLDTTGQRVAR 130

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
             N+  S    LG V++  G        F+    +L+ Q+  V + GVP+++LISF+ G 
Sbjct: 131 GGNEILSGIAFLGEVVAAGGRVARRPQTFRM--AALVNQLEQVALRGVPIIVLISFLVGG 188

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++AQQG FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ EE
Sbjct: 189 IVAQQGIFQLQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMREE 248

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MGLD + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F +R
Sbjct: 249 VDALRVMGLDPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTTDAFLAR 308

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +  +  +   GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI++
Sbjct: 309 LQAAVSFHHFAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVIVL 368

Query: 361 DSLFAIFYFAIG 372
           D LFA+F+ AI 
Sbjct: 369 DGLFAVFFAAID 380


>gi|254719095|ref|ZP_05180906.1| Sulfate transporter/antisigma-factor [Brucella sp. 83/13]
 gi|265984086|ref|ZP_06096821.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306838379|ref|ZP_07471224.1| Sulfate transporter/antisigma-factor [Brucella sp. NF 2653]
 gi|264662678|gb|EEZ32939.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306406519|gb|EFM62753.1| Sulfate transporter/antisigma-factor [Brucella sp. NF 2653]
          Length = 391

 Score =  253 bits (647), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 153/369 (41%), Positives = 216/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FG EIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGTEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|317182671|dbj|BAJ60455.1| hypothetical protein HPF57_1381 [Helicobacter pylori F57]
          Length = 377

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +P+ IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPISILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|16126557|ref|NP_421121.1| ABC transporter permease [Caulobacter crescentus CB15]
 gi|221235339|ref|YP_002517776.1| ABC transporter permease protein [Caulobacter crescentus NA1000]
 gi|13423841|gb|AAK24289.1| ABC transporter, permease protein, putative [Caulobacter crescentus
           CB15]
 gi|220964512|gb|ACL95868.1| ABC transporter permease protein [Caulobacter crescentus NA1000]
          Length = 371

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 110/371 (29%), Positives = 187/371 (50%), Gaps = 11/371 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G  V   AG+W +  + +    +  A+           DL+ +   DT GA  I+   
Sbjct: 12  QDGGLVAVLAGDWTARGLFDAGPRLTEALEDR---RDLRFDLTGVNRCDTAGAYAILRAA 68

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                K         + +L  L+    + +     PQR+     F  L   IG+ +    
Sbjct: 69  GD-RLKSDRIIARKQVLRLLELVGAAIKVE-----PQRAARPTGFYALLERIGRGVFGLF 122

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D       LG ++   G    S ++ +     ++      G+  +P++   +F  GAV+
Sbjct: 123 ADGYGTLVFLGHLLVALGRSIVSPHRIR--WAPIVALCERAGLDAMPIIATTTFFIGAVV 180

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L+ FGA++++++L+ I  +RE  +L+TA+++AGRS S+  AEIGSMK+N+EID
Sbjct: 181 ALLGANMLTDFGAQVYAVELIGISVMREFNILITAILLAGRSASSFAAEIGSMKMNQEID 240

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MG+D    L+ PR  AL++++PLLT +A  + + G  +V+W   D+    F  R  
Sbjct: 241 AMQVMGVDPYEALVLPRFAALLLTIPLLTFVATIAGLAGGILVVWSVLDLSPTFFLQRIV 300

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                 + + GL KAP MA  I  +  ++G  VG    SLG++VT  VV +I  +I+ID+
Sbjct: 301 DYVGATHFWIGLSKAPVMAMVIAAIGCRQGMEVGKDIESLGRRVTAAVVHAIFAIILIDA 360

Query: 363 LFAIFYFAIGI 373
           +FA+ Y  + I
Sbjct: 361 VFALIYMELDI 371


>gi|317014880|gb|ADU82316.1| hypothetical protein HPGAM_07715 [Helicobacter pylori Gambia94/24]
          Length = 377

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 179/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFRTSVFRLDELKKNLLDH--QGPLKVDFSGCQKIDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK +V+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEDDLESKKAGKKYEL---MITKLGKSLVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|217978940|ref|YP_002363087.1| protein of unknown function DUF140 [Methylocella silvestris BL2]
 gi|217504316|gb|ACK51725.1| protein of unknown function DUF140 [Methylocella silvestris BL2]
          Length = 379

 Score =  253 bits (646), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 144/370 (38%), Positives = 216/370 (58%), Gaps = 6/370 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           SE G+   + AG+W     ++I +     +     +  AI DL+ +  +DT GA LI   
Sbjct: 14  SEEGVR-LKLAGHWTLDACADIEEGAQALVGAGAGAKHAIFDLAGVQRMDTAGAWLIDGA 72

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++   K      +    ++  L+   H +  +    ++ F+      L   +G+ +V  
Sbjct: 73  RQQLDAKGVSADFAGGRPEIDILLKEAHFRSFEQPPGRKGFY---IVTLLADVGESVVAS 129

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D       LG V+++ G+       F+G   +L+ Q+  + + GVP+++LI+F+ GA+
Sbjct: 130 GRDIYRGVEFLGEVVASIGKSVIQPAHFRG--TALVAQIETIALRGVPIIVLINFLVGAI 187

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +AQQG FQL +FGA I  +DL+ IL LRE+GVLLTA+MI+GRSGSAI AE+GSMK+ EEI
Sbjct: 188 VAQQGIFQLRRFGATILVVDLIGILILRELGVLLTAIMISGRSGSAITAELGSMKMREEI 247

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MGL  + +LI+PRI ALI+SLPLLT LA+ +A+ G  +V W Y  I    F +  
Sbjct: 248 DALVVMGLRPIDVLIAPRILALILSLPLLTFLADMAALAGGILVSWLYGGITPKSFIALL 307

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L    +GLIKAPFM   IG++A  EG AV   + SLG++VT  VV+SI +VI++D
Sbjct: 308 PEAIALRTFLSGLIKAPFMGLIIGLIACMEGLAVAGSAESLGRQVTASVVKSIFMVIVVD 367

Query: 362 SLFAIFYFAI 371
            LFA+F+  I
Sbjct: 368 GLFAVFFATI 377


>gi|315585855|gb|ADU40236.1| ABC superfamily ATP binding cassette transporter permease protein
           [Helicobacter pylori 35A]
          Length = 377

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 179/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKVGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +P+ IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPISILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|308062730|gb|ADO04618.1| putative ABC transport system permease protein [Helicobacter pylori
           Cuz20]
          Length = 377

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 107/371 (28%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  + S  Y     +   +GK IVK  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKASKRYEL---MITKLGKSIVKTY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|264676422|ref|YP_003276328.1| inner membrane ABC-transporter component [Comamonas testosteroni
           CNB-2]
 gi|299533747|ref|ZP_07047119.1| putative ABC transporter, permease protein [Comamonas testosteroni
           S44]
 gi|262206934|gb|ACY31032.1| putative inner membrane ABC-transporter component [Comamonas
           testosteroni CNB-2]
 gi|298718296|gb|EFI59281.1| putative ABC transporter, permease protein [Comamonas testosteroni
           S44]
          Length = 375

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 99/371 (26%), Positives = 174/371 (46%), Gaps = 10/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S  G      AG W + E+ +      +A         A  DL  +   D IGA+L+   
Sbjct: 14  SREGQQWAVPAGRWSAAELGDRHIWRRLAPQIRAVPKGAAWDLQQMVWFDHIGAQLLWEQ 73

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             K      L   +          S   R    ++ P+     + +      +G+ ++  
Sbjct: 74  WGKAWPAQLLTTKTQR--------SMLERVARFSEVPESKPEPSGWMCEVNRLGQMVIDA 125

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                +   ++G ++ +      +    +G    +   +Y  G + +P+  L+ F+ G V
Sbjct: 126 CGHFSNLIQLVGQLLLDCLRLLRNP--LRGPWRDISGHLYATGATALPITALVGFLIGVV 183

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A   A QL QFGAE F ++++ I  +RE+G LL A+++AGRSGSAI A+IG M++ EE+
Sbjct: 184 LAYLMALQLRQFGAESFIVNILGISLIRELGPLLAAILVAGRSGSAITAQIGVMRVTEEL 243

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MG+     L+ PR  AL +S+PL+ +    +A+ G  +      DI  + F    
Sbjct: 244 DAMQVMGISQGYRLVLPRALALAVSMPLVALWTILAALAGGMVAADLTMDITPSYFVQSL 303

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            +   + N+   + K+      I ++    G  V  ++ SLG+  T  VV SI++VII+D
Sbjct: 304 PAAVKVGNLVLAMGKSVVFGVLIALIGCHWGLKVEPNTQSLGRGTTAAVVSSITMVIIVD 363

Query: 362 SLFAIFYFAIG 372
           ++FAI +  +G
Sbjct: 364 AIFAILFRNVG 374


>gi|261840140|gb|ACX99905.1| hypothetical protein HPKB_1368 [Helicobacter pylori 52]
          Length = 377

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +P+ IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPISILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|34558310|ref|NP_908125.1| toluene ABC transporter permease [Wolinella succinogenes DSM 1740]
 gi|34484029|emb|CAE11025.1| conserved hypothetical protein-ABC-type toluene export system,
           permease component [Wolinella succinogenes]
          Length = 366

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 102/368 (27%), Positives = 182/368 (49%), Gaps = 16/368 (4%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---ME 63
                 G W      E+   + +A  +   S    V L  ++ +D   A L++     ++
Sbjct: 10  LRLILRGQWDYELPKELISRLFLACKRD--SVRVSVSLLGVSSLDYSAATLLLELSMAVK 67

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +  G+   +GV   I  +  ++  + R          S            +G+KI + + 
Sbjct: 68  RRGGEWAWEGVPPAIAPILGIVKESKRDLPAPPPSLSS---------LLRLGEKIKESLK 118

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                A  LG  +   G     S   +  L + +  +   G+  VP++ L SF+ G V+A
Sbjct: 119 GLGRFASFLGETLFAMGRSLKESRLIR--LKATLYHIEESGIKAVPIIALTSFLVGIVMA 176

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            QGA QL +FGA I  +++  +L LRE+G ++ A+++AGRS S+  A+IG MKI EEIDA
Sbjct: 177 YQGAIQLEKFGASIIVVEMTGMLTLRELGPVIAAIVVAGRSASSYAAQIGVMKITEEIDA 236

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++TM  +    L+ PR+ AL++ +PL+  L+N + ++G  ++I  Y  I +  +  RF+ 
Sbjct: 237 MKTMNFNPYAFLVIPRVIALVVVMPLVIFLSNVAGLLGEMLIIKSYLGIGYLQYIERFYE 296

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +++ GLIKAPF    I ++    GF +   + S+G+  T  VV +I  VI ++++
Sbjct: 297 MVEIRHLWVGLIKAPFYGAIIALIGCFRGFQITGSTESVGRYTTISVVNAIFWVIALNAM 356

Query: 364 FAIFYFAI 371
           F+I +   
Sbjct: 357 FSIIFTEY 364


>gi|304391808|ref|ZP_07373750.1| ABC transporter, membrane spanning protein [Ahrensia sp. R2A130]
 gi|303296037|gb|EFL90395.1| ABC transporter, membrane spanning protein [Ahrensia sp. R2A130]
          Length = 385

 Score =  253 bits (646), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 133/370 (35%), Positives = 211/370 (57%), Gaps = 7/370 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G+ V   +G W    I E+ DD+         S   +++ +A T++DT GA LI   
Sbjct: 21  NTDGVLV-TASGPWTIAFIEEVDDDIRA--FSIEGSAKLVLNTTAATQLDTSGAWLIERL 77

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++               +   L+   HR++    +        S++     +G+  ++F
Sbjct: 78  RQRVEEAGIAFSHEDDEPRRQQLVDVIHRRE--RPETDAPTQTKSWRGPIVRLGEIGIEF 135

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D  +  +ILG  +        S    +    S++ Q+  +G   VPVV ++SF+ GA+
Sbjct: 136 GRDLMTALYILGSSVRGPSSNGGSGRGLRVM--SILNQIDQMGWRAVPVVFVMSFLIGAI 193

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGA+Q+  +G E+ +I L+ IL  RE+GVLLT++M+AGRSGSAI AEIG+MK+ EEI
Sbjct: 194 IAQQGAYQMQAYGEELLAISLVGILHFREVGVLLTSIMVAGRSGSAITAEIGTMKMREEI 253

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL+ V +L+ PR+ A++I LP+LT+L+N + I+GA +V+  Y  I  + F +  
Sbjct: 254 DALQVMGLNPVGVLLFPRLLAIMICLPILTLLSNIAGIMGAMVVMDIYVGITPSQFITTL 313

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
               +  ++  GL KAP MA  IG+VA  EG  VG  S SLG++ T  VV+SI +VI++D
Sbjct: 314 TEDISPRHLAVGLAKAPVMALIIGLVAAVEGLKVGGSSESLGQRTTAAVVKSIFLVIVVD 373

Query: 362 SLFAIFYFAI 371
            LF IF+ A+
Sbjct: 374 GLFTIFFSAM 383


>gi|113866165|ref|YP_724654.1| putative uncharacterized transport protein [Ralstonia eutropha H16]
 gi|113524941|emb|CAJ91286.1| putative uncharacterized transport protein [Ralstonia eutropha H16]
          Length = 378

 Score =  252 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 98/373 (26%), Positives = 167/373 (44%), Gaps = 14/373 (3%)

Query: 4   NGITVFRFAGNWKSPEIS--EIADDVVMAINKSIQS-DSAIVDLSAITEIDTIGAELIMY 60
           +G       G+W +  ++    A  +   +++  Q+ DSA   L+ +  +D IG +L+  
Sbjct: 17  DGTVSVALRGDWTALALAGCHQARQLRAQLHELAQAPDSAQWSLAGVERLDHIGGQLLWQ 76

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                       G                 +    Q            N     G  ++ 
Sbjct: 77  AWN---------GALPQRLDASEGQRRVFERIAAVQNEGWKKHMVDRFNPITLFGANVLS 127

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F     S   +LG +  +   F       +G    +   +Y VG   + +  L+ F+ G 
Sbjct: 128 FGAQLRSGITMLGQLAFDLLRFAGVPQ--RGPWREISANIYNVGYKALGITALVGFLIGI 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V++   A QL  FGA  F ++++ +  +RE+G +L A++IAGRSGSAI A+IG M++ EE
Sbjct: 186 VLSYLSANQLRTFGASTFIVNILGMAVIRELGPVLAAILIAGRSGSAITAQIGVMRVTEE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     LI PR+ AL I++PLL    +  A+ G  +       I    F   
Sbjct: 246 LDAMRVMGISHGFRLIMPRVIALAIAMPLLVAWTDVMALAGGMLAARMQLGISATFFLRE 305

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 +AN++ GL K       I + A   G  +  ++ SLG+  T  VV +I+IVI+ 
Sbjct: 306 LPDAVPVANLWLGLGKGVVFGILIALTACHFGLRIKPNTQSLGEGTTASVVTAITIVILA 365

Query: 361 DSLFAIFYFAIGI 373
           D++FA+ +  +G+
Sbjct: 366 DAVFAVLFKDVGL 378


>gi|115353001|ref|YP_774840.1| hypothetical protein Bamb_2950 [Burkholderia ambifaria AMMD]
 gi|115282989|gb|ABI88506.1| protein of unknown function DUF140 [Burkholderia ambifaria AMMD]
          Length = 374

 Score =  252 bits (645), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 99/366 (27%), Positives = 169/366 (46%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   +        +  DLS I  +D +G + +     +   
Sbjct: 19  TVRLYGQWTALALARNRGAVARRVAGIASGRVSEWDLSGIERLDHVGGQALWRVWGR--- 75

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             KL           ++     R   + + P+R   +     L    G  +  F      
Sbjct: 76  --KLPDGVALSPTQRTIFERIERLDSQREAPERVVHFGPITRL----GFMLFAFAEHLQG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + GLVI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGLVILDALSVLRRPKTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 248 GIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDINYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIM 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|261838741|gb|ACX98507.1| ABC transport system permease [Helicobacter pylori 51]
          Length = 377

 Score =  252 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 179/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGADSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|188590871|ref|YP_001795471.1| hypothetical protein RALTA_A0076 [Cupriavidus taiwanensis LMG
           19424]
 gi|170937765|emb|CAP62749.1| conserved hypothetical protein, DUF140; putative TRANSMEMBRANE
           PROTEIN [Cupriavidus taiwanensis LMG 19424]
          Length = 376

 Score =  252 bits (645), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 96/373 (25%), Positives = 168/373 (45%), Gaps = 14/373 (3%)

Query: 4   NGITVFRFAGNWKSPEIS--EIADDVVMAINKSIQSDS-AIVDLSAITEIDTIGAELIMY 60
           +G    +  G+W +  ++    A  +   +++  Q+   A   L+ +  +D IG +L+  
Sbjct: 15  DGTVSVQLRGDWTALALAGCHQARQLRAQLHELAQAPDHAQWSLAGVERLDHIGGQLLWQ 74

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                       G      +          +    Q            N    +G  ++ 
Sbjct: 75  AWN---------GALPQRLEASEGQRRVFARIAAVQDEGWKKHMVDRFNPVTLLGANVMS 125

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F     +   +LG +  +   F       +G    +   +Y VG   + +  L+ F+ G 
Sbjct: 126 FGVQLGNGITMLGQLAFDLLRFARMPQ--RGPWREISANIYNVGYKALGITALVGFLIGI 183

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V++   A QL  FGA  F ++++ +  +RE+G +L A++IAGRSGSAI A+IG M++ EE
Sbjct: 184 VLSYLSANQLRTFGASTFIVNILGMAVIRELGPVLAAILIAGRSGSAITAQIGVMRVTEE 243

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     LI PR+ AL I++PLL    +  A+ G  +       I    F   
Sbjct: 244 LDAMRVMGISHGFRLIMPRVIALAIAMPLLVAWTDVMALAGGMLAARMQLGISATFFLRE 303

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 +AN++ GL K       I + A   G  +  ++ SLG+  T  VV +I+IVI+ 
Sbjct: 304 LPDAVPVANLWLGLGKGVVFGILIALTACHFGLRIKPNTQSLGEGTTASVVTAITIVILA 363

Query: 361 DSLFAIFYFAIGI 373
           D++FAI +  +G+
Sbjct: 364 DAVFAILFKDVGL 376


>gi|308185234|ref|YP_003929367.1| putative ABC transport system permease protein [Helicobacter pylori
           SJM180]
 gi|308061154|gb|ADO03050.1| putative ABC transport system permease protein [Helicobacter pylori
           SJM180]
          Length = 377

 Score =  252 bits (644), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 106/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  + S  Y     L   +GK +V+  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKASKQYEL---LITKLGKSLVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|188528238|ref|YP_001910925.1| hypothetical protein HPSH_07510 [Helicobacter pylori Shi470]
 gi|188144478|gb|ACD48895.1| hypothetical protein HPSH_07510 [Helicobacter pylori Shi470]
 gi|308064225|gb|ADO06112.1| putative ABC transport system permease protein [Helicobacter pylori
           Sat464]
          Length = 377

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKVGKRYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|311694463|gb|ADP97336.1| ABC transporter, permease protein [marine bacterium HP15]
          Length = 388

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 186/365 (50%), Gaps = 5/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
                G+W       ++       ++ +      ++LS +T IDT GA  +   +     
Sbjct: 28  TLSVNGDWLLSHYRSLSSLASSMSSRDLI--KLSINLSGLTRIDTAGASQLASLIGPERL 85

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  S    +  +LI+      +KNQ        +   +     G+K+         
Sbjct: 86  LEAASADSELPRETSALIAAVCEA-MKNQPEADRRSPSLVWSFVTGTGQKVESIFRLLWI 144

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +G  +          ++++      +  ++  G++ +P+V L++F+ GAV+A  GA
Sbjct: 145 LVGFIGQTLGTLAWNLPRPWRWRM--TPFVAAVHDTGLNALPIVALLTFLVGAVVAFLGA 202

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L  FGA I++++L++   LRE GVLL A+++AGR+ SA  A IG+MK+NEE+DAIRT+
Sbjct: 203 TVLDDFGATIYTVNLVAFSFLREFGVLLAAILLAGRTASAFTAHIGAMKVNEELDAIRTL 262

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL+ + +L+ PR+ A+++SLP+LT +   S ++G ++V     DI    F +       L
Sbjct: 263 GLNPIELLVLPRVMAMMVSLPILTFVGMISGMVGGAMVCALVLDITPTQFMAIVERDIAL 322

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +   G++KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI++DS+ A+F
Sbjct: 323 QHFVVGIVKAPIFAFLIAVIGCLEGFKVAGSAQSVGEHTTSSVVQSIFMVILLDSIAALF 382

Query: 368 YFAIG 372
           +  +G
Sbjct: 383 FMEMG 387


>gi|317179642|dbj|BAJ57430.1| hypothetical protein HPF30_1333 [Helicobacter pylori F30]
          Length = 377

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 106/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KERSLDIELCNVSENNACALKVVKDWLEKEEDLESKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|119897565|ref|YP_932778.1| putative ABC transporter permease [Azoarcus sp. BH72]
 gi|119669978|emb|CAL93891.1| putative ABC transporter permease protein [Azoarcus sp. BH72]
          Length = 380

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 124/372 (33%), Positives = 199/372 (53%), Gaps = 5/372 (1%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++  G  V R +G+W       IAD V              VD S +  +DT GA L++ 
Sbjct: 13  LAAAGGGVLRLSGDWTLAHYRSIADTVSALRANVQHG--TAVDASGLGALDTAGASLLVQ 70

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
            +  + G   L        +  +L+           +P+ +   ++  ++  HIG  +  
Sbjct: 71  LLG-HDGLQALSTDPALAPERRALLRAVADALATPPEPEPADTGSALGDVLEHIGIAMGV 129

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F   +      +GL + +     A   +++  L +L   +    +  VP+V L++F+ GA
Sbjct: 130 FWRHAVGLLGFIGLTLESAFRIIAQPARWR--LTALAANLEKTALDAVPIVALLTFLVGA 187

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A  GA  L+ FGA IF++DL++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEE
Sbjct: 188 VVAFLGATVLADFGASIFTVDLVAFSFLREFGVLLTAILVAGRTASAFTAQIGSMKANEE 247

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIR +GLD V +L+ PR++AL+++LP+LT +A  S I+G  +V     DI   +F S 
Sbjct: 248 IDAIRVLGLDPVELLVLPRVYALLLALPMLTFVAMLSGIVGGMLVCALTLDISPVMFLSI 307

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           F +   L +   G+ KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI++
Sbjct: 308 FENDVGLRHFIVGIAKAPIFAFLIAVIGCLEGFKVSGSAQSVGEHTTSAVVQSIFVVIVV 367

Query: 361 DSLFAIFYFAIG 372
           D++ A+    +G
Sbjct: 368 DAVAALLCMELG 379


>gi|163850324|ref|YP_001638367.1| hypothetical protein Mext_0891 [Methylobacterium extorquens PA1]
 gi|254559575|ref|YP_003066670.1| ABC transporter permease [Methylobacterium extorquens DM4]
 gi|163661929|gb|ABY29296.1| protein of unknown function DUF140 [Methylobacterium extorquens
           PA1]
 gi|254266853|emb|CAX22652.1| Putative ABC transporter, permease [Methylobacterium extorquens
           DM4]
          Length = 382

 Score =  252 bits (644), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 135/374 (36%), Positives = 206/374 (55%), Gaps = 14/374 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +  G  +    G W + +     +     I    ++   +VDLS +  +DT+GA ++   
Sbjct: 19  AAGGRVILH--GRWTADQ-GPAVESASARIAAQGRTQPVLVDLSGLARLDTLGAWVLERT 75

Query: 62  M---EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
               E   G++   G       L   +        +  +P      N         G+++
Sbjct: 76  RAEIEAAGGRLAYAGARPEHRILLGEMGL------REPEPVPQDTRNPALRFLDTTGQRV 129

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
            +  N+  S    LG V++  G        F+    +L+ Q+  V + GVP+++LISF+ 
Sbjct: 130 ARGGNEILSGIAFLGEVVAAGGRVARRPQTFRM--AALVNQLEQVALRGVPIIVLISFLV 187

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++AQQG FQL +FGA+ F ++L+ +L LRE+GVLLT++M+AGRSGSA  AEIGSM++ 
Sbjct: 188 GGIVAQQGIFQLQRFGAQSFVVNLIGLLILRELGVLLTSIMVAGRSGSAFTAEIGSMRMR 247

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+R MGLD + ILI PRI AL+I LP+L  L + +A+ G  +    Y  +    F 
Sbjct: 248 EEVDALRVMGLDPIEILILPRILALVIGLPILAFLGSLAALAGGGLTAAIYGGMTTDAFL 307

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +R  +  +  +   GLIKAPFMA  IGI+A  EGFAV   + SLG+ VT  VV+SI +VI
Sbjct: 308 ARLQAAVSFHHFAVGLIKAPFMALTIGIIATIEGFAVEGSAESLGRHVTASVVKSIFMVI 367

Query: 359 IIDSLFAIFYFAIG 372
           ++D LFA+F+ AI 
Sbjct: 368 VLDGLFAVFFAAID 381


>gi|283957032|ref|ZP_06374504.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 1336]
 gi|283791533|gb|EFC30330.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 1336]
          Length = 369

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 113/369 (30%), Positives = 186/369 (50%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSRFQTLFELCEKNYQRLSKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LRKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL+KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLVKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVILTSAGI 369


>gi|285019443|ref|YP_003377154.1| ABC transporter permease [Xanthomonas albilineans GPE PC73]
 gi|283474661|emb|CBA17160.1| probable abc transporter permease protein [Xanthomonas albilineans]
          Length = 405

 Score =  252 bits (644), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 117/366 (31%), Positives = 193/366 (52%), Gaps = 13/366 (3%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
           +  R  G+W           V   + +S+ + +  +D S I ++D+ G   ++ +  +  
Sbjct: 52  SRVRLTGSWTLSTAL-----VASEVLRSMPAGTTGIDASGIAQLDSAGVLQLIRYATRNG 106

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
              +          L S I      + K +          F      +G  + +   +  
Sbjct: 107 IAQESLDFRQDHRALVSTIEDVADDRPKRK------RDYGFAAALERLGYTVHRNGKEIV 160

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    LG  +        +  +F+  L S +  M  VG+  VP+V L+S++ GAVIA  G
Sbjct: 161 ALVGFLGETLVKLMRLMHAPRRFR--LTSTVHHMEQVGLDAVPLVALLSYLVGAVIAFLG 218

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           +  L  FGAEI+ ++L+SI  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDAI+T
Sbjct: 219 STVLRDFGAEIYVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDAIQT 278

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GLD + +L+ PR+ AL++ LPLLT +A  + + G   V      IP  ++ +R H T  
Sbjct: 279 LGLDPMDLLVIPRLLALLLMLPLLTFVAMIAGLAGGVTVGAFDLGIPPQMYLARMHDTIQ 338

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + ++  GL KAP  A AIG++   EG  V   + S+G++ T+ VVQ+IS+VIIID++ A+
Sbjct: 339 IRHMLVGLAKAPIFAIAIGLIGCLEGLRVEGTAQSVGERTTSSVVQTISLVIIIDAIAAL 398

Query: 367 FYFAIG 372
           ++  +G
Sbjct: 399 WFMKMG 404


>gi|182680400|ref|YP_001834546.1| hypothetical protein Bind_3500 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|182636283|gb|ACB97057.1| protein of unknown function DUF140 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 376

 Score =  252 bits (643), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 122/371 (32%), Positives = 205/371 (55%), Gaps = 6/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
                     G+W     + + + ++  + +  +  +  VD+  + EIDT GA L+   +
Sbjct: 12  RGETLNVIATGSWIGAHAAAL-EPLIEGVRRDGRGRTLSVDMRGVDEIDTFGACLLERLI 70

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           + +  + K   ++   ++   L++          +           +     G+  +   
Sbjct: 71  QSWKAEGKETTITGLSDRFGDLVAEVDHVSRSMSQAAAKRTS---LDSLRAFGRAAMDLW 127

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D+ +   +LG +++          K +    SL+ Q+  VG+  VP+++LI+F+ G +I
Sbjct: 128 LDTRNFLVVLGRLVAVFLVVLRHPKKMR--FTSLVAQLDRVGLQAVPIILLITFLIGGII 185

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQG F   +FGA+ + +DL++ L LRE+GVL+ A+M+AGRSGS+  AEIGSMK+ EEID
Sbjct: 186 AQQGLFNFRKFGADTYVVDLLAFLVLRELGVLIVAIMVAGRSGSSYTAEIGSMKMREEID 245

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RTMGLD V +L+ PR+ AL+++LP+LT L   +A+ G  +V W Y  +   +F  R  
Sbjct: 246 ALRTMGLDPVEVLLLPRVLALVLALPMLTFLGFMAALYGGGVVSWIYGGMSPPIFIERIR 305

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
             A+L     GLIKAPFMA  IG++A  EG AV   + SLG + T+ VV+SI ++I++D 
Sbjct: 306 DAASLTQFEVGLIKAPFMALVIGVIACTEGLAVQGSAESLGLRTTSSVVKSIFLIIVLDG 365

Query: 363 LFAIFYFAIGI 373
           +  +F+ A G+
Sbjct: 366 ILDLFFAATGM 376


>gi|114707109|ref|ZP_01440007.1| permease of ABC transporter [Fulvimarina pelagi HTCC2506]
 gi|114537305|gb|EAU40431.1| permease of ABC transporter [Fulvimarina pelagi HTCC2506]
          Length = 394

 Score =  252 bits (643), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 139/371 (37%), Positives = 220/371 (59%), Gaps = 3/371 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G  V   AG+W +  I  I  D+       + +D   +DLS + +IDT GA ++    
Sbjct: 27  RGGTLVLEAAGDWLARTIGSIESDLERTARADLGAD-VAMDLSRVGQIDTAGAFVLERLK 85

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                K +   V    E+  +L +       + +  ++        N    +G  ++   
Sbjct: 86  RDLRAKREHVEVEGLAERNTALFAAVGSAMDRERPVRQRERSKILTNAVIAVGSFVIGIK 145

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ++  +  +++G  +   G   +   + +    ++  Q+  +GV  +P+++LI+F+ G +I
Sbjct: 146 DELVNGLNLIGGAMYGAGSRISGRTQSRP--AAIFNQIDQMGVKAIPIIVLITFLVGGII 203

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL ++G E+++++L+SIL LREIGVLL A+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 204 AQQGAFQLRRYGGEVYAVNLISILVLREIGVLLAAIMIAGRSGSAICAEIGSMKMREEVD 263

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ + +L+ PR+ AL I+LPLLT++AN +A++G +I +  Y DI F  F     
Sbjct: 264 ALHVIGLNPIGVLVFPRLVALSIALPLLTVIANLAALVGGAITLRIYSDISFLNFLQGLQ 323

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            +  L  +F+GL+KAPFMA  IG+VA  EG  VG  + SLG +VT  VV+SI +VI++D 
Sbjct: 324 QSIDLFTVFSGLLKAPFMAILIGLVAANEGMKVGGSAESLGLRVTAAVVKSIFLVIVMDG 383

Query: 363 LFAIFYFAIGI 373
           LFAIFY +IG+
Sbjct: 384 LFAIFYASIGL 394


>gi|307638119|gb|ADN80569.1| organic solvent resistant ABC transporter [Helicobacter pylori 908]
 gi|325996719|gb|ADZ52124.1| putative ABC transport system, permease protein [Helicobacter
           pylori 2018]
          Length = 377

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFRTSVFRLDELKKNLLDH--QGSLKMDFSGCQKIDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK +V+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEDDLESKKAGKKYEL---MITKLGKSLVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|172061853|ref|YP_001809505.1| hypothetical protein BamMC406_2812 [Burkholderia ambifaria MC40-6]
 gi|171994370|gb|ACB65289.1| protein of unknown function DUF140 [Burkholderia ambifaria MC40-6]
          Length = 374

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 97/366 (26%), Positives = 168/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   +        +  DLS I  +D +G + +     +   
Sbjct: 19  TVRLYGQWTALALARNRGAVARRVAGIASGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R   +     L    G  +  F      
Sbjct: 79  DGVALSTTQ-----RTIFERIERLDSQREAPERVVHFGPITRL----GFMLFAFAEHLQG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + GLVI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGLVILDALSVLRRPKTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQTFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 248 GIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDINYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIM 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|160872209|ref|ZP_02062341.1| ABC transporter, permease [Rickettsiella grylli]
 gi|159121008|gb|EDP46346.1| ABC transporter, permease [Rickettsiella grylli]
          Length = 375

 Score =  251 bits (642), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 112/376 (29%), Positives = 194/376 (51%), Gaps = 13/376 (3%)

Query: 1   MSENGITVFRFAGNWKSPEISE-IADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           +S+ G       G W    I +   D     +N+ I+S   I++ + IT++D+ GA  + 
Sbjct: 10  LSKQGNHQIDCQGAWTLSGIRKKNLDQSFQKLNRHIESP-LILNAAFITQMDSSGAWQLY 68

Query: 60  YFMEKY--HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
            + ++     K+ L G+++  + LF +I     +     + +              +GKK
Sbjct: 69  QWKKQLAKKRKVHLIGLNSKHQALFGMIETAAEQIKPLPREKT-------FRGLGLLGKK 121

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
            ++  N+  S    +G    +         + +    +++  +   G+  + ++ L+SF+
Sbjct: 122 SIEQWNELKSYLAFIGKNFISACHAFLHPRQLRV--RAILGIIENTGLDALGIIALLSFM 179

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V+  Q  FQL  FGA  F IDL+ +  LRE   LLTA+M+AGRSGSA  A++G MKI
Sbjct: 180 IGIVLTYQMGFQLKNFGATRFIIDLLGLAILREFSPLLTAIMVAGRSGSAFTAQLGMMKI 239

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            EEIDA+ TMG+   ++LI PR+W L+++LPLLT+ A+   ++G   +     +I +  F
Sbjct: 240 KEEIDALNTMGVLPRQLLILPRLWGLLLALPLLTVWADIFGLLGGMAMTHNMMNISYLDF 299

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
             RF    +L+++  G+ KAP  A  I   A  +G  V   ++S+G++ T  VVQ I  +
Sbjct: 300 LHRFPKVVSLSSLIIGVGKAPVFALIIASTACFQGLRVSGSADSVGRQTTRSVVQGIFFI 359

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D+LF+I +  + I
Sbjct: 360 IVADALFSILFSTLNI 375


>gi|86149247|ref|ZP_01067478.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni CF93-6]
 gi|88596442|ref|ZP_01099679.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 84-25]
 gi|218563235|ref|YP_002345015.1| putative ABC transporter permease [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|85840029|gb|EAQ57287.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni CF93-6]
 gi|88191283|gb|EAQ95255.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 84-25]
 gi|112360942|emb|CAL35743.1| putative ABC transport system permease [Campylobacter jejuni subsp.
           jejuni NCTC 11168]
 gi|284926840|gb|ADC29192.1| putative ABC transport system permease [Campylobacter jejuni subsp.
           jejuni IA3902]
 gi|315929480|gb|EFV08676.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           305]
          Length = 369

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 112/369 (30%), Positives = 185/369 (50%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKN 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSRFQTLFELCEKNYQRLGKTKKSHQN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LRKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      ++ PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIVIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVILTSTGI 369


>gi|15598407|ref|NP_251901.1| permease of ABC transporter [Pseudomonas aeruginosa PAO1]
 gi|9949331|gb|AAG06599.1|AE004744_14 probable permease of ABC transporter [Pseudomonas aeruginosa PAO1]
          Length = 381

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 112/366 (30%), Positives = 183/366 (50%), Gaps = 4/366 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G+W     + +  +V     +S  + +   DLS +  +DT GA L+   +    
Sbjct: 19  ARVRAIGDWTLAHYTALEREVTRL--RSEVAANVSFDLSQLGALDTAGAALLAELLGAER 76

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                +       +  +L+           +P++     +   L   IG  +  F     
Sbjct: 77  LADLAELEPGLPRERQALLKTVGHALHDFCEPEKPKPPTTAIELLARIGCAMETFWLHLK 136

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +GL +            ++     L+  +   G+  VP++ L++F+ GAVIA  G
Sbjct: 137 ALLGFIGLTLETLFRSLVRPASWRV--TPLVANIEKSGLDAVPIIALLTFLVGAVIAFLG 194

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA I++++L+    LRE  VLLTA+++AGR+ SA  A+IGSMK NEEIDAIR 
Sbjct: 195 ATVLANFGATIYTVNLVVFSFLREFAVLLTAILMAGRTASAFTAQIGSMKANEEIDAIRA 254

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PR+ AL++SLP+LT +     I+G   V     DIP A+F S       
Sbjct: 255 LGLNPIELLVLPRVLALLVSLPMLTFVGMLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIG 314

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + +   G+ KAP  A  I ++   EGF V   + S+G+  TT VV SI +VI++D+L A+
Sbjct: 315 VQHFLVGISKAPLFAFLIAVIGCLEGFKVSGSAQSVGEHTTTSVVHSIFVVILLDALAAL 374

Query: 367 FYFAIG 372
            +  +G
Sbjct: 375 LFMEMG 380


>gi|254458263|ref|ZP_05071689.1| stas domain protein [Campylobacterales bacterium GD 1]
 gi|207085099|gb|EDZ62385.1| stas domain protein [Campylobacterales bacterium GD 1]
          Length = 357

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 102/365 (27%), Positives = 174/365 (47%), Gaps = 8/365 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            +F+G +    ++   + +       +       DL  +   DT  +  I   + K   K
Sbjct: 1   MKFSGEFTLYTVTSYQNKIDEIDFSQV--RKVDFDLEDVVYFDTAASIFINSLIHKLTQK 58

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                + T  + +   +    + K  +Q            N    IG+    + +   + 
Sbjct: 59  NITSNIITTNKDILDTLELVLKSKKTSQAIPEETRP----NFLNIIGENTYLYYSGFVAF 114

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G + +       +    +     +  ++    +  + ++ L SF+ G V+A Q A+
Sbjct: 115 MAFIGQLFATKINTLKTIKNIR--FKEIAFEINESAIKALGIISLTSFLIGLVVAYQSAY 172

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL  +GA IF +D++ I  LRE+  L+TA++IAGRSGSA  A+IG+MKI EE+DA+RTMG
Sbjct: 173 QLKIYGANIFIVDMLGISMLRELAPLMTAIVIAGRSGSAFTAQIGAMKITEELDAMRTMG 232

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
            D    L+ PRI AL+I++P+L  +A+  ++ G  +V     DI   +F  RF+      
Sbjct: 233 FDPYIFLVLPRIIALMIAMPILIFVADIMSVFGGLLVAVIDLDISPQLFIDRFNDVVAAK 292

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           + F G+ K PF A  I  + +  G  V   + S+G   T  VV+SI  VII D++F+I +
Sbjct: 293 HFFIGIGKGPFFAFIIASIGVYRGLEVKDDTQSIGFNTTKSVVESIFAVIICDAIFSILF 352

Query: 369 FAIGI 373
             +GI
Sbjct: 353 TNLGI 357


>gi|159184854|ref|NP_354638.2| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
 gi|159140135|gb|AAK87423.2| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
          Length = 386

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 157/370 (42%), Positives = 223/370 (60%), Gaps = 6/370 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G + +  +G+W++  +S I + +   I KS  +    +DLSA+  IDT GA +I    
Sbjct: 22  SGGGSRYVLSGSWRNSNLSGIFESLDR-IEKSKPASPVDIDLSAVEAIDTTGAWIIQRLR 80

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           +          ++ +      +     + ++  +           + +   IG+ +V+  
Sbjct: 81  KDLEASGATVTLTGNDRIEDVIGQLPDKAEMDVEPVA---REGLVERIFAPIGQAVVQNG 137

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D  +  +ILG  +                  +++ Q+ ++GV  VP+++L+SF+ GA+I
Sbjct: 138 ADFLAGMYILGSAVRGAQMKLGRGRGVSP--AAIVNQIDHMGVRAVPIIMLMSFLIGAII 195

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EEID
Sbjct: 196 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEID 255

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ V +L+ PR+ AL I+LPLLTILANF+A+ GA+IV   Y  I F VF SR H
Sbjct: 256 ALKVIGLNPVGVLVFPRLVALTIALPLLTILANFAALFGAAIVALAYSGITFEVFLSRLH 315

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                + I  G+IKAPFMA  IGIVA  EG  VG  + SLGK VT+ VV+SI +VI++D 
Sbjct: 316 GAVEESTIAAGMIKAPFMALIIGIVAAVEGMKVGGSAESLGKHVTSSVVKSIFVVILVDG 375

Query: 363 LFAIFYFAIG 372
           LFAIFY AI 
Sbjct: 376 LFAIFYAAID 385


>gi|254487283|ref|ZP_05100488.1| ABC transporter, inner membrane subunit [Roseobacter sp. GAI101]
 gi|214044152|gb|EEB84790.1| ABC transporter, inner membrane subunit [Roseobacter sp. GAI101]
          Length = 369

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 129/369 (34%), Positives = 205/369 (55%), Gaps = 8/369 (2%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
             T    +G+ +   +    D +  +      +   ++D+S +T IDT GA L++Y  ++
Sbjct: 9   DGTRLVVSGDLRIAAV----DALDRSALLKKAAGVTVIDISGLTRIDTAGAWLLVYAQDR 64

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                K   ++   +    LI             +      +  +    +G+ +      
Sbjct: 65  LAAPGKRVEITGTSDAQAQLIDVVRASMPPADIAE--PKPKTLADQVETLGRMVTSGARK 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           +      LG V++          +F+  L SL+     VG++ VP+V L+SF+ G V+A 
Sbjct: 123 TVELTSFLGQVVATMAGTLIHPRRFR--LTSLVHHCQEVGLNAVPIVALMSFLIGVVLAF 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QGA QL QFGAE+F +DL++I  LRE+G+LLTA+++AGRSGSA  A IGSMK+ EEIDA+
Sbjct: 181 QGAVQLRQFGAEVFVVDLIAISVLRELGILLTAIIVAGRSGSAFTAAIGSMKMREEIDAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RT+GLD V IL+ PR+ AL++ LP L +LA+ S ++G +++ W    +  AVF SR    
Sbjct: 241 RTIGLDPVTILVVPRVLALMLMLPALGLLADISGLVGGAVMSWIELGVSPAVFQSRLVGN 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +   G+IKAPF A  IGI+   EG  VG  + SLG+  +T VV SI +VI++D++F
Sbjct: 301 TDVWHFGVGMIKAPFFALIIGIIGCYEGMKVGGDAESLGRLTSTSVVLSIFMVIVMDAMF 360

Query: 365 AIFYFAIGI 373
           +IF+  +G+
Sbjct: 361 SIFFAIVGV 369


>gi|308183565|ref|YP_003927692.1| putative ABC transport system permease protein [Helicobacter pylori
           PeCan4]
 gi|308065750|gb|ADO07642.1| putative ABC transport system permease protein [Helicobacter pylori
           PeCan4]
          Length = 377

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGSLKMDFSGCQKIDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKVGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|297380678|gb|ADI35565.1| conserved hypothetical protein [Helicobacter pylori v225d]
          Length = 377

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  VD S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGSLKVDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKEAGKRYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|254710104|ref|ZP_05171915.1| Sulfate transporter/antisigma-factor [Brucella pinnipedialis B2/94]
 gi|261317653|ref|ZP_05956850.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261296876|gb|EEY00373.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
          Length = 391

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 154/369 (41%), Positives = 217/369 (58%), Gaps = 3/369 (0%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++G+ V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    
Sbjct: 24  QDGMRVIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLR 82

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++   K     +    E    L+        +     R+     F      +G  ++   
Sbjct: 83  QRLAAKHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMF 142

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           ND     HILG  I                  +++ QM  +GV  +P+V+L+S + GA+I
Sbjct: 143 NDFKMAMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIVVLMSTIVGAII 200

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEIGSMK+ EE D
Sbjct: 201 AQQGAFQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEIGSMKMREETD 260

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  +GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H
Sbjct: 261 ALTVIGLNAVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLH 320

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L   F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D 
Sbjct: 321 DAVALNTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDG 380

Query: 363 LFAIFYFAI 371
           LFA+FY AI
Sbjct: 381 LFAMFYAAI 389


>gi|163793381|ref|ZP_02187356.1| ABC transporter, inner membrane subunit [alpha proteobacterium
           BAL199]
 gi|159181183|gb|EDP65698.1| ABC transporter, inner membrane subunit [alpha proteobacterium
           BAL199]
          Length = 391

 Score =  251 bits (640), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 118/375 (31%), Positives = 211/375 (56%), Gaps = 12/375 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G  V R  G W       +   +    +++  + S  VD ++++ +D+ GA +I   
Sbjct: 26  TRDGTLVVRLRGPWTLQTALSVDAAIRALADRA--AASVTVDATSLSRLDSAGAWVIQRT 83

Query: 62  ---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
               ++    +++ G+   ++ +    +   +       P      +S  N    +G++ 
Sbjct: 84  VAQFDRRGVPVEIVGLDEGLQAILDKAAEHDQSADIAPAPT-----SSLLNFLERLGRRS 138

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           V+ ++   +   +LG+V+  +G         +G   +++ Q+   GV+ +P+V L+ F+ 
Sbjct: 139 VEGLHTGRNLLGLLGVVVVASGRIVVRPMTLRG--TAVVAQIEATGVTALPIVGLLCFLV 196

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V+A  GA QL++FGA   +++L+ I  LREIG+LLTA+++AGRSGSA  A+IG+MK+N
Sbjct: 197 GVVLAYMGALQLTRFGAANLTVNLVGISVLREIGILLTAIIVAGRSGSAFAAQIGTMKVN 256

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           +EIDA+ TMGL  + +L+ PR+ ALII LP LT+ A+ + ++G ++V     D+    F 
Sbjct: 257 QEIDALETMGLSVIDVLVLPRVIALIIVLPALTVFADVAGLVGGAMVCMFQLDMTIGQFL 316

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  +  T+ +  TGLIKAP  A AI +V    G  V   + S+G++ T  VV+SI +VI
Sbjct: 317 TQLSAGVTVWSFATGLIKAPVFALAIALVGCHSGLGVSGSAESVGRQTTRAVVESIFLVI 376

Query: 359 IIDSLFAIFYFAIGI 373
           I++++FAI +  IGI
Sbjct: 377 ILNAIFAIAFAKIGI 391


>gi|317010161|gb|ADU80741.1| putative ABC transport system permease protein [Helicobacter pylori
           India7]
          Length = 377

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 102/371 (27%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGPLKMDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESEKAGKKYEL---MITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL + GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQEMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAINYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|86152328|ref|ZP_01070539.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 260.94]
 gi|121613751|ref|YP_001001289.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|167006183|ref|ZP_02271941.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|315125046|ref|YP_004067050.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni ICDCCJ07001]
 gi|85840817|gb|EAQ58068.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 260.94]
 gi|87249848|gb|EAQ72807.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81-176]
 gi|315018768|gb|ADT66861.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni ICDCCJ07001]
          Length = 369

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 113/369 (30%), Positives = 185/369 (50%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSSFQTLFELCEKNYQRLSKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LRKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVILTSAGI 369


>gi|319788025|ref|YP_004147500.1| hypothetical protein Psesu_2437 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466537|gb|ADV28269.1| protein of unknown function DUF140 [Pseudoxanthomonas suwonensis
           11-1]
          Length = 371

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 119/364 (32%), Positives = 184/364 (50%), Gaps = 13/364 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W      E+A  +     + I  D A VD S +  ID+ G   +  F  +    
Sbjct: 20  VRLQGDWILDHALEMAARL-----REIPGDVASVDASGVGRIDSAGMMQLARFARRRELA 74

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                 S     L  LI      + + +          F      +G+       +    
Sbjct: 75  DDALHFSESHLPLVQLIEDVPDDRPRRK------RDYGFAAALERLGRATHTVGRNIVEL 128

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
               G  +           +    L + +  M  VG+  +P+V L+S++ GAVIA  G+ 
Sbjct: 129 LGFTGENLVKLLRLLRQPRR--FRLTATVSHMEQVGLDALPLVALLSYLVGAVIAFLGST 186

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGAEIF ++L+SI  LRE  VLLTA+++AGR+ SA  A+IGSMK  EEIDAIRT+G
Sbjct: 187 ILADFGAEIFVVELVSIAFLREFAVLLTAIVLAGRTASAFTAQIGSMKAREEIDAIRTLG 246

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           LD + +L+ PR+ AL++ LPLLT +A  + + G   V     +IP  ++ +R   T  + 
Sbjct: 247 LDPIELLVIPRLVALLVMLPLLTFVAMMAGLAGGVTVGAFDLEIPPQMYLARMEETMQVR 306

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+L A+++
Sbjct: 307 HFLVGMSKAPVFAMVIGLIGCLEGMRVQGSAQSVGERTTSSVVQTISLVIIIDALAALWF 366

Query: 369 FAIG 372
             +G
Sbjct: 367 MNMG 370


>gi|88810292|ref|ZP_01125549.1| hypothetical protein NB231_14468 [Nitrococcus mobilis Nb-231]
 gi|88791922|gb|EAR23032.1| hypothetical protein NB231_14468 [Nitrococcus mobilis Nb-231]
          Length = 364

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 92/366 (25%), Positives = 181/366 (49%), Gaps = 12/366 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G+W    ++ +   +    N  + S    ++L  I+ +DT GA ++     +    
Sbjct: 10  VICSGDWSVERLAAVERQIRR--NAPMTSGEWRINLGEISTLDTAGAVMVQRLCRRLRTA 67

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +     +  +++     +     +   S       N    +G+++          
Sbjct: 68  GASVQLEDVSAERHAVLKLVASEMEVTPRRPYS-------NPLERLGRRVTDGCFGITEY 120

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G + +++       ++ +     +  ++   GV  +P++ L++F+ G V+A Q   
Sbjct: 121 LAFIGRLTADSLPRMLRPHRLR--WHEIAVELERAGVMAIPIIGLLAFLIGIVMAYQSGD 178

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  +GA IF +DL+ ++ LRE+G L+TAV++AGR+G++  A+IG+M + EE+DA+RTMG
Sbjct: 179 ILQTYGANIFLVDLLGVIILREMGPLMTAVIVAGRTGASYTAQIGTMHLTEEVDALRTMG 238

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +    +L+ P+  AL+I+LPLLT+ A+   ++G  +V    Y + F VF  R  +     
Sbjct: 239 VTPFEMLVLPKFLALLIALPLLTVWADAIGLLGGMLVSSLLYGVDFDVFLRRLPTAVPPN 298

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI-F 367
             + G+ KAP  A  I  +   +GF +   ++ +G+  T  VVQ I  VI+ D++F+I  
Sbjct: 299 MFWVGIAKAPVFAALIASIGCYQGFRIRYSADEVGRYTTISVVQGIFWVIVADAVFSIVL 358

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 359 FSWLGL 364


>gi|57238657|ref|YP_179788.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           RM1221]
 gi|57167461|gb|AAW36240.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           RM1221]
 gi|315059096|gb|ADT73425.1| Putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni S3]
          Length = 369

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 114/369 (30%), Positives = 185/369 (50%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSRFQTLFELCEKNYQRLSKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LRKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      +I PR+ ALI+++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIIIPRVMALIVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVVLTSAGI 369


>gi|27381005|ref|NP_772534.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
 gi|27354171|dbj|BAC51159.1| ABC transporter permease protein [Bradyrhizobium japonicum USDA
           110]
          Length = 367

 Score =  250 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 127/370 (34%), Positives = 191/370 (51%), Gaps = 5/370 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
                    G W +     +   V  A   +    S  +D+S + ++DT GA LI     
Sbjct: 3   GNALALCATGTWTASFAPVLERMVADAEKLAGSPQSIFIDVSEVAKLDTFGAWLIERLRR 62

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                     ++       SL+    R +     P       +   +   IG+ +     
Sbjct: 63  SLTQGTVEAQIAGLSANYSSLVDEVRRVRAT---PVVDAGTITITGMLDQIGRAVAGVAG 119

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG V++  G        F+  L S +  M  V    VP+++LI+F+ G +IA
Sbjct: 120 TVAGLIDMLGAVLAAGGRVLIHPRSFR--LTSTVHHMEQVCWRAVPIIVLITFLIGCIIA 177

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
           QQG F   +FGA+IF +D++ +L LREIGVLL A+M+AGRSGSA  AE+GSMK+ EEIDA
Sbjct: 178 QQGIFHFRRFGADIFVVDMLGVLVLREIGVLLVAIMVAGRSGSAYTAELGSMKMREEIDA 237

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RTMG D + +L+ PR+ AL+++LP+L  L   +A+ G  +V W Y  +    F  R   
Sbjct: 238 LRTMGFDPIEVLVLPRMLALVLALPILAFLGAMAALYGGGLVAWLYGGVDPEAFLLRLRD 297

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             ++ +   G++KAP MA  IGIVA  EG AV   + SLG+  T  VV+ I  VI++D +
Sbjct: 298 AISIDHFIVGIVKAPVMAAVIGIVACVEGLAVQGSAESLGQHTTASVVKGIFFVIVMDGV 357

Query: 364 FAIFYFAIGI 373
           FAIF+ +IG+
Sbjct: 358 FAIFFASIGM 367


>gi|109948194|ref|YP_665422.1| putative ABC transport system permease protein [Helicobacter
           acinonychis str. Sheeba]
 gi|109715415|emb|CAK00423.1| putative ABC transport system permease protein [Helicobacter
           acinonychis str. Sheeba]
          Length = 377

 Score =  250 bits (639), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W       + D++   ++         +D S   ++D +    +   +
Sbjct: 14  DGSGSVLILGGDWDFRTSVFLLDELKKTLSNH--QGRLKMDFSRCQKVDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS        ++     K    +  +    Y         +GK IV+  
Sbjct: 72  KERSLNIELCNVSESNACALKVVRDWLEKDGNIESQKTIKKYELV---VTKMGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F      L+  +   G   +PV IL  F+ G  I
Sbjct: 129 NTFLNALNFCGMILFYFIKGVFNPKRF--CFTPLVYHINESGFKVLPVSILTVFIVGFAI 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
             QGA QL   G  + ++++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 TLQGALQLQDMGVPLTTVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ ALII LPL+  +A+  AI+G+   +    D+ F+ +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALIIVLPLMVFIADAIAILGSMCAVKYQLDLTFSSYVDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           ST T  + + G+IKAPF   AI +V    GF V   + S+G+  T  VV ++  +I +++
Sbjct: 307 STVTWNHFWVGIIKAPFWGFAIAVVGCMRGFEVRGDTESVGRLTTISVVNALFWIIFLNA 366

Query: 363 LFAIFYFAIGI 373
            F+I +  +GI
Sbjct: 367 TFSIVFSRLGI 377


>gi|238754554|ref|ZP_04615908.1| ABC transporter, permease protein [Yersinia ruckeri ATCC 29473]
 gi|238707185|gb|EEP99548.1| ABC transporter, permease protein [Yersinia ruckeri ATCC 29473]
          Length = 343

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 113/336 (33%), Positives = 174/336 (51%), Gaps = 2/336 (0%)

Query: 37  SDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQ 96
             S   DLS +  +DT GA L+   +         +      ++   L+    +      
Sbjct: 9   PASITFDLSQLGRLDTAGATLLATLLGGERISHLRELAPLLPDERRILLETVSQVLPNLA 68

Query: 97  KPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSL 156
                     +  L   IG+ +     D  S     GL +           +++    SL
Sbjct: 69  SQPTVKPPPFWIGLLVPIGQSVDNLWQDFKSLLGFTGLTLEALFGTVFRPSRWRM--TSL 126

Query: 157 IRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLT 216
           I  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  VLLT
Sbjct: 127 IANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFAVLLT 186

Query: 217 AVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANF 276
           A+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT +   
Sbjct: 187 AILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTFIGMV 246

Query: 277 SAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
             I G  +V     +I   +F S   ++  L +   G+ KAP  A  I I+   EGF V 
Sbjct: 247 CGIFGGMVVCALALNISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEGFKVS 306

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
             + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 307 GSAESVGIHTTTSVVHSIFVVILLDAVAALFFMEMG 342


>gi|15646075|ref|NP_208257.1| hypothetical protein HP1466 [Helicobacter pylori 26695]
 gi|2314643|gb|AAD08507.1| conserved hypothetical integral membrane protein [Helicobacter
           pylori 26695]
          Length = 377

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGPLKMDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSIIFSKLNI 377


>gi|304319773|ref|YP_003853416.1| hypothetical protein PB2503_00972 [Parvularcula bermudensis
           HTCC2503]
 gi|303298676|gb|ADM08275.1| hypothetical protein PB2503_00972 [Parvularcula bermudensis
           HTCC2503]
          Length = 380

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 129/362 (35%), Positives = 195/362 (53%), Gaps = 3/362 (0%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G W         D  + A+N   + D A +DLS I  +DT GA ++     +  G+ + Q
Sbjct: 21  GEWTLRGGLTKIDSKIRALNFGPREDLAEIDLSQIEALDTAGALMLQRLRHRCMGEGRPQ 80

Query: 73  GVSTHIEQLFSLISFTHRKKIKNQK-PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHI 131
            ++T             R                SF  L   +G+  +   N+  +    
Sbjct: 81  AIATLTGMTDPQHELMERMAAHIADCEGDPPRRKSFILLLNRVGQGTIAVGNEGLAILSF 140

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           +G V++       S  +F+  L + +  M   G++   +V L+SF+ GAV+A  GA  LS
Sbjct: 141 VGSVVARLAGTIMSPARFR--LTATVAHMEEAGLNSTLIVGLMSFLIGAVVAFMGARVLS 198

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           +FGAE+FS++L+ I  LRE GVLLTA++IAGRSGSA  A IGSMK+ EEIDA+R +G+  
Sbjct: 199 EFGAEVFSVELVGISVLREFGVLLTAILIAGRSGSAFTASIGSMKLREEIDAMRALGISP 258

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           +  LI PR  AL+++LP+L  LA F  ++G  +V W   DIP  +F  R     T+ N+F
Sbjct: 259 LDALILPRTIALVLTLPVLAFLAGFLGLLGGGVVGWLALDIPPQLFIGRLQEIVTVENLF 318

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
            GL+KAPF A  I +V    G +V   +  LG++ T  VVQS+ +VI++D+LFA+ +  +
Sbjct: 319 VGLVKAPFFAFVIAVVGCYHGMSVENSAEELGRRTTMAVVQSLFLVILLDALFAMLFLEL 378

Query: 372 GI 373
            I
Sbjct: 379 DI 380


>gi|325998313|gb|ADZ50521.1| hypothetical protein hp2017_1400 [Helicobacter pylori 2017]
          Length = 377

 Score =  250 bits (638), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFRTSVFRLDELKKNLLDH--QGSLKMDFSGCQKIDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     KK   +  +    Y     +   +GK +V+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLVKKNDLESKKAGKKYEL---MITKLGKSLVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|108563874|ref|YP_628190.1| hypothetical protein HPAG1_1449 [Helicobacter pylori HPAG1]
 gi|107837647|gb|ABF85516.1| ABC transport system permease [Helicobacter pylori HPAG1]
          Length = 377

 Score =  249 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGPLKMDFSGCQKVDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLETKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADSFAILGGMFAIKYQLDLGFPSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIVFSKLNI 377


>gi|15612424|ref|NP_224077.1| hypothetical protein jhp1359 [Helicobacter pylori J99]
 gi|4155971|gb|AAD06935.1| putative [Helicobacter pylori J99]
          Length = 377

 Score =  249 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   +ID +    +   +
Sbjct: 14  DGANSVLILRGDWDFRTSVFRLDELKKNLLDH--QGSLKMDFSGCQKIDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK +V+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEDDLESKKAGKKYEL---MITKLGKSLVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   ++ L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CIIPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|319791003|ref|YP_004152643.1| hypothetical protein Varpa_0310 [Variovorax paradoxus EPS]
 gi|315593466|gb|ADU34532.1| protein of unknown function DUF140 [Variovorax paradoxus EPS]
          Length = 388

 Score =  249 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 92/372 (24%), Positives = 177/372 (47%), Gaps = 13/372 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEI--ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           + G       G W +  +S +     +  ++  +  +D    DL  I ++D IGA+L+  
Sbjct: 25  QEGRQWTVATGRWTALGMSSLPAWQALSKSLAAAPPADDRAWDLRPIEQLDHIGAQLLWE 84

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
                              Q  +++    +  +           +  +   ++  + +V 
Sbjct: 85  HWRHEWPATL-----EMEAQHKAVLDQVAQYTVATPVEPPKTLADRIRTFSHNGPRAMVV 139

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
               +     ++G +  + G    + ++           +Y  G + + +  L+  + G 
Sbjct: 140 ----ARDFIGLIGQLAIDVGTLIRAPHRAP--WRDFSGHLYQFGATALHITALVGLLIGV 193

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A   + QL  +GAE F ++++ +  +RE+G +L AV+IAGRSGSAI A+IG M++ EE
Sbjct: 194 VLAYLISQQLRNYGAEAFVVNILGLSLVRELGPVLAAVLIAGRSGSAITAQIGVMRVTEE 253

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     L+ PR+ AL I++PL+++  + +A++G  +      DI  A F S 
Sbjct: 254 LDAMRVMGIPHGFRLVMPRVLALAIAMPLISLWTSMAALLGGMLAADAALDISPAYFLSA 313

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 +AN++  + K+      I ++    G  V  ++ SLG+  T+ VV SI+ VI++
Sbjct: 314 LPRAVPIANLWLAMAKSAVFGILIALIGCYFGMKVKPNTESLGRGTTSSVVTSITAVILV 373

Query: 361 DSLFAIFYFAIG 372
           D+LFA+ +  IG
Sbjct: 374 DALFAVLFKGIG 385


>gi|283953736|ref|ZP_06371267.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 414]
 gi|283794777|gb|EFC33515.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 414]
          Length = 369

 Score =  249 bits (637), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 111/364 (30%), Positives = 185/364 (50%), Gaps = 13/364 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEKYHGKI 69
           G W    I ++    +      IQS   I D   + +IDT G    +     ++  + KI
Sbjct: 16  GIWDKASIYKLK---IKDFLTLIQSKEVIFDFKDLEKIDTAGVRFFLALENDLKNKNIKI 72

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
             QG+++    LF L    +++  K +K  ++     F     ++GK  ++ +       
Sbjct: 73  TKQGLNSRFLTLFELCEKNYQRLNKTKKSHKN-----FSEYFINLGKLSLELLKILREFI 127

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
           +  G   ++      +   F+  L++ +  +       +P+VIL + + G V+A Q A+Q
Sbjct: 128 NFTGAFFTSLFLCLKNPKNFR--LIAFLYHIENSAFKALPIVILTALLVGVVLAYQAAYQ 185

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+ TMG 
Sbjct: 186 LAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAMNTMGF 245

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                +I PR+ AL++++PL+  +++  +I+G  ++     DI FA F  RF     + +
Sbjct: 246 RSFEFIIIPRVMALVVAMPLIVAISDAISIVGGMMIAKLNLDISFAEFLRRFREAVDIKH 305

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           I  GL+KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF++   
Sbjct: 306 ILIGLVKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALFSVVLT 365

Query: 370 AIGI 373
           + GI
Sbjct: 366 SAGI 369


>gi|220934666|ref|YP_002513565.1| protein of unknown function DUF140 [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995976|gb|ACL72578.1| protein of unknown function DUF140 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 375

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 100/368 (27%), Positives = 180/368 (48%), Gaps = 8/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
             V R AG      +S +  + +  + K        VD S +   D  G  L++  + + 
Sbjct: 16  GVVLRLAGRLDVHTVSTVWGEALAGL-KVRSGRPVRVDTSGVDYCDGAGVALVVDLLRQP 74

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                  G+    E++  ++     +    +    +        L  H+   +       
Sbjct: 75  RDPGAEVGLGETPEEVRRMLVPFDVRDFSGE----AVPPQRGPGLKQHLANGMHDLGRYL 130

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
             Q   +G   +          + +      +      G + +P+V+LI+F+ G ++A Q
Sbjct: 131 YLQVAFVGEATAAMFHAARHPRQVR--WRDALNLAQEAGANALPIVMLIAFLMGVILAFQ 188

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A  + QFGAEIF  +L+++  LRE+  L+TA+++AGRSG+A  AEIG+MK+NEEI+A+ 
Sbjct: 189 SAVAMRQFGAEIFVANLVALSLLRELAPLMTAILLAGRSGAAFAAEIGTMKVNEEINALT 248

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMGLD VR L+  R+ A +  +PLLT++AN   ++G ++V+  + DIPF  +F++  S  
Sbjct: 249 TMGLDPVRFLVVTRVLAAVAVMPLLTLVANLVGLVGGAVVMKGF-DIPFVTYFNQVTSAV 307

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           TL+++  GL KA      +  V    G      + ++G   T  VV +I ++++ D +FA
Sbjct: 308 TLSDLLGGLFKATVFGLLVAGVGCLRGLETRSGAAAVGISTTRAVVSAIILIVVADGVFA 367

Query: 366 IFYFAIGI 373
           + ++ + I
Sbjct: 368 VVFYHLDI 375


>gi|325293034|ref|YP_004278898.1| ABC transporter transmembrane protein [Agrobacterium sp. H13-3]
 gi|325060887|gb|ADY64578.1| ABC transporter, membrane spanning protein [Agrobacterium sp.
           H13-3]
          Length = 386

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 163/370 (44%), Positives = 224/370 (60%), Gaps = 6/370 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G   +  +G+W++  +S I   +   I KS  +    +DLS++  IDT GA +I    
Sbjct: 22  SGGGQRYALSGSWRNSNLSGIFARLEN-IEKSGPAGPVEIDLSSVEAIDTTGAWVIRRLR 80

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           E    K     ++ + E++  LI     K     +P         +     IG+ +V+  
Sbjct: 81  EDMEAKGVTVTLTGN-ERIEDLIGQLPDKAAMEGEP--VAKVGLAERFFSPIGQAVVQNG 137

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            D  +  +ILG  +                  +++ Q+ ++GV  VP+++L+SF+ GA+I
Sbjct: 138 ADFLAGMYILGSAVRGAQMKLGRGRGVSP--AAIVNQIDHMGVRAVPIIMLMSFLIGAII 195

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EEID
Sbjct: 196 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEID 255

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ V +L+ PR+ AL I+LPLLTILANF+A+ GA+IV   Y  I F VF SR H
Sbjct: 256 ALKVIGLNPVGVLVFPRLVALTIALPLLTILANFAALFGAAIVTLLYSGITFEVFLSRLH 315

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                + I  G+IKAPFMA  IGIVA  EG  VG  + SLGK VT+ VV+SI +VI++D 
Sbjct: 316 GAVEESTIAAGMIKAPFMALIIGIVAAVEGMKVGGSAESLGKHVTSSVVKSIFVVILVDG 375

Query: 363 LFAIFYFAIG 372
           LFAIFY AI 
Sbjct: 376 LFAIFYAAID 385


>gi|241767246|ref|ZP_04764987.1| protein of unknown function DUF140 [Acidovorax delafieldii 2AN]
 gi|241362094|gb|EER58209.1| protein of unknown function DUF140 [Acidovorax delafieldii 2AN]
          Length = 373

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 89/364 (24%), Positives = 172/364 (47%), Gaps = 12/364 (3%)

Query: 11  FAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKI 69
             G W + E+ + +    + A  +   + +   DL  +  +D +GA+L+     +     
Sbjct: 21  LLGRWGAAELGQRSQWRALSAQLRDNTAPAGGWDLRGLDWLDHVGAQLLWDHWGQAW--- 77

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
                     +L         +      P          +   H+G  ++  ++ +    
Sbjct: 78  ------PGRLELTDPQRAMLERVGAFTAPPPPAEPWRLADQADHLGVLVLHGLDHARHVV 131

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
            ++G +  +      + ++       +   +Y +G + +P+  L+ F+ G V+A   + Q
Sbjct: 132 QLIGQLALDLLRLVRAPHRAP--WRDMSGHVYRMGATALPITALVGFLIGVVLAYLMSLQ 189

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L Q+GAE F ++++ I  +RE+G +L A+++AGRSGS+I A+IG M++ EE+DA+R MG+
Sbjct: 190 LRQYGAESFIVNILGISLIRELGPMLAAILVAGRSGSSITAQIGVMRVTEELDAMRVMGI 249

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                L+ PR  AL +++PL+++    +A+ G  +       I  A F     +   + N
Sbjct: 250 PHGFRLVMPRTLALALAMPLISVWTTLAALAGGMLAADVSMGISPAYFVEALPAAVKIGN 309

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           +     K+      I ++    G  V  ++ SLG+  T  VV SI++VII+D+LFA+ + 
Sbjct: 310 LGLATAKSVVFGALIALIGCHWGLRVKPNTQSLGEGTTASVVTSITMVIIVDALFAVAFK 369

Query: 370 AIGI 373
            IGI
Sbjct: 370 NIGI 373


>gi|157415866|ref|YP_001483122.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|157386830|gb|ABV53145.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni 81116]
 gi|307748503|gb|ADN91773.1| ABC transporter, permease protein, putative [Campylobacter jejuni
           subsp. jejuni M1]
 gi|315931385|gb|EFV10354.1| conserved hypothetical protein [Campylobacter jejuni subsp. jejuni
           327]
          Length = 369

 Score =  249 bits (636), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 113/369 (30%), Positives = 185/369 (50%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSRFQTLFELCEKNYQRLSKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LIKFTNFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      +I PR+ AL++++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIIIPRVMALVVAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVVLTSAGI 369


>gi|210135633|ref|YP_002302072.1| ABC transporter permease protein [Helicobacter pylori P12]
 gi|210133601|gb|ACJ08592.1| ABC transporter permease protein [Helicobacter pylori P12]
          Length = 377

 Score =  249 bits (636), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 178/371 (47%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGPLKMDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIVFSKLNI 377


>gi|146305413|ref|YP_001185878.1| hypothetical protein Pmen_0373 [Pseudomonas mendocina ymp]
 gi|145573614|gb|ABP83146.1| protein of unknown function DUF140 [Pseudomonas mendocina ymp]
          Length = 379

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 122/371 (32%), Positives = 203/371 (54%), Gaps = 5/371 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +  +  R  G+W     S +   V+    +        VDL  +  +DT GA L++  
Sbjct: 13  STDAASGLRIGGDWTLAHYSRLEPQVLALRERL--HGQESVDLDELAALDTAGAALLVEL 70

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           +     +   Q  +   E+  +L+         +Q+ Q+    ++ + +  HIG+ +   
Sbjct: 71  LGSERLRQLAQQDNLSTER-RALLLAVADAMAGSQQVQQHATPSALREVLGHIGEAVETT 129

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                     +GL +S          +++  L SL   +   G++ VP+V L++F+ GAV
Sbjct: 130 WCHGRELLGFMGLTLSGMLTILLRPARWR--LTSLAAHLEQCGLNAVPIVALLTFLVGAV 187

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA  L+ FGA I++++L++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEEI
Sbjct: 188 VAFLGATILADFGASIYTVNLVAFSFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEI 247

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DAIRT+GL  + +L+ PR++A++I+LP+LT +A  S I+G ++V     DIP  ++ S  
Sbjct: 248 DAIRTLGLSPIELLVLPRVFAMLIALPILTFIAMLSGIVGGAVVCAVSLDIPLTMYMSIL 307

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             +  L +   GL+KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI++D
Sbjct: 308 QDSDLLRHFLVGLLKAPIFAFLIALIGCLEGFKVSGSAQSVGEHTTSAVVQSIFVVILLD 367

Query: 362 SLFAIFYFAIG 372
           +L A+F   +G
Sbjct: 368 ALAALFLMEMG 378


>gi|82702739|ref|YP_412305.1| hypothetical protein Nmul_A1612 [Nitrosospira multiformis ATCC
           25196]
 gi|82410804|gb|ABB74913.1| Protein of unknown function DUF140 [Nitrosospira multiformis ATCC
           25196]
          Length = 384

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 111/366 (30%), Positives = 191/366 (52%), Gaps = 5/366 (1%)

Query: 9   FRFAGNWKSPEISEIADD--VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
               GNW     + + +   ++   ++ + +    VDL  +  +DT GA  +   +    
Sbjct: 21  LNVRGNWTLENYAALGEQIALLRHRSRGLAAAGRNVDLGGLAALDTAGAARLYELLG-AE 79

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
              +L        +  +L+    +      K  +     +F  +  H G  +  F     
Sbjct: 80  LAGELAASDALSRERSALLLMVAKAMEAAGKVSQRRQRGAFIEIFGHAGVALEIFRQQIL 139

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +G  +           +++  L S++ Q++  G++ VP++ L++F+ GAVIA  G
Sbjct: 140 ALLGFMGFTLDALARGLLHPKRWR--LTSIVAQIHETGLNAVPIIALLNFMVGAVIAFLG 197

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L+ FGA I++++L++   LRE+GVLLTA+++AGR+ S   A++GSMKINEEIDA R 
Sbjct: 198 ATVLANFGASIYTVNLVTFAFLRELGVLLTAILMAGRTASTFTAQLGSMKINEEIDATRV 257

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ V +L+ PR+ AL +SLP+LT +   S I+G ++V     DI  A+F + F     
Sbjct: 258 LGLNPVNLLVLPRVLALFVSLPILTFVGMISGILGGALVCALQLDISLAMFLTIFQDQIE 317

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L +   G+ KAP  A  IG++   EG  V   + S+G+  T  VV SI +VI +D++ A+
Sbjct: 318 LRHFLVGMSKAPVFAFVIGVIGCLEGLKVSGSALSVGQHTTASVVHSIFVVIFLDAMAAL 377

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 378 FFMEMG 383


>gi|208435334|ref|YP_002267000.1| ABC transport system permease [Helicobacter pylori G27]
 gi|208433263|gb|ACI28134.1| ABC transport system permease [Helicobacter pylori G27]
          Length = 377

 Score =  249 bits (635), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGSLKMDFSGCQKVDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     +   +GK IV+  
Sbjct: 72  KERSLSIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---MITKLGKSIVETC 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSILFSKLNI 377


>gi|148925785|ref|ZP_01809473.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|145845795|gb|EDK22886.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8486]
          Length = 369

 Score =  248 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 112/369 (30%), Positives = 184/369 (49%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  + +++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKESLNSRFQILFELCEKNYQRLGKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LIKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      ++ PR+ AL+I++PL+  +++  +IIG  +V     DI FA F  RF   
Sbjct: 241 NTMGFRSFEFIVIPRVMALVIAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVILTSTGI 369


>gi|119385048|ref|YP_916104.1| hypothetical protein Pden_2317 [Paracoccus denitrificans PD1222]
 gi|119374815|gb|ABL70408.1| protein of unknown function DUF140 [Paracoccus denitrificans
           PD1222]
          Length = 364

 Score =  248 bits (634), Expect = 9e-64,   Method: Composition-based stats.
 Identities = 122/366 (33%), Positives = 198/366 (54%), Gaps = 19/366 (5%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V R AG +    + ++  +            ++ ++LS +T +DT  A  +     +   
Sbjct: 18  VLRLAGEFTVWTLGQLPPE---------AGTASRLELSGLTRLDTAAAWYLT---GRERE 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
              L G++    QL   +          Q    S     ++ +    G+++V  +     
Sbjct: 66  GASLDGLTGTQAQLLDTVRQAL-----PQPEAESAGPAGWRLMLEQTGRRMVAALVFLRE 120

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
            A  LG  ++           F+    SL+      G+  VP+V L+SF+ G V+A QGA
Sbjct: 121 IAEYLGRFLAALARGIRHPGDFR--FTSLVYHCQETGLRAVPIVALMSFLIGIVLAFQGA 178

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL QFGAE+F IDL++I  LRE+G+LLTA+++AGR+ SA+ A IGSMK+NEEIDA+RT+
Sbjct: 179 VQLRQFGAEVFVIDLIAISILRELGILLTAIIVAGRTASALTASIGSMKMNEEIDAMRTL 238

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD   +LI PR+ ALII+LP+L ++AN + ++G +++ W    I  ++F  R  +  ++
Sbjct: 239 GLDPDMVLILPRVLALIITLPILGLIANIAGLVGGALMSWIELGISPSMFRYRLLADTSV 298

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            ++  GL KAP  A  IG++    G  VG  + SLG + +  VV +I  VI+ D+LF+IF
Sbjct: 299 DHVIVGLSKAPVFALIIGVIGCHAGMKVGKDAESLGAETSRAVVNAIFAVIVADALFSIF 358

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 359 FSEVGL 364


>gi|217033903|ref|ZP_03439327.1| hypothetical protein HP9810_870g35 [Helicobacter pylori 98-10]
 gi|216943666|gb|EEC23111.1| hypothetical protein HP9810_870g35 [Helicobacter pylori 98-10]
          Length = 377

 Score =  248 bits (634), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 178/371 (47%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGPLKMDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  +    Y     L   +GK IVK  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKEAGKHYEL---LITKLGKSIVKTY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSAFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDLGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIIFSKLNI 377


>gi|207091861|ref|ZP_03239648.1| hypothetical protein HpylHP_01931 [Helicobacter pylori
           HPKX_438_AG0C1]
          Length = 377

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   ++D +    +   +
Sbjct: 14  DGADSVLILRGDWDFKTSVFRLDELKKNLLDH--QGSLKMDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIVFSKLNI 377


>gi|312797432|ref|YP_004030354.1| ABC transporter permease protein [Burkholderia rhizoxinica HKI 454]
 gi|312169207|emb|CBW76210.1| ABC transporter permease protein [Burkholderia rhizoxinica HKI 454]
          Length = 390

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 93/370 (25%), Positives = 174/370 (47%), Gaps = 16/370 (4%)

Query: 9   FRFAGNWKSPEISEIADD-----VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            R  G W +  ++           +  +  +      + DLS I  +D +GA+ +     
Sbjct: 31  IRLGGQWTALSLALDQRRGGIAAKLRTLRDAAARADTLWDLSPIQRLDHVGAQALWQIWG 90

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           ++        ++    ++F  I+     +   +         +  +    +G  +  F  
Sbjct: 91  RHLPCGLS--LTDTQREIFERIALLDATREPAEP-------AAAIDPITRLGLAVFGFAG 141

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG ++ + G       +       +   +Y  G   +P+  L++F+ G V++
Sbjct: 142 HLRDGITLLGGLVIDCGRLLRDPRRIP--WSEISANVYAAGAQALPITALVAFLIGIVLS 199

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L A+++AGRSGSAI A++G M++ EE+DA
Sbjct: 200 YLSAQQLRLFGANAYIVNILGLSIIRELGPVLAAILVAGRSGSAITAQLGVMRVTEELDA 259

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL I  +  A+ G  +      +I  + F     S
Sbjct: 260 MRVMGISHGLRLILPRVIALGVAMPLLVIWTDAIALAGGMLAAQLVLNIDMSFFIRSLPS 319

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I +V    G  +  +S SLG+  TT VV SI++V++ D++
Sbjct: 320 VVPVANLYLGLGKGVAFGMLIALVGCHFGLRIKPNSQSLGEGTTTSVVSSITVVMLADAV 379

Query: 364 FAIFYFAIGI 373
           FAI +  IG+
Sbjct: 380 FAIMFQRIGL 389


>gi|302039183|ref|YP_003799505.1| putative ABC transporter permease [Candidatus Nitrospira defluvii]
 gi|300607247|emb|CBK43580.1| putative ABC-type transport system, permease component [Candidatus
           Nitrospira defluvii]
          Length = 373

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 112/368 (30%), Positives = 181/368 (49%), Gaps = 15/368 (4%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM--- 62
               R  G W  P+++ +   +           + + + S I   DT GA ++   +   
Sbjct: 15  GRTLRCRGAWTMPDVAPVERALRRM--TWPARSALVFEASGIEAFDTGGAVVLYRALMEA 72

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +   ++ +QG+     QL SL+S      +    P+++                I   +
Sbjct: 73  RRQGCEVSIQGLRPDYAQLMSLVSSHWAAMVAEVAPRQNGS--------ERFRASIRNRV 124

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                    LG   +      AS  + +    S +  +   GV  +P+  L++F+ G VI
Sbjct: 125 AQGAGALEFLGESATALVRLVASPRRLR--WRSCLNSLRLDGVHALPITGLLTFLIGVVI 182

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL +FG  IF +DL+ I  LREI  L+ A++IAGRSGSA  A+IG+MK+ EE+D
Sbjct: 183 AYQGAEQLRKFGTNIFIVDLVGISLLREIAPLIAAILIAGRSGSAYAAQIGTMKVTEELD 242

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++T GL  + +L+ PR+ AL+++LPLLT  A+   + G  ++     ++ F  F SRF 
Sbjct: 243 ALQTFGLSPIELLVLPRVLALVVALPLLTAYADVLGVFGGMLIASNQLNVSFTAFLSRFE 302

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               L ++  GL KAPF A  I +V   +GF +    + +G+  T  VVQSI +VII D+
Sbjct: 303 EAVALRHMLIGLGKAPFFAVIIALVGCYQGFQIRGGVDDVGRHTTISVVQSIFLVIIFDA 362

Query: 363 LFAIFYFA 370
           + +I    
Sbjct: 363 ICSILLNW 370


>gi|15965586|ref|NP_385939.1| hypothetical protein SMc00174 [Sinorhizobium meliloti 1021]
 gi|307302706|ref|ZP_07582462.1| protein of unknown function DUF140 [Sinorhizobium meliloti BL225C]
 gi|307318554|ref|ZP_07597988.1| protein of unknown function DUF140 [Sinorhizobium meliloti AK83]
 gi|15074767|emb|CAC46412.1| Probable ABC transporter [Sinorhizobium meliloti 1021]
 gi|306895894|gb|EFN26646.1| protein of unknown function DUF140 [Sinorhizobium meliloti AK83]
 gi|306903070|gb|EFN33661.1| protein of unknown function DUF140 [Sinorhizobium meliloti BL225C]
          Length = 379

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 152/371 (40%), Positives = 216/371 (58%), Gaps = 10/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +      + F+G+W+      +A  +     +      +  D S IT +DT GA +I  F
Sbjct: 18  AAGNGRRYVFSGDWRHETAEAMAAKLKRL--EKPAGGQSEFDFSGITRMDTAGAWIIRRF 75

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           M     +++  G   + E + +L     R        + +     F+ L   +G+  V  
Sbjct: 76  MNGTADEVRFTGGERYAELVRALPKQLRR------PEESATRMPLFQRLFTPVGELTVSI 129

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D+ +   ILG  +                  +++ Q+  +GV   P++ L+SF+ GA+
Sbjct: 130 WTDTVAAMFILGSAVRGAQMKLGRHAGVSP--AAIVHQIDRMGVMATPIITLMSFLIGAI 187

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAEIF +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+
Sbjct: 188 IAQQGAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEV 247

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL  V +L+ PR+ AL I LPLLTI+ANF+A+ GA++V W Y DI    F +R 
Sbjct: 248 DALKVMGLSPVGVLVFPRLVALTIVLPLLTIIANFAALAGAAMVAWTYSDITIPTFLARL 307

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                 +++  G+IKAPFMA  IG+VA  EG  VG  + SLG++VT+ VV+SI +VI+ID
Sbjct: 308 QEAVDFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTSSVVKSIFVVILID 367

Query: 362 SLFAIFYFAIG 372
            LFA+FY AI 
Sbjct: 368 GLFAMFYAAID 378


>gi|298735565|ref|YP_003728086.1| putative ABC transport system permease protein [Helicobacter pylori
           B8]
 gi|298354750|emb|CBI65622.1| putative ABC transport system permease protein [Helicobacter pylori
           B8]
          Length = 377

 Score =  248 bits (633), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGSLKMDFSGCQKVDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG  QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGVLQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F+ +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFSSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIVFSKLNI 377


>gi|328954405|ref|YP_004371739.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454729|gb|AEB10558.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 418

 Score =  247 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 96/368 (26%), Positives = 181/368 (49%), Gaps = 6/368 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +G      +G  +  +++  + ++   + +  Q  S  +DL  +  +D+ GA  ++   E
Sbjct: 57  DGGQKLLISGRLELFDLAIFSREI-QPLLQQPQLSSVGLDLGGLEYLDSAGALAVLQLAE 115

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K   +  +  +     ++  ++     + + +                  +G+  + F  
Sbjct: 116 KLKSQGIICTLDNISPKIKKILDLIDIQALTHPP---LITVGKRFGWISQVGEASLAFWR 172

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D        G ++ +    C    + +     ++  M   GV G+P+V LI  + G +IA
Sbjct: 173 DIIEVIAFFGELLLDLASVCLRPRRVR--WEYVMFYMKRAGVDGLPIVSLIGLLLGLIIA 230

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              + QL QFGA I+   L+ +  +RE+G ++TA+++AGRSGSA  AEIGSMK++EE+DA
Sbjct: 231 FMSSLQLQQFGANIYVASLLGVAMVRELGPIMTAILVAGRSGSAFAAEIGSMKVSEEVDA 290

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MG + +R+L +P++ A ++ +PLLTI A+   IIG  IV     D+    +      
Sbjct: 291 LTVMGFNPMRMLTTPKVIASLVVVPLLTIYADLLGIIGGLIVGVTMLDLTVYSYIQETRR 350

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             TL +  +  IK+   A  I  +  + GF V   ++++G   T+ VV +I ++I++DS+
Sbjct: 351 ILTLFDFTSSFIKSVVFAFLIAAIGCQRGFQVRGGASAVGSATTSAVVAAIFLIIVVDSI 410

Query: 364 FAIFYFAI 371
           FAI    +
Sbjct: 411 FAIVLTYV 418


>gi|254779978|ref|YP_003058085.1| ABC-type transport system, permease; putative membrane protein
           [Helicobacter pylori B38]
 gi|254001891|emb|CAX30141.1| ABC-type transport system, permease; putative membrane protein
           [Helicobacter pylori B38]
          Length = 377

 Score =  247 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 179/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKKLLDH--QGPLKMDFSGCQKVDFVFGMFLFDLI 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      +I     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KERSLNIELCNVSENNACALKVIKDWLEKEEDLESKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG  QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGTLQLQDMGAPLVSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSIVFSKLNI 377


>gi|126666401|ref|ZP_01737380.1| ABC transporter, permease protein, putative [Marinobacter sp.
           ELB17]
 gi|126629202|gb|EAZ99820.1| ABC transporter, permease protein, putative [Marinobacter sp.
           ELB17]
          Length = 387

 Score =  247 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 110/364 (30%), Positives = 191/364 (52%), Gaps = 4/364 (1%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G+W  P    +   V  A   S +     ++L  +  IDT GA L+   +  ++ +
Sbjct: 27  ISACGDWTLPYYHALYSSVTAAGQDSDRYQ--TLNLQTLGRIDTAGAALLAELVGPHNLE 84

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
             L      + +  + +       + +Q+P  +    +   L   +G  + +      + 
Sbjct: 85  QWLADNPQAVSRETAALLSAVATAMADQQPLPAPPGFTLSGLVRDVGAWVNELYQLVVTL 144

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +G +I+          +++    + +  +   G++ VP+V L++F+ GAV+A  GA 
Sbjct: 145 IGFIGQIIAALAWTTLHPRRWRM--TAFVAAVQDTGLNAVPIVALLTFLVGAVVAFLGAT 202

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ FGA I++++L++   LRE GVLL A+++AGR+ S+  A+IG+MK+NEE+DA+RT+G
Sbjct: 203 VLADFGATIYTVNLVAFSFLREFGVLLAAILLAGRTASSFTAQIGAMKVNEELDALRTLG 262

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           L  + +L+ PR+ A+++SLPLLT +   S ++G ++V     DI    F S       L 
Sbjct: 263 LSPIELLVLPRVLAMMVSLPLLTFVGMISGMVGGALVCSMTLDITPTQFISIVSQDVALK 322

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL KAP  A  I  VA  EGF V   + S+G   T+ VVQSI +VI+ DS+ A+F+
Sbjct: 323 HLLVGLSKAPIFAFLIAAVACLEGFKVSGSAQSVGVHTTSSVVQSIFMVILFDSIAALFF 382

Query: 369 FAIG 372
             +G
Sbjct: 383 MEMG 386


>gi|86152962|ref|ZP_01071167.1| ABC transporter, permease [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85843847|gb|EAQ61057.1| ABC transporter, permease [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 369

 Score =  247 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 110/369 (29%), Positives = 184/369 (49%), Gaps = 13/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKITKEGLNSRFQILFELCEKNYQRLGKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LIKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      ++ PR+ AL++++PL+  +++  +IIG  ++     DI F  F  RF   
Sbjct: 241 NTMGFRSFEFIVIPRVMALVVAMPLIVAISDAISIIGGMMIAKLNLDISFVEFLRRFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + +IF GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALF 360

Query: 365 AIFYFAIGI 373
           ++   + GI
Sbjct: 361 SVVLTSAGI 369


>gi|218780630|ref|YP_002431948.1| hypothetical protein Dalk_2788 [Desulfatibacillum alkenivorans
           AK-01]
 gi|218762014|gb|ACL04480.1| protein of unknown function DUF140 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 377

 Score =  247 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 97/366 (26%), Positives = 177/366 (48%), Gaps = 6/366 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++   ++ R  G         +A  +  AI K   +   ++DL  +T +D  GA L+ + 
Sbjct: 13  NDGKGSILRLHGPLDQDAYFALAGPLRQAIKKGC-AGELVIDLKDVTRLDDFGALLLAHV 71

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            +  H       +      +  ++   H +++ N        +    N    +G  I+  
Sbjct: 72  HKAAHAVNSPCSIEAARPSVREVLDLLHFQRLINAPALEKPKHE---NPFVALGGAIIDK 128

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +  +       G V+          +  +     ++  M  VGV  VP+V LI+F+ G +
Sbjct: 129 VLGAKELIDFTGDVLLCAAIVVRHPFSMR--WDDMLTAMRKVGVDAVPIVGLINFLLGFI 186

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A   + QL QFGA I+   L++I  +RE+G ++TA+++ GRSGSA  +EIG+MKI+EE+
Sbjct: 187 MAFMTSVQLKQFGANIYVAPLVAIAMVRELGPIMTAIVVTGRSGSAFASEIGAMKISEEV 246

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMG + V  L+ P++ A +I +P+LT+ A    I+G  +V   + D+  + + S  
Sbjct: 247 DALSTMGFNPVVFLVMPKMTAAMIVMPILTVFACLFGILGGLLVGVVFLDLTLSNYLSET 306

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             + ++  +     KA   A  I  +    GF V   S+++G+  T+ VV  I ++I+ D
Sbjct: 307 IDSLSMYAVNWCFFKAVVFAFLITWIGCLRGFQVKGGSSAVGEATTSSVVSGIFLIILWD 366

Query: 362 SLFAIF 367
            +FA  
Sbjct: 367 CIFAFI 372


>gi|307825468|ref|ZP_07655686.1| protein of unknown function DUF140 [Methylobacter tundripaludum
           SV96]
 gi|307733354|gb|EFO04213.1| protein of unknown function DUF140 [Methylobacter tundripaludum
           SV96]
          Length = 379

 Score =  247 bits (632), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 101/372 (27%), Positives = 178/372 (47%), Gaps = 14/372 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +G +  +  G+W    +   A ++   I+    + +   DLS+I  +D+  + ++    
Sbjct: 20  SDGQSCVKLTGSWNLRSLVT-ATELNRKISSHAANKNIQWDLSSIEVLDSASSLILWKAW 78

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIG-KKIVKF 121
            K         +    ++LF         + + QK        S  +L    G +    F
Sbjct: 79  GKKLP--VALQLKPEHQRLFD--------RWQAQKIPEPEPVGSSSSLIIKYGYQLFANF 128

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                    +LG +  + G               +   +Y  GV  + +  L+ F+ G V
Sbjct: 129 WGQLLQLVTLLGQLFLDIGYLLLHPGDIP--WSEISITIYESGVRALGITALVGFLIGIV 186

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   A QL  FGAEI+ ID++ +  +RE+G LL A+++AGRSGSA+ A+IG M++ EE+
Sbjct: 187 LSYLSALQLKIFGAEIYIIDILGLSVIRELGPLLAAILVAGRSGSAMTAQIGIMRVTEEL 246

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MG+     L  P++ AL I LPL+ +  +  A+IG  +      DI +  FF + 
Sbjct: 247 DALSAMGISHSLRLTLPKVMALTIVLPLIGVWTSALALIGGMVSAQNTLDISYQQFFLKL 306

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L N+F GL K+      I ++A   GF +  ++ SLG + T  VV +I++VI++D
Sbjct: 307 PDVVPLTNVFIGLGKSAVFGLMIALIACHFGFRIKPNTESLGNETTNSVVAAITVVIMVD 366

Query: 362 SLFAIFYFAIGI 373
           ++FAI +  +G+
Sbjct: 367 AVFAILFMNVGM 378


>gi|317013234|gb|ADU83842.1| putative ABC transport system permease protein [Helicobacter pylori
           Lithuania75]
          Length = 377

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 103/371 (27%), Positives = 179/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   ++D +    +   +
Sbjct: 14  DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGSLKMDFSGCQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  RERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKHYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 STFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  R H
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRLH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 VFSIVFSKLNI 377


>gi|186474974|ref|YP_001856444.1| hypothetical protein Bphy_0205 [Burkholderia phymatum STM815]
 gi|184191433|gb|ACC69398.1| protein of unknown function DUF140 [Burkholderia phymatum STM815]
          Length = 379

 Score =  247 bits (631), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 99/370 (26%), Positives = 175/370 (47%), Gaps = 14/370 (3%)

Query: 8   VFRFAGNWKSPEISEIA----DDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           + R +G W +  ++           +      ++  A  DLS +  +D +G + +     
Sbjct: 19  IVRLSGQWTALALARDRLHGQALPRLRELVDSRAHVAQWDLSNVERMDHVGGQALWRVWG 78

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
            Y     L  ++     +F  I+     +   +  +R        +    +G  I  F+ 
Sbjct: 79  -YKLPRDLVALNDTQRDIFDRIALLDTVRENPEPVRR-------FDPFTQLGLGIFSFVE 130

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  + G VI +      +          +   +Y  G   +P+  L++F+ G V++
Sbjct: 131 HVYGGVAMFGRVILDLLSIARNPKLAP--WKEISANVYSAGTQALPITALVAFLIGIVLS 188

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  F ++++ +  LRE+G +L+A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 189 YLSAQQLRLFGANQFIVNILGMSVLRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDA 248

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL +  N  +++G ++       I  + F      
Sbjct: 249 MRVMGIPHGLRLILPRVIALSLAMPLLVMWTNIISLLGGALAAKLVLQIDVSYFVRALPG 308

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I I     GF +  +S SLG+  TT VV SI+IVI+ D++
Sbjct: 309 VVPVANLWIGLGKGMVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVSSITIVILADAV 368

Query: 364 FAIFYFAIGI 373
           FAI +  +G+
Sbjct: 369 FAILFQNVGL 378


>gi|330501346|ref|YP_004378215.1| hypothetical protein MDS_0432 [Pseudomonas mendocina NK-01]
 gi|328915632|gb|AEB56463.1| hypothetical protein MDS_0432 [Pseudomonas mendocina NK-01]
          Length = 381

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 120/371 (32%), Positives = 202/371 (54%), Gaps = 5/371 (1%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +  +  R  G+W     S++   V+    +        VDL  +  +DT GA L++  
Sbjct: 15  STDAASGLRLGGDWTLAHYSQLEPQVLALRERL--HGKESVDLGDLAALDTAGAALLVEL 72

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                 +  +Q      E+  +L+         +   Q +   +  + +  HIG+ +   
Sbjct: 73  FGSERLRQLIQQA-ELDERRRALLLTVADAMAGSAPAQAASEPSVLREVLGHIGEVVEGM 131

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            +   +    +GL +++         +++  L SL   +   G++ VP+V L++F+ GAV
Sbjct: 132 WHQGRALLGFMGLTLTSMLAILVRPMRWR--LTSLAAHLEQCGLNAVPIVALLTFLVGAV 189

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA  L+ FGA I++++L++   LRE GVLLTA+++AGR+ SA  A+IGSMK NEEI
Sbjct: 190 VAFLGATILADFGATIYTVNLVAFSFLREFGVLLTAILMAGRTASAFTAQIGSMKANEEI 249

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DAIRT+GL  + +L+ PR++A++I+LP+LT +A  S I+G  +V     DIP  ++ S  
Sbjct: 250 DAIRTLGLSPIELLVLPRVFAMLIALPILTFIAMLSGIVGGGLVCAVSLDIPVTMYLSIL 309

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             +  L +   GL+KAP  A  I ++   EGF V   + S+G+  T+ VVQSI +VI++D
Sbjct: 310 QDSDLLRHFLVGLLKAPIFAFLIALIGCLEGFKVSGSAQSVGEHTTSAVVQSIFVVILLD 369

Query: 362 SLFAIFYFAIG 372
           +L A+F   +G
Sbjct: 370 ALAALFLMEMG 380


>gi|163759630|ref|ZP_02166715.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica
           DFL-43]
 gi|162283227|gb|EDQ33513.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica
           DFL-43]
          Length = 428

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 148/370 (40%), Positives = 221/370 (59%), Gaps = 4/370 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             G       G+W+   I+ +  +++  + K I     ++DLS ++  DT GA L+   M
Sbjct: 62  SGGRQRLALWGDWRHAAIAGVYGELLS-VQKKISGADLVIDLSDLSNFDTAGAWLVRKTM 120

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
               G+     +    + +  L+S          +   +     F+ +   +G+ + +  
Sbjct: 121 VVAKGQGASVEIEGASKPVSGLLSAIPD-PADRAEVAATERAPLFQRIFAPVGRALYELF 179

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +D  +  +ILG  +                  +++ Q+ ++GV  VP+++L+SF+ GA+I
Sbjct: 180 DDLIASMYILGSAVRGAQLKL--DRSAGISPAAIVTQIDHMGVRAVPIIMLMSFLIGAII 237

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           AQQGAFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+D
Sbjct: 238 AQQGAFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVD 297

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ +GL+ V +L+ PR+ AL ++LPLLT++ANF+A+ GA+ V W Y  I   VF SR  
Sbjct: 298 ALKVIGLNPVGVLVFPRLVALTVALPLLTVVANFAALAGAAAVAWSYSGITPDVFTSRLR 357

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +  + +G+IKAPFMA  IGIVA  EG  VG  + SLG++VT  VV+SI +VI++D 
Sbjct: 358 EAIDMTTVASGMIKAPFMALIIGIVASVEGMKVGGSAESLGRRVTASVVKSIFVVILVDG 417

Query: 363 LFAIFYFAIG 372
           LFAIFY AI 
Sbjct: 418 LFAIFYAAID 427


>gi|237747194|ref|ZP_04577674.1| ABC transport system permease [Oxalobacter formigenes HOxBLS]
 gi|229378545|gb|EEO28636.1| ABC transport system permease [Oxalobacter formigenes HOxBLS]
          Length = 374

 Score =  246 bits (629), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 93/370 (25%), Positives = 178/370 (48%), Gaps = 13/370 (3%)

Query: 5   GITVFRFAGNWKSPEISE--IADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           G T     GNW+   ++   + + +   +    +  S   DL+ I E+D IGA+L+    
Sbjct: 15  GNTCVIARGNWRVESLAASGVINRIRSTVRSFSKKGSVSWDLTQILELDYIGAQLLWDNW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            K   +  L   ++   +LFS +      ++  +KP     +   +              
Sbjct: 75  NKTRPRELLV--TSEQNKLFSRLESAGNLQLPAEKPAHWQLFGRIRKFPQ-------AAA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G ++ +   F  + +  +G    +   +Y+ G   + +  ++ F+ G V+
Sbjct: 126 EHFSGIVGLVGQLMIDLARFAKAPH--RGPWTEISANIYHAGAQALGITAIVGFLIGVVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FG ++F ++L+ +  +RE+G LL A+++AGRSGS++ A++G M++ EE+ 
Sbjct: 184 SYLSAQQLHMFGGDVFLVNLLGMSVIRELGPLLAAILVAGRSGSSMTAQLGVMRVTEELS 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MG+     LI P++ AL I +PLL I  +  A++G  +       +    F S   
Sbjct: 244 AMQVMGMSHGFRLIMPKVIALSIVMPLLIIWTDIVALLGGMLAASFEIGLSIPYFLSALP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           +   +AN + G+ K       I ++A   G  +  ++ SLG+  T  VV SI+IVI+ D+
Sbjct: 304 NAVPMANFWIGIGKGIVFGILIALIACYYGMKIKPNTESLGQGTTNSVVTSITIVILADA 363

Query: 363 LFAIFYFAIG 372
           +FA+    +G
Sbjct: 364 IFAVVLQGVG 373


>gi|121603099|ref|YP_980428.1| hypothetical protein Pnap_0182 [Polaromonas naphthalenivorans CJ2]
 gi|120592068|gb|ABM35507.1| protein of unknown function DUF140 [Polaromonas naphthalenivorans
           CJ2]
          Length = 382

 Score =  246 bits (629), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 89/372 (23%), Positives = 180/372 (48%), Gaps = 20/372 (5%)

Query: 11  FAGNWKSPEIS--EIADDVVMAI-------NKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
             G W +  ++   + D +   +         S    +    LS + ++D +GA+++   
Sbjct: 22  LQGAWTAANLTQKPLWDALAAQLKALRAQTASSASPAALRWSLSPLEKLDYLGAQVLWSA 81

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
              +        +      +   +     + +   +P       S+      +G++++  
Sbjct: 82  WNHHWPAGLQ--IEPEQRAMLETVEKFTVRPLPPPRP-------SWLEPVLMLGERLLSL 132

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           ++ +     +LG ++ + G       +       L   +Y  G + +P+  L+ F+ G V
Sbjct: 133 LSHAKGMLRLLGQLLLDMGRLVRHPQQGP--WRDLSGHLYNFGATALPITALVGFLIGVV 190

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A   + QL QFGA+ F ++++ I  +RE+G +L A++IAGRSGSAI A+IG M++ EE+
Sbjct: 191 LAYLISQQLRQFGADAFIVNILGISLIRELGPVLAAILIAGRSGSAITAQIGVMRVTEEL 250

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R MG+     L+ PR  AL + +PL+++    +A++G  +       +  + FF+  
Sbjct: 251 DAMRVMGIARGFRLVMPRAMALALVMPLISVWTTIAALLGGMLAADISMGVTPSFFFNAL 310

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            +   ++N+     K+      I ++    G  V  ++ SLG+  T  VV SI++VI++D
Sbjct: 311 PAAVKVSNLVLATAKSVVFGLLIALIGCHYGLRVKPNTESLGQGTTASVVTSITVVILVD 370

Query: 362 SLFAIFYFAIGI 373
           +LFA+ + ++GI
Sbjct: 371 ALFAVLFKSVGI 382


>gi|28974221|gb|AAO64222.1| putative ABC transport system permease protein Cf0016
           [Campylobacter fetus]
          Length = 367

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 107/369 (28%), Positives = 179/369 (48%), Gaps = 20/369 (5%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
              V +  G +      +   ++              +DL  +  ID   A        K
Sbjct: 19  DNAVLKLDGEFDYTMDKKSLKELRSL-------KVDTLDLKNLIRIDYSAATFFA----K 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           ++   KL   +   +++F+L+S  +   ++  K ++S       NL   IGK I+   N+
Sbjct: 68  HYNCPKLINSNDKFDKIFALVSDKYILNLQIIKFKKS-------NLIEQIGKNIINLKNE 120

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             S    LG  + N  +   + +  +     L    Y  G+S V +V L SF+ G V+A 
Sbjct: 121 LVSFCIFLGEFLFNLTKSLLNPFTVR--FKELSNHFYSAGISAVFIVCLTSFLIGIVLAY 178

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QGA  L  FGA I+ +D+M I+ LRE+G L+ A+++AGRS S+  A+IG MKI +E++A+
Sbjct: 179 QGATMLENFGASIYVVDIMGIMTLREVGPLIAAIVVAGRSASSYTAQIGVMKITDELEAM 238

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           +TMG +  R ++ P  +         +I +      G  +V   Y D+ F+ +  RF S+
Sbjct: 239 KTMGFEPFRFIVMPACFGSYFGYAFYSIFSKRGKYFGQMMVCNWYLDLSFSDYLERFRSS 298

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L + + GL KAPF    I ++  K GF V   +NS+G+  T  VV +I  +I +D++F
Sbjct: 299 IALRHFWVGLFKAPFFGAVIALIGCKRGFEVSGSTNSVGELTTRSVVNAIFWIIALDAIF 358

Query: 365 AIFYFAIGI 373
           +I Y  + I
Sbjct: 359 SIIYTELKI 367


>gi|317011599|gb|ADU85346.1| putative ABC transport system permease protein [Helicobacter pylori
           SouthAfrica7]
          Length = 377

 Score =  246 bits (628), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 105/371 (28%), Positives = 180/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +          +D SA  ++D +    +   +
Sbjct: 14  DGADSVLILRGDWDFKTSVFRLDELKKILLDH--QGPLKMDFSACQKVDFVFGMFLFDLV 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           +     I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 72  KGRSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---LITKLGKSIVETY 128

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 129 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 186

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QGA QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 187 ALQGALQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 246

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F  +  RFH
Sbjct: 247 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFPSYIDRFH 306

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 307 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 366

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 367 IFSIVFSKLNI 377


>gi|116749843|ref|YP_846530.1| hypothetical protein Sfum_2414 [Syntrophobacter fumaroxidans MPOB]
 gi|116698907|gb|ABK18095.1| protein of unknown function DUF140 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 384

 Score =  246 bits (628), Expect = 5e-63,   Method: Composition-based stats.
 Identities = 86/374 (22%), Positives = 164/374 (43%), Gaps = 12/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
              + +    GNW+  +     D ++       +      D   + E D+     ++  +
Sbjct: 20  REDVLLVGLRGNWRIADEPIPVDAIIREFESDPRIRILAFDTGELGEWDSSLLTFLIKVI 79

Query: 63  E---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
           +   +   +    G+   + +L SL S         ++  +             +G + +
Sbjct: 80  DTGVRRGLEADRTGLPEGVGRLLSLASAVPEATDARRQEAKQP-------FLTRVGTQAI 132

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                       LG       +      + +     L+  +   G   +P+V LIS + G
Sbjct: 133 SLAAAVGQMMEFLGEAAIAFFQLVRGRARLRRV--DLMTLIQDCGADALPIVSLISVLVG 190

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            ++A  GA QL  FGA+I+  DL+ +   RE+G ++TAV++AGR+G+A  A++G+M++NE
Sbjct: 191 LILAFVGAVQLRMFGAQIYVADLVGLGMAREMGAMMTAVIMAGRTGAAFAAQLGTMQVNE 250

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA++T+G+  +  L+ PR+ AL++ +P L + A+   I+G  IV      +    ++ 
Sbjct: 251 EIDALQTLGVSPMEFLVLPRMLALVLMMPFLCLYADLMGILGGGIVGVGMLGLSPLEYYH 310

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                  L +   GLIK       I +     G   G  S ++G   T+ VV  I  +++
Sbjct: 311 ETVQAVGLMDFGAGLIKGAVFGVLIALSGCLRGMQCGRSSAAVGLATTSAVVTGIVAIVV 370

Query: 360 IDSLFAIFYFAIGI 373
            D++  + Y  +GI
Sbjct: 371 SDAILTVIYDRLGI 384


>gi|305432464|ref|ZP_07401626.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter coli JV20]
 gi|304444503|gb|EFM37154.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter coli JV20]
          Length = 371

 Score =  246 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 109/362 (30%), Positives = 179/362 (49%), Gaps = 13/362 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEKYHGKI 69
           G W    +S+I    +  +   I   + I D S + EID  G    +     ++K    I
Sbjct: 18  GIWDKTSVSKIK---IKDLLSQISQTNCIFDFSQLNEIDMAGVRFFLALEHDLKKNDILI 74

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
             QG++T  + LF L    +++  + Q+ + +     F +    +G      +       
Sbjct: 75  LKQGLNTRFKSLFELCEKNYQRINEKQEKKFN-----FTDFFISLGILSFDLLKILQKFI 129

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
           +  G   ++      +   F+   +S +  +       +P+VIL + + G V+A Q A+Q
Sbjct: 130 NFTGAFFTSLFLCIKNPKNFR--FISFLYHIENSAFKALPIVILTALLVGVVLAYQAAYQ 187

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L+QFGA IF +DL+ I   RE+  L+ A++IAGRS S+  A+IG MKI +EI+A+ TMG 
Sbjct: 188 LAQFGANIFIVDLVGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEINAMNTMGF 247

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                +I PR+ AL+I++PL+  L++  +I+G  +V     DI F  F  RF     + +
Sbjct: 248 RSFEFIIIPRVMALVIAMPLIVALSDAISILGGMVVAKINLDISFGEFLRRFREAVEMKH 307

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           I  GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF++   
Sbjct: 308 IIIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALFSVVLT 367

Query: 370 AI 371
            +
Sbjct: 368 IM 369


>gi|223936767|ref|ZP_03628677.1| protein of unknown function DUF140 [bacterium Ellin514]
 gi|223894618|gb|EEF61069.1| protein of unknown function DUF140 [bacterium Ellin514]
          Length = 384

 Score =  246 bits (627), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 96/374 (25%), Positives = 177/374 (47%), Gaps = 12/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E G      +G+WKS E+      V   ++      +   D+S +T   +    L+M   
Sbjct: 20  ETGKLQVVASGDWKSGEVFPDVGGVSNKLDVDESIRALSFDVSKVTSWSSGLIGLVMRCR 79

Query: 63  E---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
           E   +        G+   +++L  L            + + +    +   +   IG  ++
Sbjct: 80  ELAMERKIAFDQSGLPQSVQRLIVLALAV-------PEKKDARSLQTRPGIFEKIGLGVL 132

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                       +G              +++     +   M   G   +P+V LI+F+ G
Sbjct: 133 GLRRSGEETLKFIGDCTIAFLALAKRKARYR--WTEVWLIMQQCGPDALPIVALINFLVG 190

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           A++A  GA QLS+FGA I+  DL+ I  +RE+GV++ AV++ GR+G+A  A++G+MK+N+
Sbjct: 191 AILAFVGAVQLSKFGAAIYVADLVGIATMREMGVIMMAVIMCGRTGAAFAAQLGTMKVNQ 250

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA +T+G+  +  L+ PRI  L +  P+L I A+  AI+G  +V     +  FA ++ 
Sbjct: 251 EIDAYKTLGISPIEFLVMPRIMCLWLMFPVLCIFADLMAIVGGGVVALAMLNFSFAEYWQ 310

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
              +  TL + F G++K+      + + +   G   G  + ++G   T+ VV  I++++I
Sbjct: 311 ETVAAVTLTHFFIGIVKSFVFGVLVAMTSCLRGIQCGNDAAAVGLATTSAVVTGITVIVI 370

Query: 360 IDSLFAIFYFAIGI 373
            D++FA+     GI
Sbjct: 371 ADAIFAVILNVFGI 384


>gi|222148407|ref|YP_002549364.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4]
 gi|221735395|gb|ACM36358.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4]
          Length = 376

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 149/365 (40%), Positives = 224/365 (61%), Gaps = 11/365 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY--FMEKYH 66
            R +G+W++  +  +   ++    +   +    +D++ I+ +DT GA +I          
Sbjct: 19  LRLSGSWRNTTVDTVIPKLLEL--RETLNGHVEIDITGISSLDTSGAWIIRRIELAASKQ 76

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
           G +++ G S  + +L S +      +      +       F+ +   +GK  V    D  
Sbjct: 77  GDVQIVGGSDAMRELISAL-----PEQPPLPEKVVDRRPFFQRVLEPVGKMSVSLFEDVL 131

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           + +++LG  +  T        +      S++ Q+ ++G+  VP+++L+SF+ GA+IAQQG
Sbjct: 132 AMSYVLGSAVRGTQSKERRGGRASI--ASIVNQLDHMGLRAVPIILLMSFLIGAIIAQQG 189

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           AFQL  FGAE+F +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+DA++ 
Sbjct: 190 AFQLRYFGAEVFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEVDALKV 249

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL+ + +L+ PRI AL+I+LPLLT++ANF+A+ GA++V + Y  I F VF +R H    
Sbjct: 250 IGLNPIGVLVLPRIVALVIALPLLTVIANFAALYGAAVVSFAYSGITFQVFVTRLHDAVD 309

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            A    GLIKAPFMA  IGIVA  EG  VG  + SLG+ VT  VV+SI +VI++D LFA+
Sbjct: 310 YATFAAGLIKAPFMAVVIGIVAAVEGMKVGGSAESLGQHVTASVVKSIFVVILMDGLFAV 369

Query: 367 FYFAI 371
           FY AI
Sbjct: 370 FYAAI 374


>gi|56479165|ref|YP_160754.1| ABC transporter permease [Aromatoleum aromaticum EbN1]
 gi|56315208|emb|CAI09853.1| Possible ABC transport permease [Aromatoleum aromaticum EbN1]
          Length = 374

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 94/371 (25%), Positives = 176/371 (47%), Gaps = 12/371 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
                  R  G+W    ++  AD+    + ++    +A   L  +T +D+ GA L+ +  
Sbjct: 14  SGARPECRLEGDWTLRALAPRADEFRRLLARA--GPAASWKLDGVTRLDSFGATLLWHAW 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +             +     L +   R +    +P       +  +    +G  ++ F 
Sbjct: 72  REQW--------PQDLSADDELRAVIGRIEATAAEPLPEARAFTLTDAIVVLGAGLLGFA 123

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +   + G +  +          +   L  +   +Y VG    PV  L+ F+ G V+
Sbjct: 124 NHLAAFVQLAGQLCLDIAYLLRHPRDWP--LREISANLYKVGARATPVAALVGFLIGVVL 181

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA+I+ ++++ +  +RE+G +L +V++AGRSGSA+ A++G M++ +E+D
Sbjct: 182 SYLSALQLQAFGADIYIVNILGLGIVRELGPVLVSVLVAGRSGSAMTAQLGVMRVTDELD 241

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  MG+     L+ P++ AL +++PLL +  +  A+ G  +  W   D+ F  F     
Sbjct: 242 ALSAMGISRTVRLVLPKVVALTVAMPLLVLWTSAVALFGGMVSAWVQLDLGFGFFLDTLP 301

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ GL K      +I +VA   G  V  ++ SL    T  VV +I++VI+ID+
Sbjct: 302 RVVPVANLYIGLAKGAVFGLSIALVACHFGLRVRPNTESLSANTTASVVSAITVVILIDA 361

Query: 363 LFAIFYFAIGI 373
           +FAI   +IG+
Sbjct: 362 VFAIATRSIGV 372


>gi|298292077|ref|YP_003694016.1| hypothetical protein Snov_2101 [Starkeya novella DSM 506]
 gi|296928588|gb|ADH89397.1| protein of unknown function DUF140 [Starkeya novella DSM 506]
          Length = 382

 Score =  245 bits (626), Expect = 7e-63,   Method: Composition-based stats.
 Identities = 123/369 (33%), Positives = 195/369 (52%), Gaps = 6/369 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAIN--KSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
            VF   G W + +   +   V  A+   K    ++A +DLS +   DT+GA ++   +  
Sbjct: 18  LVFVGNGRWVAGQGRALEGGVDTALAELKVGAVETARLDLSGVRGFDTVGAVMVDRLLRA 77

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                    +     +   L+    +        +     N+       +G+ +V    D
Sbjct: 78  LEVAGVRFQIVGLERRFRPLLDEIVKGSHDVPPRRH--HVNAVIGGIQLVGQTVVNTGRD 135

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           S      +G V++           F+G   S++  +   G+  VP++ LI+F+ G +IAQ
Sbjct: 136 SLVFLSFIGAVVAALLRVIVRPQTFRG--TSMVYHLERTGLRAVPIIALITFLIGCIIAQ 193

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QG F   +FGA  + +D++ IL LRE+GVL+ ++M+AGRSGSA  AE+GSM++ EE+DA+
Sbjct: 194 QGIFHFRKFGATTYVVDMVGILTLRELGVLIVSIMVAGRSGSAFTAELGSMRMREEVDAL 253

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R MG D   +L+ PR+ ALII++PLLT + N  A+ G  +V W Y  I   +F +R    
Sbjct: 254 RVMGFDPNEVLVLPRLVALIIAVPLLTFIGNMCALFGGGLVAWLYGGISPEIFLNRLQEA 313

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L     G+IKAPFMA  +G++A  EG  VG  + SLG   T  VV++I +VI++D LF
Sbjct: 314 IALNTFEVGMIKAPFMAAIVGLIACMEGMRVGGSAESLGAHTTAAVVKAIFLVIVVDGLF 373

Query: 365 AIFYFAIGI 373
           A+F+ AI +
Sbjct: 374 AMFFAAIDM 382


>gi|57168794|ref|ZP_00367925.1| conserved hypothetical integral membrane protein [Campylobacter
           coli RM2228]
 gi|57019841|gb|EAL56524.1| conserved hypothetical integral membrane protein [Campylobacter
           coli RM2228]
          Length = 371

 Score =  245 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 109/362 (30%), Positives = 179/362 (49%), Gaps = 13/362 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEKYHGKI 69
           G W    +S+I    +  +   I   + I D S + EID  G    +     ++K    I
Sbjct: 18  GIWDKTSVSKIK---IKDLLSQISQTNCIFDFSQLNEIDMAGVRFFLALEHDLKKNDILI 74

Query: 70  KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQA 129
             QG++T  + LF L    +++  + Q+ + +     F +    +G      +       
Sbjct: 75  LKQGLNTRFKSLFELCEKNYQRINEKQEKKFN-----FTDFFISLGILSFDLLKILQKFI 129

Query: 130 HILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQ 189
           +  G   ++      +   F+   +S +  +       +P+VIL + + G V+A Q A+Q
Sbjct: 130 NFTGTFFTSLFLCIKNPKNFR--FISFLYHIENSAFKALPIVILTALLVGVVLAYQAAYQ 187

Query: 190 LSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGL 249
           L+QFGA IF +DL+ I   RE+  L+ A++IAGRS S+  A+IG MKI +EI+A+ TMG 
Sbjct: 188 LAQFGANIFIVDLVGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEINAMNTMGF 247

Query: 250 DFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLAN 309
                +I PR+ AL+I++PL+  L++  +I+G  +V     DI F  F  RF     + +
Sbjct: 248 RSFEFIIIPRVMALVIAMPLIVALSDAISILGGMVVAKINLDISFGEFLRRFREAVEMKH 307

Query: 310 IFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           I  GL KAP     IG++A   GF V   + S+G   T  VV +I  VI  D+LF++   
Sbjct: 308 IIIGLAKAPIFGFLIGLIACFRGFEVKNTTQSIGIYTTKSVVNAIFWVIAFDALFSVVLT 367

Query: 370 AI 371
            +
Sbjct: 368 IM 369


>gi|312115045|ref|YP_004012641.1| hypothetical protein Rvan_2318 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311220174|gb|ADP71542.1| protein of unknown function DUF140 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 385

 Score =  245 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 118/372 (31%), Positives = 189/372 (50%), Gaps = 10/372 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E G      +G+W    + +    V         +    +D+  +  +DT GA  ++   
Sbjct: 21  ERGTRRLIVSGDWTLAALGDAQAAVDDFEAPHGAAHE--IDIGDVRRLDTAGALTLVGLR 78

Query: 63  --EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
             +                 L   I+       +   P+        +            
Sbjct: 79  DGKAAAKTADFFRARPEHRILLDEIARAAPAAFEPPPPRAGAAVEILRRFLS----AATS 134

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              D+      LG   +  G       +F+    +   Q+   G+S VP++ L+SF+ G 
Sbjct: 135 IGRDAIRLTMFLGETTAALGRVVVHPGRFRI--KAFTHQLQQTGLSAVPIIALVSFLIGG 192

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+ QQ AFQL +FGAE  SID++ IL LRE+GV+L AVM+AGRS SA  A+IG+MK+ EE
Sbjct: 193 VVMQQSAFQLQKFGAETMSIDMLGILALRELGVILAAVMVAGRSASAFTAQIGTMKMREE 252

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+RT+G+D +  L+ PR+ AL+I+LPLL  LA+  A+ G +++   Y  +   ++  R
Sbjct: 253 IDAMRTLGIDPIETLVLPRVLALMIALPLLVFLADMMALAGGAVMAKLYLSLDTDMYLQR 312

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            +S+    +++ GLIKAPF A  IG+V   EG +    + S+G +VTT VV++I +V+++
Sbjct: 313 LNSSVQAKHLYVGLIKAPFAALVIGLVGCLEGLSAQGSAESVGTQVTTAVVKAIFLVLVL 372

Query: 361 DSLFAIFYFAIG 372
           D++FAIF  A G
Sbjct: 373 DAVFAIFLSAAG 384


>gi|270159818|ref|ZP_06188474.1| putative ABC transporter permease [Legionella longbeachae D-4968]
 gi|289165424|ref|YP_003455562.1| ABC transporter permease protein [Legionella longbeachae NSW150]
 gi|269988157|gb|EEZ94412.1| putative ABC transporter permease [Legionella longbeachae D-4968]
 gi|288858597|emb|CBJ12478.1| putative ABC transporter permease protein [Legionella longbeachae
           NSW150]
          Length = 375

 Score =  245 bits (626), Expect = 8e-63,   Method: Composition-based stats.
 Identities = 102/370 (27%), Positives = 181/370 (48%), Gaps = 14/370 (3%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---M 62
              +   G W   +I  +        ++  ++    +    I+  D+ GA  ++     +
Sbjct: 14  RIRYHCTGIWSVLQIDSLVKRFSA--DELPETKKVTISGEGISHFDSAGALALIKCIDKL 71

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           E+   +++L   +   +QL  LI         +            +NL Y +GK+     
Sbjct: 72  EQRENQVELTDFTETQQQLLELIKSKKDILDYHIP------SAPKENLFYQLGKESENKF 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G + +   E   +  +F   L S+I  +Y  GV+ +P++ L+SF+ G V+
Sbjct: 126 RQVDGLLVLVGDLTTKIIEAFGNWRRF--QLPSIISNIYTTGVTALPILALLSFLIGVVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A Q   QL  +GA  F   L  +   RE   L+TA+++AGR+ SA  A+IGSMK+NEE+D
Sbjct: 184 AYQMGLQLQTYGANSFIAYLSGMAIFREFAPLITAIIVAGRTSSAFTAQIGSMKLNEEVD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ TMGL    +L+ P++  L+I+ PLL   ++  +I+G+ I+      I F  F  R  
Sbjct: 244 ALLTMGLSPTELLVLPKVIGLLIAFPLLIFWSDLFSILGSMIMSNNMLGINFTDFLQRLR 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN-SLGKKVTTCVVQSISIVIIID 361
            T  L+ +  GL KAP  A  I +V   +GF V   +  ++G + T  VVQ++ ++II D
Sbjct: 304 DTVGLSQLNLGLYKAPAFALLIALVGCFQGFKVEAGTEKNIGSQTTKSVVQALFLIIIAD 363

Query: 362 SLFAIFYFAI 371
           +++++ Y  +
Sbjct: 364 AIYSVIYSRM 373


>gi|217031805|ref|ZP_03437308.1| hypothetical protein HPB128_199g13 [Helicobacter pylori B128]
 gi|216946457|gb|EEC25059.1| hypothetical protein HPB128_199g13 [Helicobacter pylori B128]
          Length = 367

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 104/371 (28%), Positives = 181/371 (48%), Gaps = 7/371 (1%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +   +V    G+W         D++   +       S  +D S   ++D +    +   +
Sbjct: 4   DGANSVLILRGDWDFKTSVFRLDELKKNLLDH--QGSLKMDFSGCQKVDFVFGMFLFDLI 61

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
           ++    I+L  VS +      ++     K+   +  +    Y     L   +GK IV+  
Sbjct: 62  KERSLNIELCNVSENNACALKVVKDWLEKEEDLESKKAGKKYEL---LITKLGKSIVETY 118

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           N   +  +  G+++    +   +  +F   +  L+  +   G   +PV IL  F+ G  +
Sbjct: 119 NTFLNAFNFCGMILFYFIKSVFNPKRF--CITPLLYHINESGFKVLPVSILTVFIVGFAV 176

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG  QL   GA + S+++ + L LREIG  +  +++AGRS S+  A+IG MKI EE+D
Sbjct: 177 ALQGVLQLQDMGAPLMSVEMTAKLALREIGPFILTLVVAGRSASSFTAQIGVMKITEELD 236

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG +    L+ PR+ AL+I LPLL  +A+  AI+G    I    D+ F+ +  RFH
Sbjct: 237 AMKTMGFNPFEFLVLPRVLALVIVLPLLVFIADAFAILGGMFAIKYQLDLGFSSYIDRFH 296

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
            T    +   G++KAPF   AI +V    GF V   + S+G+  T  VV ++  +I +D+
Sbjct: 297 DTVGWNHFLVGIVKAPFWGFAIAMVGCMRGFEVKGDTESIGRLTTISVVNALFWIIFLDA 356

Query: 363 LFAIFYFAIGI 373
           +F+I +  + I
Sbjct: 357 VFSIVFSKLNI 367


>gi|114764121|ref|ZP_01443360.1| ABC transporter, inner membrane subunit [Pelagibaca bermudensis
           HTCC2601]
 gi|114543479|gb|EAU46494.1| ABC transporter, inner membrane subunit [Roseovarius sp. HTCC2601]
          Length = 377

 Score =  245 bits (625), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 124/374 (33%), Positives = 200/374 (53%), Gaps = 9/374 (2%)

Query: 1   MSENGI-TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           +SE G   V   +G      +S +               S +VDL+ +  IDT GA L++
Sbjct: 12  LSETGAEAVLSLSGALSIRTVSVLRQRFAALGF----DRSLVVDLAGVERIDTAGAWLLV 67

Query: 60  YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
               +        G+    +    L+    + + +  +  R       + L   IG+ +V
Sbjct: 68  DLEARAQAAGGSFGLRNVSDTTALLLDNVRQARPE--REDRPAAARGIQALLEQIGRAVV 125

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             +         LGL ++  G       +F+  L +L+     VG+  VP+V L+SF+ G
Sbjct: 126 GGLRYFADLTGFLGLFLARLGRVLRHPSQFR--LTALVAHCEDVGLRAVPIVALMSFLIG 183

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A QG+ QL QFGAE+F +DL++I  LRE+G+LLTA+++AGR+ SA  A IGSMK+ E
Sbjct: 184 VVLAFQGSEQLRQFGAEVFVVDLIAISVLRELGILLTAIIVAGRTASAFTAAIGSMKMRE 243

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+RT+GLD   +L  PRI AL++ LP+L ++A+F  + G +++ W    I  ++F +
Sbjct: 244 EIDAMRTLGLDPGVMLFVPRILALLLMLPILGLIADFMGLFGGALMAWLELGISPSMFVT 303

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R      + ++  GL+KAP  A  IG+V    G  V  ++ SLG+  +  VV +I  VI+
Sbjct: 304 RLIEGTGVGHLLVGLVKAPAFALIIGVVGCHAGMQVKGNAESLGRMTSGAVVAAIFAVIL 363

Query: 360 IDSLFAIFYFAIGI 373
            D+LF++F+  +GI
Sbjct: 364 ADALFSVFFAKVGI 377


>gi|182416429|ref|YP_001821495.1| hypothetical protein Oter_4625 [Opitutus terrae PB90-1]
 gi|177843643|gb|ACB77895.1| protein of unknown function DUF140 [Opitutus terrae PB90-1]
          Length = 376

 Score =  245 bits (625), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 90/374 (24%), Positives = 174/374 (46%), Gaps = 18/374 (4%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY-- 60
           +  +      G+W+  +      DVV     S +     + + A+   D+     +    
Sbjct: 18  DGNVLEVELGGSWRITDRRPAWMDVVS----SHRPAKLRLHVDAVERWDSSLLLFLFEIG 73

Query: 61  -FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
            +            +   ++ L + ++ +H   + + +           N    +G   +
Sbjct: 74  EWCRANQVACDTTVLPPRVQTLLTQLASSHATSVPHDRS---------VNFLAVVGNATM 124

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +    +       G  +    +      KF+      + +M   G   +P+V LI+F+ G
Sbjct: 125 ELSRKTQDFVQFFGECVLGAVKLLKRPDKFR--WRDCLEEMQQCGAMALPIVSLIAFLVG 182

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
             +A  GA  L Q+G +I+  DL+ +  +RE+G ++TAV++AGR+G+A  A++G+MK NE
Sbjct: 183 VTLAYIGALVLRQYGGDIYVADLIGMAMVREMGAVMTAVVLAGRTGAAFAAQLGNMKANE 242

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+ T+G+  V+ L+ PR+ AL + +PLL + AN   I+G   V     DI  + ++ 
Sbjct: 243 EIDALETLGISPVQFLVMPRLLALGVMMPLLALYANALGILGGMAVSAGVLDISPSAYWV 302

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
              +  TL ++ +G IKA      +G+     G      +  +G+  T+ VV SI ++++
Sbjct: 303 EMGTIVTLRDVASGFIKAIAFGGIVGLSGCLRGLQAERSAAGVGRAATSAVVTSILLLVV 362

Query: 360 IDSLFAIFYFAIGI 373
            D++FA+ +  IG+
Sbjct: 363 ADAIFAVLFNVIGL 376


>gi|148560485|ref|YP_001258960.1| putative toulene ABC transporter permease [Brucella ovis ATCC
           25840]
 gi|148371742|gb|ABQ61721.1| putative toulene ABC transporter, permease protein [Brucella ovis
           ATCC 25840]
          Length = 365

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 151/364 (41%), Positives = 212/364 (58%), Gaps = 3/364 (0%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V   +G+W S  +  + DD +  I ++    + I+D+S I+ +DT GA LI    ++   
Sbjct: 3   VIHLSGHWISQSVH-LVDDKMRGIEQAGGDKATIIDISGISNLDTAGAWLIERLRQRLAA 61

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           K     +    E    L+        +     R+     F      +G  ++   ND   
Sbjct: 62  KHVDVRLKGVHEAWLPLMEEVGNAVERTLDIPRTKSPFFFIAFLNVLGGAVISMFNDFKM 121

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
             HILG  I                  +++ QM  +GV  +P+++L+S + GA+IAQQGA
Sbjct: 122 AMHILGATIRGAQLKYGRGNGIPI--AAIVTQMDRMGVGAIPIIVLMSTIVGAIIAQQGA 179

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           FQL  FGAEIF +DL+ IL LRE+GVLLTA+MIAGRSGSAI AEI SMK+ EE DA+  +
Sbjct: 180 FQLRYFGAEIFVVDLVGILVLRELGVLLTAIMIAGRSGSAITAEISSMKMREETDALTVI 239

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL+ V +L+ PR+ AL++ LPLLTIL++ SA++GA+ V W Y +I    F SR H    L
Sbjct: 240 GLNPVGVLVFPRLVALVVILPLLTILSDLSALVGAAGVSWLYSNISPEAFISRLHDAVAL 299

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
              F GLIKAPFMA  IGI+A  EG  VG  + SLG++VT  VV++I +VI++D LFA+F
Sbjct: 300 NTYFAGLIKAPFMAMIIGILASVEGMKVGGSAESLGRRVTASVVKAIFVVIVVDGLFAMF 359

Query: 368 YFAI 371
           Y AI
Sbjct: 360 YAAI 363


>gi|254496222|ref|ZP_05109116.1| ABC transporter, permease [Legionella drancourtii LLAP12]
 gi|254354527|gb|EET13168.1| ABC transporter, permease [Legionella drancourtii LLAP12]
          Length = 375

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 99/373 (26%), Positives = 181/373 (48%), Gaps = 14/373 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY-- 60
           +  +  F   G W   ++  +   +    +   ++    V+   I+ +D+ GA  ++   
Sbjct: 11  DEELAQFNCTGRWSVMDVGSLLKKITA--STLPKTQKIKVNGEGISHLDSAGALALIKCV 68

Query: 61  -FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             +++   ++ L G S   +QL  LI                      +N  Y +GK+  
Sbjct: 69  NALKQRDNEVALVGFSKIQQQLLDLIQEKQGILDYQIP------SPPKENFLYKLGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             +        ++G + +   +   +  +F     S++  +   G+  +P++ L+SF+ G
Sbjct: 123 TKLAQVDGLIILIGDLATKLFDAFGNWRRF--QWPSIMSNIDATGIKALPILALLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL+ +GA  F   L  +   RE   L+TA+++AGR+ SA  A++GSMK+NE
Sbjct: 181 VVLAYQMGLQLTTYGANSFIAYLSGMAIFREFAPLITAIIVAGRTSSAYTAQLGSMKVNE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+ TMGL    +L+ P++  L+I+ PLL   A+  +I+G+ I+      I F  F  
Sbjct: 241 EIDALLTMGLSPTELLVLPKVLGLLIAFPLLIFWADIFSILGSMIMANNMLGIGFLDFLQ 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSN-SLGKKVTTCVVQSISIVI 358
           R   +  ++    GL KAP  A  I +V   +GF V   +  ++G + T  VVQS+ ++I
Sbjct: 301 RLRDSVGISQFKLGLYKAPAFALLIALVGCFQGFRVEAGTEKNIGSQTTKSVVQSLFLII 360

Query: 359 IIDSLFAIFYFAI 371
           I D++++I Y  +
Sbjct: 361 IADAIYSIIYSWM 373


>gi|307720548|ref|YP_003891688.1| hypothetical protein Saut_0627 [Sulfurimonas autotrophica DSM
           16294]
 gi|306978641|gb|ADN08676.1| protein of unknown function DUF140 [Sulfurimonas autotrophica DSM
           16294]
          Length = 368

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 106/369 (28%), Positives = 180/369 (48%), Gaps = 13/369 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                 F+G      +++  + +    NK   S   I++L+    +DT  A  +    E+
Sbjct: 13  DGLSLDFSGELTLYNLTQAQNLIE--TNKLSNSQKIIINLANAQYLDTAFALFLTDIQEE 70

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           Y+ +I+    +        L     ++   N    +        ++  + GK   +    
Sbjct: 71  YNAEIECNNKNFLHT--LELTREHKKRLDSNDDIHKK-------SIFEYFGKIFYESYLS 121

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             S    +G +  +   +  S    +     +  ++    V  + +V L SF+ G V A 
Sbjct: 122 FISFMEFIGKIFISFLLYFKSIKNIRI--KEIAFEINESAVRALGIVALTSFLIGLVTAY 179

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL ++G  IF +D+M I   RE+  L+TA++IAGRSGSA  A+IG+MKI +EIDA+
Sbjct: 180 QAAYQLQRYGGNIFIVDMMGISVFRELAPLITAIVIAGRSGSAYTAQIGAMKITQEIDAM 239

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           RTMG D    L+ PRI ALII LP+L  +++  A++G  IV     D+  ++F +R    
Sbjct: 240 RTMGFDPYTFLVLPRIIALIIMLPILIFVSDMMAMLGGIIVADLSLDLIPSLFINRLSEV 299

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             + + + GL+K PF A  I  + +  G  V   + S+G   T  VV+S+  VI+ D++F
Sbjct: 300 VAIKHFYVGLVKGPFFAFLIASIGIYRGLMVKDDTQSIGFNTTKSVVESLFAVIVCDAIF 359

Query: 365 AIFYFAIGI 373
           +I +  +GI
Sbjct: 360 SIAFTNLGI 368


>gi|225165545|ref|ZP_03727365.1| protein of unknown function DUF140 [Opitutaceae bacterium TAV2]
 gi|224800218|gb|EEG18628.1| protein of unknown function DUF140 [Opitutaceae bacterium TAV2]
          Length = 371

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 92/363 (25%), Positives = 172/363 (47%), Gaps = 19/363 (5%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLS-AITEIDTIGAEL---I 58
           +  +   R  G W+           +  +    +     ++L+  +  +D+        I
Sbjct: 24  DGDLLRIRLGGRWRVTA----PRPSLAGVIGDRKPRRIRIELAPNLERLDSALLLFTHEI 79

Query: 59  MYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
             + E++        +S  +  L + ++   + +  +         +   NL   IG+  
Sbjct: 80  RSWCEQHKTDYDTSALSPEVAALCNKLATATQAEPAH---------DRRTNLLTSIGEAT 130

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           ++ ++ +      LG  + +         KF+        +M   G   +P+V LISF+ 
Sbjct: 131 IETVDRATGIMSFLGECLLSFFHLARRPRKFR--WGDCSEEMQQCGAMALPIVGLISFLV 188

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++A Q A  + QFGA+I+  D ++++  RE+G ++T +++AGR+G+A  A IG+MK N
Sbjct: 189 GVIMAYQSAVLMRQFGADIYVADAVALVMAREMGAMMTGIILAGRTGAAFAATIGNMKAN 248

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+ T G+  V  L+ PR+ AL + +PLLT+ AN   I+G   V     DIP   ++
Sbjct: 249 EEIDALSTFGIRPVDFLVLPRLVALALMMPLLTLYANALGIVGGMGVAMGVLDIPPITYW 308

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  +   L++I TGLIKA      +G+     G      ++ +G+  T+ VV  + ++I
Sbjct: 309 NQTVNALDLSDISTGLIKASCFGILVGLSGCHRGMNADRSASGVGRAATSAVVIGMLLII 368

Query: 359 IID 361
           I D
Sbjct: 369 IAD 371


>gi|197105491|ref|YP_002130868.1| ABC transporter, permease protein [Phenylobacterium zucineum HLK1]
 gi|196478911|gb|ACG78439.1| ABC transporter, permease protein [Phenylobacterium zucineum HLK1]
          Length = 375

 Score =  244 bits (624), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 111/371 (29%), Positives = 186/371 (50%), Gaps = 11/371 (2%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                   G+W +  +      +  A++      +  +DLS +  +DT GA  ++     
Sbjct: 14  DRPTVALTGDWTARALGGAGTALAEALDGLT---NIAIDLSGVRRLDTAGAYAVVRAAGP 70

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                K       + +L  ++    R      +P        F +L   +GK +V F +D
Sbjct: 71  AFDASK-VEARPEVRRLLEVVDEAARI-----QPAVRQEPKGFHDLTIRVGKGVVGFGHD 124

Query: 125 SCSQAHILGLVISNTGEFCASSY--KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                  LG ++          +    K    +L+  M   G+  +PVV + +F  GAV+
Sbjct: 125 FIDTMGFLGHLLVVLARSLVLLFVNPRKIRWPALVSIMERAGLDAIPVVAVATFFIGAVV 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  GA  L QFGAE+F+++L+ I  +RE  +++TAV++AGRS S+  AEIGSMK+++EID
Sbjct: 185 AFIGADMLQQFGAEVFAVELIGISMMREFNIVITAVLLAGRSASSFAAEIGSMKMSQEID 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MG+D    L+ PR  AL+I++PLLT +A  + ++G  +V W    +  A F  R  
Sbjct: 245 AMKVMGIDPFEALVFPRFAALLITIPLLTFVATLAGLLGGIVVTWSVLGLGPAFFLQRIV 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + + +  L KAP MA  I  +  ++G   G    SLG++VT  VV +I  +I+ID+
Sbjct: 305 DNVGVDHFWIALSKAPVMAGVIAGIGCRQGLETGGDVESLGRRVTAAVVHAIFAIIVIDA 364

Query: 363 LFAIFYFAIGI 373
           +FA+ Y  +G+
Sbjct: 365 IFAMIYMELGL 375


>gi|170743041|ref|YP_001771696.1| hypothetical protein M446_4933 [Methylobacterium sp. 4-46]
 gi|168197315|gb|ACA19262.1| protein of unknown function DUF140 [Methylobacterium sp. 4-46]
          Length = 394

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 123/369 (33%), Positives = 200/369 (54%), Gaps = 4/369 (1%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
                R  G+W + +   +                  VDLS +  +DT+GA ++     +
Sbjct: 30  DGVQARLTGSWTADQAPAVEAAAAAIAAPGEPGPRVQVDLSGLVRLDTLGAFVLERTRSE 89

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                +    +    +   L+     ++                +    +G  + +   +
Sbjct: 90  IEAAGRAVDYAGARPEHRILLREVAYRRDTPP--PPRRRRLGLLDGLEALGAGLRRLGAE 147

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             S    LG V++      A   +F+    S + QM  +   G P+++LI+F+ G ++ Q
Sbjct: 148 GLSWLGFLGEVVAACLRVLARPRRFRA--ASFVNQMEQIAYRGTPIIMLIAFLVGCIVTQ 205

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           QG  QL +FGA+ F ++++ IL LRE+GVLLTA+M+AGRSGSA  AEIGSM++ EE+DA+
Sbjct: 206 QGIIQLQRFGAQSFVVNMIGILTLRELGVLLTAIMVAGRSGSAFTAEIGSMRMREEVDAL 265

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R MGLD + ILI PRI AL+++LP+L  LA+ +A++G ++    Y ++ F  F +R  + 
Sbjct: 266 RVMGLDPIEILIVPRILALMLALPMLGFLADVAALLGGALTSMAYGNLSFDAFLARLQAV 325

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            ++ +   G++KAPFMA  IGI+A  EGF V   + SLG+ VT  VV+SI +VI++D +F
Sbjct: 326 ISVRHGLVGMLKAPFMALIIGIIATSEGFRVEGSAESLGRHVTASVVKSIFMVIVLDGVF 385

Query: 365 AIFYFAIGI 373
           AIF+ AI +
Sbjct: 386 AIFFAAIDL 394


>gi|255019625|ref|ZP_05291705.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970928|gb|EET28410.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Acidithiobacillus caldus
           ATCC 51756]
          Length = 380

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 102/365 (27%), Positives = 171/365 (46%), Gaps = 13/365 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
               G W    ++   D V   + ++ +      DL AI  +D++GA +I          
Sbjct: 26  LTLRGRWTLRRLTGAMDRVREQLAQAGRGRP--WDLRAIERLDSVGALVIWRAWG----- 78

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
               GV     +L +      R+  + Q P               +G  I+  + D    
Sbjct: 79  ----GVLPADARLSAEQEAVFRRFAQMQTPTAPRRPWGLWARLDALGAHILGVLVDLWGL 134

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG +++           F      +   +   G   +P++ LI F+ G VI+ Q A 
Sbjct: 135 FLLLGALLTELWRALRHPRHFP--WREISATVVRTGPDSLPILSLIGFLIGIVISFQSAP 192

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L+ +GA I+ I +  +  LRE G L+TAV++AGR+GSA  A+IG+M++ EE+DA+RT G
Sbjct: 193 TLASYGANIYIISIAGLSILREFGPLITAVILAGRTGSAFTAQIGAMRVTEELDALRTFG 252

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  V+ LI P++ AL I+LPLL +  +  AI+GA IV      I  + F           
Sbjct: 253 ISPVQRLILPKVIALAITLPLLVVWTDAVAILGAIIVAKLDLGISASFFLREMPIMVPDF 312

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N + G+ K       I  V+   G  V  +++SL ++ T  VV ++++VI+ID++ A+ +
Sbjct: 313 NFWLGIGKGILFGILIAWVSGYHGLKVQPNTDSLSRETTDSVVLTLTLVIVIDAVLAMVF 372

Query: 369 FAIGI 373
              GI
Sbjct: 373 ANTGI 377


>gi|91776717|ref|YP_546473.1| hypothetical protein Mfla_2365 [Methylobacillus flagellatus KT]
 gi|91710704|gb|ABE50632.1| protein of unknown function DUF140 [Methylobacillus flagellatus KT]
          Length = 373

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 96/370 (25%), Positives = 175/370 (47%), Gaps = 11/370 (2%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY-FME 63
           G       G W    +     ++  A+      + A  DL+ + ++DT GA ++   +  
Sbjct: 14  GGKRIVLNGQWSLRALDNDFAELRRALKPYFSDEKAQWDLTQVEQLDTAGAAVLWNGWQG 73

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K  G++    ++     LF  ++      +  + P+       +  L    GK  +   +
Sbjct: 74  KMEGRVT---LTDEQVALFDTLASIETTTVAEKPPRFD-----WLKLVAGFGKLTIFISS 125

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  ++GL++   G        F          +Y  GV+ +PV  L+ F+ G  ++
Sbjct: 126 HVVDFVKLIGLLVLELGYLLRRPQDFP--WREFSANIYKSGVTALPVTALLGFMIGIAMS 183

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA+IF ++++ +  +RE+G +L AV++AGRSGS++ A+IG M++ EEIDA
Sbjct: 184 YLMATQLRTFGADIFIVNILGLAVIRELGPILMAVLVAGRSGSSMAAQIGVMRVTEEIDA 243

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + TMG+  +  ++ P++  L +  P L I  +  A++G ++       + F  FF    +
Sbjct: 244 LATMGISRILRVVLPKVLGLTVIAPFLVIWTSCWALLGGALSANIELGLGFRFFFDYLAA 303

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                NI  GLIK       + ++A   G  +  ++ SL +  T+ VV +I+ VI+ID+ 
Sbjct: 304 VVQPVNITLGLIKGVMFGFIVAVMACHFGLRIKPNTESLSRSTTSSVVTAITCVILIDAA 363

Query: 364 FAIFYFAIGI 373
           FAI    IG+
Sbjct: 364 FAIITSGIGV 373


>gi|329905881|ref|ZP_08274264.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
 gi|327547452|gb|EGF32273.1| ABC-type transport system [Oxalobacteraceae bacterium IMCC9480]
          Length = 372

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 94/368 (25%), Positives = 175/368 (47%), Gaps = 15/368 (4%)

Query: 7   TVFRFAGNWKSPEISE--IADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           +V   +G W+   +++  +   +  A+ +  +      DL+ IT ID IGA+ +     K
Sbjct: 17  SVIVASGAWQVHALADAGVIGQLDAALARLTKPTG--WDLTQITAIDHIGAQWLWNVWGK 74

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                 +  +S   ++ F  +       +   +  R             +G +       
Sbjct: 75  TRPPGLV--LSDRQDEFFQRLEQAGPLTLPEVQKPRWKQ-------LIRLGARTQSLTGH 125

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 +LG ++ +   F  +    +G    +   +Y  G   + +  L+  + G V++ 
Sbjct: 126 LIDVVGLLGQLMFDLRRFALNPR--RGPWKEISSNIYRTGYQALGITALVGMLIGVVLSY 183

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FG +I+ ++++ +  +RE+G LL A+++AGRSGS+I A++G M++NEE+DA+
Sbjct: 184 LSAQQLHSFGGDIYLVNILGMSIIRELGPLLAAILVAGRSGSSITAQLGVMRVNEELDAM 243

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             MGL     LI P++ AL I++PLL I  +  A++G  +       +    F  +    
Sbjct: 244 LVMGLPHGFRLIMPKVLALAIAMPLLVIWTDAMALLGGMVAANLELGLSPRYFLHKLPDA 303

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             LAN + G+ K       I +VA   GF +  ++ SLG   T+ VV +I++VI+ D++F
Sbjct: 304 VPLANYWIGIGKGVVFGGLIALVACHFGFRIKANTESLGAGTTSSVVTAITVVILADAVF 363

Query: 365 AIFYFAIG 372
           AI +  +G
Sbjct: 364 AIVFSGVG 371


>gi|150396764|ref|YP_001327231.1| hypothetical protein Smed_1554 [Sinorhizobium medicae WSM419]
 gi|150028279|gb|ABR60396.1| protein of unknown function DUF140 [Sinorhizobium medicae WSM419]
          Length = 379

 Score =  243 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 149/371 (40%), Positives = 213/371 (57%), Gaps = 10/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +      + F+G+W+      ++  +            +  D S IT +DT GA +I  F
Sbjct: 18  AAGNGRRYVFSGDWRHETAEAMSAKLKRL--GKPAGGQSEFDFSGITAMDTAGAWIIRRF 75

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           M     +++  G   + E + +L                +     F+ L   +G+  V  
Sbjct: 76  MNGTADEVRFAGSDRYAELILALPKQLR------SPEGETARAPLFQRLFAPVGELTVSI 129

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             D+ +  +ILG  +                  +++ Q+  +GV   P++ L+SF+ GA+
Sbjct: 130 WTDTVAAMYILGSAVRGAQMKLGRHAGVSP--AAIVHQIDRMGVMATPIITLMSFLIGAI 187

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IAQQGAFQL  FGAEIF +DL+ ILQLREIGVLLTA+MIAGRSGSAI AEIGSMK+ EE+
Sbjct: 188 IAQQGAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGSMKMREEV 247

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MGL  + +L+ PR+ AL I LPLLTI+ANF+A+ GA++V W Y  I    F +R 
Sbjct: 248 DALKVMGLSPIGVLVFPRLVALTIVLPLLTIIANFAALAGAAMVAWAYSGITIPTFLARL 307

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                 +++  G+IKAPFMA  IG+VA  EG  VG  + SLG++VT+ VV+SI +VI+ID
Sbjct: 308 QEAVDFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTSSVVKSIFVVILID 367

Query: 362 SLFAIFYFAIG 372
            LFAIFY AI 
Sbjct: 368 GLFAIFYAAID 378


>gi|308272474|emb|CBX29078.1| hypothetical protein N47_J00590 [uncultured Desulfobacterium sp.]
          Length = 381

 Score =  243 bits (620), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 108/368 (29%), Positives = 181/368 (49%), Gaps = 8/368 (2%)

Query: 1   MSEN--GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELI 58
           +SE+  G     F G   +     I   ++  ++ S+   S   DL  ++  D  G  ++
Sbjct: 14  ISEDKEGFFTIHFHGEMDAQSSPGIIGKLLGEVD-SLSLLSITADLDDVSYFDDFGLLVL 72

Query: 59  MYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
           +   +    K     V+ +  +  +++      +   ++       N  +     +G+ +
Sbjct: 73  IELQKAAKNKNSSFNVTDNSGKAKNILYLL---ESNFERSVLPAKQNRLQLKITQLGESV 129

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +  I++S      +G V  +  + C      +      I  M   GV+ +P++ LISF+ 
Sbjct: 130 LDNISNSRVFVSFIGSVALSFYQICRHPKSLRIN--DTILHMEKTGVNALPIIALISFLL 187

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G VIA   + QL QFGA ++   L+SI  + E+G ++TA++IAGRSGSA  AEIG+MKI+
Sbjct: 188 GLVIAFMSSLQLEQFGANLYVASLVSIGMVSELGPIMTAIVIAGRSGSAFAAEIGTMKIS 247

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE DA+  MG D    L  PRI A II +PLLT+ A+  AI G  +V     D+  + + 
Sbjct: 248 EETDALFVMGFDPTLFLAVPRILASIIVVPLLTLFADIFAIAGGLVVGVFILDLTTSSYL 307

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  +   L  I  G+ K+   A  I  V    GF     ++++G   T+ VV SI ++I
Sbjct: 308 TQTMNVLNLFEICWGISKSIVFAVIISWVGCLRGFQTKGGADAVGNAATSAVVSSIFLII 367

Query: 359 IIDSLFAI 366
           +IDS+FAI
Sbjct: 368 LIDSMFAI 375


>gi|57505618|ref|ZP_00371545.1| conserved hypothetical integral membrane protein [Campylobacter
           upsaliensis RM3195]
 gi|57016165|gb|EAL52952.1| conserved hypothetical integral membrane protein [Campylobacter
           upsaliensis RM3195]
          Length = 377

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 101/338 (29%), Positives = 165/338 (48%), Gaps = 10/338 (2%)

Query: 39  SAIVDLSAITEIDTIGAELIMYF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKN 95
             I+D   +  ID  G    +     ++K     +   +S   + LF L    +++ +K 
Sbjct: 47  QCILDFHHLEFIDMAGVRFFLALEYELQKRGITSQRVHLSEKFDALFELCEKNYQRILKE 106

Query: 96  QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
            K            L  ++G   +  +         +G   +   +       F+   ++
Sbjct: 107 PKKHFDT-----AELFVNLGVLSLNLLGILKQFICFVGEFFTAFFQCFKKPKTFR--FVA 159

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
            +  +    +  +P+VIL + + G V+A Q AFQL+QFGA IF +DL+ I   RE+  L+
Sbjct: 160 FLYHIENSALKALPIVILTALLVGVVLAYQTAFQLAQFGANIFIVDLVGISATRELAPLI 219

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++IAGRS S+  A+IG MKI +EI A+ TMG      +I PR+ AL++++PL+  +++
Sbjct: 220 AAIVIAGRSASSYTAQIGVMKITDEIAAMNTMGFSTFHFIIIPRVVALVVAMPLIVAVSD 279

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F +I G  +V     DI F  F  RF     L ++  GLIKAP     IG++A   G  V
Sbjct: 280 FVSIFGGMMVAHLNLDINFIEFLRRFKEAVDLKHVIIGLIKAPIFGFLIGLIACFRGLEV 339

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              + S+G   T  VV +I  VI  D+LF++    +GI
Sbjct: 340 KHTTQSIGIYTTKSVVNAIFWVIAFDALFSVILTQMGI 377


>gi|52842264|ref|YP_096063.1| ABC transporter, permease [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629375|gb|AAU28116.1| ABC transporter, permease [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 374

 Score =  243 bits (620), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 109/374 (29%), Positives = 184/374 (49%), Gaps = 13/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF- 61
           E     ++  G+W    +  +      + +    S    ++   I+  D+ GA  +    
Sbjct: 11  EQKNATYQCCGSWSVLTLDGLPKKF--STSPLPDSQQITINGEKISAFDSAGALALKKCI 68

Query: 62  --MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             ++K + +I+L   S   +Q+  LI                      + + Y IGK+  
Sbjct: 69  DELKKRNNQIELVNFSDSQQQMLELIESKQDILSYQLPAVSK------EGVLYQIGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             ++       ++G + +   E  A   +F   L S++  +   G+  +P++ L+SF+ G
Sbjct: 123 NKLHQVDGLIILIGDLSTRLFEAFAYWRRF--HLPSIVSVIDSAGLKALPIIGLLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMKINE
Sbjct: 181 VVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMKINE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  F S
Sbjct: 241 EVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFEDFLS 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ ++II
Sbjct: 301 RLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFLIII 360

Query: 360 IDSLFAIFYFAIGI 373
            D+ F+I Y  +G+
Sbjct: 361 ADAAFSIAYSWMGL 374


>gi|54297975|ref|YP_124344.1| hypothetical protein lpp2030 [Legionella pneumophila str. Paris]
 gi|53751760|emb|CAH13182.1| hypothetical protein lpp2030 [Legionella pneumophila str. Paris]
          Length = 374

 Score =  242 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 108/374 (28%), Positives = 185/374 (49%), Gaps = 13/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF- 61
           E     ++  G+W    +  +      +I+    S    ++   I+  D+ GA  +    
Sbjct: 11  EQKNATYQCCGSWSVLTLDGLPKKF--SISPLPDSQQITINGEKISVFDSAGALALKKCI 68

Query: 62  --MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             ++K + +++L   S   +Q+  LI                      + + Y IGK+  
Sbjct: 69  DELKKRNNQVELVNFSDSQQQMLELIESKQEILSYQLPAVSK------EGVLYQIGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             ++       ++G + +   E  A   +F   L S++  +   G+  +P++ L+SF+ G
Sbjct: 123 NKLHQVDGLIILIGDLSTRLFEAFAYWRRF--HLPSIVSVIDSAGLKALPIIGLLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMKINE
Sbjct: 181 VVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMKINE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  F +
Sbjct: 241 EVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFEDFLT 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ ++II
Sbjct: 301 RLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFLIII 360

Query: 360 IDSLFAIFYFAIGI 373
            D+ F+I Y  +G+
Sbjct: 361 ADAAFSIAYSWMGL 374


>gi|114332197|ref|YP_748419.1| hypothetical protein Neut_2236 [Nitrosomonas eutropha C91]
 gi|114309211|gb|ABI60454.1| protein of unknown function DUF140 [Nitrosomonas eutropha C91]
          Length = 381

 Score =  242 bits (619), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 84/372 (22%), Positives = 173/372 (46%), Gaps = 12/372 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +E G +  +  G++    ++     V   + +         DL+ I ++D  GA ++   
Sbjct: 18  TEAGNSCLQLTGSYTLVSLNPSLPAVARELAQLASQPGLYWDLTNIHQLDYAGAVMLWQI 77

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +      L  +    EQ+F  +          Q+                +G+++++F
Sbjct: 78  WGEQRPDHLL--LRPEQEQMFQRLEKVVSLPEPTQRKWFLP--------VSLLGQQLLRF 127

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            +       + G ++ +         +       +   +Y  G   + +  ++ F+ G V
Sbjct: 128 FDHLAGMISLSGQIVLDIVYLMTHPSRIPV--REISANLYRTGAQALGITAIVGFLIGIV 185

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   + QL   GA+I+ ++++ +  +RE+G +L A+++AGRSGSA+ A++G M++ EE+
Sbjct: 186 LSYLSSEQLHMLGADIYIVNILGMSIIRELGPMLAAILVAGRSGSAMTAQLGVMRVTEEL 245

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MG+     L+  +I  L ++LPL+ +  +  A++G  +       +      +  
Sbjct: 246 DALTVMGIPHSLRLVLSKIIGLSLALPLIVLWTSSVALLGGLLAADLQVGLSIRYAVTTL 305

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                +AN++ GL K      AI ++A   G  +  ++ SLG+  T  VV SI+ VIIID
Sbjct: 306 PDAVPIANLWLGLGKGVVCGMAIALIACHFGLRIKPNTESLGEGTTNSVVTSITAVIIID 365

Query: 362 SLFAIFYFAIGI 373
           ++FA+ + +IGI
Sbjct: 366 AIFAVAFSSIGI 377


>gi|332162490|ref|YP_004299067.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325666720|gb|ADZ43364.1| ABC transporter, membrane permease [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 354

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 114/340 (33%), Positives = 180/340 (52%), Gaps = 2/340 (0%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           ++ Q  S + DL+ +  +DT GA L+   +         +      E+  +L+    R  
Sbjct: 16  RASQPQSVVFDLTQLGALDTAGATLLALLLGDERINHLRELAPKLPEERRTLLETVSRVL 75

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF 152
                       + +     + G+ +     D  S    +GL +           +++  
Sbjct: 76  PDLASESSEKPPSFWLEFLANTGRSVDNLWQDIKSLLGFVGLTLEALFSTIFRPSRWRM- 134

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  
Sbjct: 135 -TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFA 193

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT 
Sbjct: 194 VLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTF 253

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   EG
Sbjct: 254 IGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEG 313

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 314 FKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 353


>gi|107023833|ref|YP_622160.1| hypothetical protein Bcen_2286 [Burkholderia cenocepacia AU 1054]
 gi|105894022|gb|ABF77187.1| protein of unknown function DUF140 [Burkholderia cenocepacia AU
           1054]
          Length = 425

 Score =  242 bits (618), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 95/366 (25%), Positives = 163/366 (44%), Gaps = 33/366 (9%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     V   I        +  DLS I  +D +G + +     +   
Sbjct: 92  TVRLTGQWTALSLARNRGAVARRIASIAAGRVSEWDLSGIERLDHVGGQALWRVWGRKLP 151

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R   ++    L    G  I  F      
Sbjct: 152 AGVALSATQ-----RTIFERIERLDSEREAPERIVRFDPVTRL----GLAIFAFGEHLQG 202

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 203 GITMFGRVILDALSVLRRPKTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 260

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 261 QQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 320

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+                           +
Sbjct: 321 GIPHGLRLILPRVLALGVAMPLLVMWTNIIAL----------------------PGVVPI 358

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 359 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVSSITVVILADAVFAIL 418

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 419 FQNVGL 424


>gi|315453380|ref|YP_004073650.1| ABC transport system permease protein (pseudogene) [Helicobacter
           felis ATCC 49179]
 gi|315132432|emb|CBY83060.1| putative ABC transport system permease protein (pseudogene)
           [Helicobacter felis ATCC 49179]
          Length = 369

 Score =  242 bits (618), Expect = 7e-62,   Method: Composition-based stats.
 Identities = 104/366 (28%), Positives = 174/366 (47%), Gaps = 8/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
                GNW     ++    +   +  +    +  VD   +  +D +   L+   + +   
Sbjct: 12  TLFLRGNWDFKTPAQTLLRLEKLLKNAPPIRA--VDFREVERLDFVFLMLLYDLLGR--K 67

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           K  +   + +   +  ++    ++       + S       N    +G+ IV F N   +
Sbjct: 68  KPAILNANAYNAHVLEVVQHWVKEDPSILSREHSKPPK--INPLNKLGQSIVDFFNTMLN 125

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
             +  G+V+   G            L  LI  ++  G   +PV IL  FV G  IA QGA
Sbjct: 126 TFNFCGMVLYFLGRAIIKPKTL--CLTPLIHHIHESGFKVLPVSILTVFVVGFAIALQGA 183

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL Q G  + SI++ + L LRE+G  +  +++AGRS S+  A+IG MKI EE+DA+ TM
Sbjct: 184 IQLQQLGFPLMSIEMTAKLALREMGPFILTLVVAGRSASSFTAQIGVMKITEELDAMHTM 243

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL     L+ PR+ AL+I +PL+  +A+  A++G  + I     + F  + +R H    L
Sbjct: 244 GLSPFAWLVLPRVLALVIVMPLMVFIADAFALLGTMVAIKYQLGVTFNHYIARLHENVGL 303

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           ++ F GLIKAPF   AI IV    GF V   + S+G   T  VV ++  +I +++LF++ 
Sbjct: 304 SHFFVGLIKAPFWGFAIAIVGCMRGFEVKGDTESIGTLTTISVVNALFWIIFLNALFSVI 363

Query: 368 YFAIGI 373
           +  + I
Sbjct: 364 FSKLNI 369


>gi|323524591|ref|YP_004226744.1| hypothetical protein BC1001_0219 [Burkholderia sp. CCGE1001]
 gi|323381593|gb|ADX53684.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1001]
          Length = 389

 Score =  242 bits (617), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 95/370 (25%), Positives = 169/370 (45%), Gaps = 16/370 (4%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME- 63
           + R +G W +  ++        +    +          DLS I  +D +G + +      
Sbjct: 31  IVRLSGQWTALALARDRATGHVIPQLRSLEGAEGIGQWDLSRIDRMDHVGGQALWRVWGH 90

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +     +L      I +  +L+           +           +    +G  I  F+ 
Sbjct: 91  RMPPDTELTDTQRDIFERIALLDTVRETAEPVVRF----------DPFTRLGLAIFSFLE 140

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  + G V+ +                 +   +Y  G   +P+  L++F+ G V++
Sbjct: 141 HLYGGVAMFGRVVLDLLAIARKPAITP--WTEISANVYNAGTKALPITALVAFLIGIVLS 198

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 199 YLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDA 258

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I  + F      
Sbjct: 259 MRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIALTGGALAAKIVLGIDMSYFARALPG 318

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I IV    GF +  +S SLG+  T+ VV SI+IVI+ D++
Sbjct: 319 VVPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKANSQSLGEGTTSSVVTSITIVILADAV 378

Query: 364 FAIFYFAIGI 373
           FAI +  +G+
Sbjct: 379 FAILFQNVGL 388


>gi|318606570|emb|CBY28068.1| ABC-type transport system involved in resistance to organic
           solvents, permease component USSDB6A [Yersinia
           enterocolitica subsp. palearctica Y11]
          Length = 354

 Score =  242 bits (617), Expect = 9e-62,   Method: Composition-based stats.
 Identities = 114/340 (33%), Positives = 180/340 (52%), Gaps = 2/340 (0%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           ++ Q  S + DL+ +  +DT GA L+   +         +      E+  +L+    R  
Sbjct: 16  RASQPQSVVFDLTQLGALDTAGATLLALLLGDERINHLRELAPKLPEERRTLLETVSRVL 75

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF 152
                       + +     + G+ +     D  S    +GL +           +++  
Sbjct: 76  PDLASESSEKPPSFWLEFLANTGRSVDNLWQDIKSLLGFVGLTLEVLFSTIFRPSRWRM- 134

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
             SLI  +  +G++ VP+++L++F+ GAVIA  GA  L+ FGA IF++DL+    LRE  
Sbjct: 135 -TSLIANIQQIGLNAVPIIMLLTFLVGAVIAFLGATVLTTFGAGIFTVDLVVFSFLREFA 193

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  AEIG MK NEEIDAI+T+GL+ V +L+ PR+ AL+ISLP+LT 
Sbjct: 194 VLLTAILMAGRTASAFTAEIGLMKANEEIDAIQTLGLNPVELLVLPRVLALLISLPMLTF 253

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I G  +V     DI   +F S   ++  L +   G+ KAP  A  I I+   EG
Sbjct: 254 IGMICGIFGGMVVCALALDISPTMFLSIMQNSNGLQHFLVGISKAPIFAFLIAIIGCLEG 313

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G   TT VV SI +VI++D++ A+F+  +G
Sbjct: 314 FKVTGSAESVGVHTTTSVVHSIFVVILLDAVAALFFMEMG 353


>gi|83720699|ref|YP_440931.1| ABC transporter permease [Burkholderia thailandensis E264]
 gi|83654524|gb|ABC38587.1| ABC transporter, permease protein [Burkholderia thailandensis E264]
          Length = 404

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 94/366 (25%), Positives = 168/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R +G W +  ++    +V   I +  +      DLS +  +D +G + +     +   
Sbjct: 49  TVRLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALWRVWGRRLP 108

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                        L         +  +    + +       +     G+ +  F      
Sbjct: 109 AGI---------ALTDNQRTVFERIERLDAGREAPEPVVRIDPVTRFGQGLFTFGEHLYG 159

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG +I +                 +   +Y  G   +P+  L++F+ G V++   A
Sbjct: 160 GIALLGGLIVDLLSVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYLSA 217

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 218 QQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 277

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S   +
Sbjct: 278 GIPHGLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFFVRSLPSVVPI 337

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 338 ANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 397

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 398 FQNVGL 403


>gi|289208500|ref|YP_003460566.1| hypothetical protein TK90_1322 [Thioalkalivibrio sp. K90mix]
 gi|288944131|gb|ADC71830.1| protein of unknown function DUF140 [Thioalkalivibrio sp. K90mix]
          Length = 382

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 98/370 (26%), Positives = 185/370 (50%), Gaps = 16/370 (4%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQS--DSAIVDLSAITEIDTIGAELIMYF---ME 63
            + +G      +  +   +     +  +    +  +D+  +   D  GA L+      +E
Sbjct: 24  LQLSGRLDVHAVERVWSPLRRRARELAEGTQAAVTLDVGGLEYCDGAGAALLHALERDIE 83

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +   +++L GV   +E+  +        +           + +   L     + + +   
Sbjct: 84  RAGRQVELVGVQGLVEEQLTPYRELETVE--------PARHETRGGLLAQSFEAVSRVGQ 135

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
            + SQ   +G +    G    +  + +       R     G   +P+V LI+F+ G ++A
Sbjct: 136 AAYSQFGFIGELTRALGSALLNPRQVR--WGDTFRVAEAAGFQALPIVSLIAFLLGVILA 193

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            Q A  + QFG EIF  +L+++   RE+G L+ A+++AGRSG+A  AEIG+MK+NEE++A
Sbjct: 194 FQSAIAMRQFGGEIFVANLVAVSLFRELGPLMMAILLAGRSGAAFAAEIGTMKVNEEVNA 253

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++TMGLD VR L+ P++ A I+  PLL + AN   ++GA++V+  +  IP+  FF++   
Sbjct: 254 LKTMGLDPVRFLVLPKVLAGILVAPLLALYANMIGLLGAAVVMQGFG-IPWTAFFNQVTV 312

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +L+++F+GL KA      I  V    G      + ++G   T+ VV SI ++++ D L
Sbjct: 313 ALSLSDLFSGLFKAVIFGLLIAGVGCLRGLQTASGAAAVGISTTSAVVTSIILIVVFDGL 372

Query: 364 FAIFYFAIGI 373
           FA+ ++ +G+
Sbjct: 373 FAVLFYHMGV 382


>gi|33594879|ref|NP_882522.1| putative integral membrane protein [Bordetella parapertussis 12822]
 gi|33564955|emb|CAE39902.1| putative integral membrane protein [Bordetella parapertussis]
          Length = 378

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 95/366 (25%), Positives = 172/366 (46%), Gaps = 10/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V   +G+W    ++   +        +        DL  +  +DTIGA L+     +   
Sbjct: 23  VCHVSGDWSMQALAAPGEVERRRAALARVDPDQRWDLRGVERLDTIGAHLLWGAWGQQLP 82

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +    S    ++F  +     + +    P   +           IG  +     +  +
Sbjct: 83  --ERVRWSDGQREVFQTLQRNRGEALPAPAPADRW------GWLRAIGDAVFDAGRNGRA 134

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G ++ + G F       +G    +  Q+Y  G   + +  L+ F+ G V++   A
Sbjct: 135 LIIMFGQLVLDLGAFLRRPS--RGPWREISAQVYRTGAQALGITALVGFLIGVVLSYLSA 192

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  M
Sbjct: 193 QQLQMFGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMLVM 252

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+   + LI PR+ AL I++PLL +  +  A++G  +       +    F +      +L
Sbjct: 253 GISHGQRLILPRVIALAITMPLLVVWTDAMALLGGMLAAQMQLGVSAQWFLTSLPDAISL 312

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            N + G+ K       I +VA   G  +  ++ SLG+  TT VV SI+ VI++D+L+A+ 
Sbjct: 313 TNYWIGMFKGVSFGILIALVACHFGLCIQPNTESLGRGTTTSVVTSITGVILVDALYAVI 372

Query: 368 YFAIGI 373
           + +IGI
Sbjct: 373 FSSIGI 378


>gi|33599154|ref|NP_886714.1| putative integral membrane protein [Bordetella bronchiseptica RB50]
 gi|33575200|emb|CAE30663.1| putative integral membrane protein [Bordetella bronchiseptica RB50]
          Length = 378

 Score =  241 bits (616), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 95/366 (25%), Positives = 172/366 (46%), Gaps = 10/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V   +G+W    ++   +        +        DL  +  +DTIGA L+     +   
Sbjct: 23  VCHVSGDWSMQALAAPGEVERRRAALARVDPDQRWDLRGVERLDTIGAHLLWGAWGQQLP 82

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +    S    ++F  +     + +    P   +           IG  +     +  +
Sbjct: 83  --ERVRWSDGQREVFQTLQRNRGEALPAPAPADRW------GWLRAIGDAVFDAGRNGRA 134

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G ++ + G F       +G    +  Q+Y  G   + +  L+ F+ G V++   A
Sbjct: 135 LIIMFGQLVLDLGAFLRRPS--RGPWREISAQVYRTGAQALGITALVGFLIGVVLSYLSA 192

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  M
Sbjct: 193 QQLQMFGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMLVM 252

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+   + LI PR+ AL I++PLL +  +  A++G  +       +    F +      +L
Sbjct: 253 GISHGQRLILPRVIALAITMPLLVVWTDAMALLGGMLAAQMQLGVSAQWFLTSLPDAISL 312

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            N + G+ K       I +VA   G  +  ++ SLG+  TT VV SI+ VI++D+L+A+ 
Sbjct: 313 TNYWIGMFKGVSFGVLIALVACHFGLCIQPNTESLGRGTTTSVVTSITGVILVDALYAVI 372

Query: 368 YFAIGI 373
           + +IGI
Sbjct: 373 FSSIGI 378


>gi|301057238|ref|ZP_07198367.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300448689|gb|EFK12325.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 352

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 107/360 (29%), Positives = 183/360 (50%), Gaps = 12/360 (3%)

Query: 16  KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME---KYHGKIKLQ 72
            S     +  ++     ++   D   VDL  +T +D  G  +++   +   K HG   L+
Sbjct: 2   DSNNAGSLIQELSQHFAENPPGD-LTVDLENVTYLDDFGTLVLVELRKLAAKEHGAFNLE 60

Query: 73  GVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHIL 132
                I ++   ++F       +   + SF     + +   +G+K    I D       +
Sbjct: 61  NTGKKIREMLMFLNF------DSLFQKVSFEKKRRQGIFVRLGEKTFDIILDLKYAISFI 114

Query: 133 GLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQ 192
           G +  + G   A     +      +  M   GV G+P+V LISF+ G ++A   + QL Q
Sbjct: 115 GAITLSLGYHLAHPRALRK--DDTLDYMQKTGVDGLPIVALISFLMGLIMAFMSSVQLEQ 172

Query: 193 FGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFV 252
           FGA I+   L+S+   RE+G ++TA+++AGRSGSA  AEIG+MKI+EE+DA+ TMG D V
Sbjct: 173 FGANIYVASLVSLAMTRELGPIMTAIIVAGRSGSAFAAEIGTMKISEEVDALYTMGFDPV 232

Query: 253 RILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFT 312
             L+ P++ A +I +P+LT+ ++  AI G  +V     D+    + ++  +T  L ++F 
Sbjct: 233 GFLVIPKLIAALIMVPILTLFSDIFAIAGGLLVGVFMLDLTVGAYVAQTINTLALFDVFW 292

Query: 313 GLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           G++K+   A  I  V    GF V   + S+G+  T+ VV SI ++I+ DS+F++     G
Sbjct: 293 GVLKSGVFALLITWVGCLRGFQVSGGAASVGQATTSAVVSSIFLIILFDSVFSVVLRYTG 352


>gi|296388302|ref|ZP_06877777.1| ABC transporter permease [Pseudomonas aeruginosa PAb1]
          Length = 343

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 110/340 (32%), Positives = 177/340 (52%), Gaps = 2/340 (0%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           +S  + +A  DLS +  +DT GA L+   +         +       +  +L+       
Sbjct: 5   RSEVAGNASFDLSQLGALDTAGAALLAELLGAERLADLAELEPGLPRERQALLKTVGHAL 64

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF 152
               +P++     +   L   IG  +  F     +    +GL +            ++  
Sbjct: 65  HDFCEPEKPKPPTTAIELLARIGCAMETFWLHLKALLGFIGLTLETLLRSLVRPASWRV- 123

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
              L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  
Sbjct: 124 -TPLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFA 182

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT 
Sbjct: 183 VLLTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTF 242

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EG
Sbjct: 243 VGMLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEG 302

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 303 FKVSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 342


>gi|313108528|ref|ZP_07794529.1| putative permease of ABC transporter [Pseudomonas aeruginosa 39016]
 gi|310881031|gb|EFQ39625.1| putative permease of ABC transporter [Pseudomonas aeruginosa 39016]
          Length = 343

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 110/340 (32%), Positives = 178/340 (52%), Gaps = 2/340 (0%)

Query: 33  KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKK 92
           +S  + +A  DLS +  +DT GA L+   +         +   +   +  +L+       
Sbjct: 5   RSEVAGNASFDLSQLGALDTAGAALLAELLGAERLADLAELEPSLPRERQALLKTVGHAL 64

Query: 93  IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGF 152
               +P++     +   L   IG  +  F     +    +GL +            ++  
Sbjct: 65  HDFCEPEKPKPPTTAIELLARIGCAMETFWLHLKALLGFIGLTLETLLRSLVRPASWRV- 123

Query: 153 LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIG 212
              L+  +   G+  VP++ L++F+ GAVIA  GA  L+ FGA I++++L+    LRE  
Sbjct: 124 -TPLVANIEKSGLDAVPIIALLTFLVGAVIAFLGATVLANFGATIYTVNLVVFSFLREFA 182

Query: 213 VLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTI 272
           VLLTA+++AGR+ SA  A+IGSMK NEEIDAIR +GL+ + +L+ PR+ AL++SLP+LT 
Sbjct: 183 VLLTAILMAGRTASAFTAQIGSMKANEEIDAIRALGLNPIELLVLPRVLALLVSLPMLTF 242

Query: 273 LANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEG 332
           +     I+G   V     DIP A+F S       + +   G+ KAP  A  I ++   EG
Sbjct: 243 VGMLCGIVGGMTVCAWTLDIPPAMFLSIMEDGIGVQHFLVGISKAPLFAFLIAVIGCLEG 302

Query: 333 FAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           F V   + S+G+  TT VV SI +VI++D+L A+F+  +G
Sbjct: 303 FKVSGSAQSVGEHTTTSVVHSIFVVILLDALAALFFMEMG 342


>gi|54294946|ref|YP_127361.1| hypothetical protein lpl2025 [Legionella pneumophila str. Lens]
 gi|53754778|emb|CAH16265.1| hypothetical protein lpl2025 [Legionella pneumophila str. Lens]
          Length = 374

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 109/374 (29%), Positives = 183/374 (48%), Gaps = 13/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF- 61
           E     ++  G+W    +  +    +        S    ++   I+  D+ GA  +    
Sbjct: 11  EQKNATYQCCGSWSVLTLEGLPKKFI--TGSLPDSQQITINGEKISAFDSAGALALKKCI 68

Query: 62  --MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             ++K + +I+L   S   +Q+  LI                      + + Y IGK+  
Sbjct: 69  DELKKRNNQIELVNFSDSQQQMLELIESKQEILSYQLPAVSK------EGVLYQIGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             ++       ++G + +   E  A   +F   L S++  +   G+  +P++ L+SF+ G
Sbjct: 123 NKLHQVDGLIILIGDLSTRLFEAFAYWRRF--HLPSIVSVIDSAGLKALPIIGLLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMKINE
Sbjct: 181 VVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMKINE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  F S
Sbjct: 241 EVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFEDFLS 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ ++II
Sbjct: 301 RLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFLIII 360

Query: 360 IDSLFAIFYFAIGI 373
            D+ F+I Y  +G+
Sbjct: 361 ADAAFSIAYSWMGL 374


>gi|154149262|ref|YP_001406165.1| ABC transport system permease [Campylobacter hominis ATCC BAA-381]
 gi|153805271|gb|ABS52278.1| ABC transport system permease [Campylobacter hominis ATCC BAA-381]
          Length = 367

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 114/371 (30%), Positives = 177/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQ-SDSAIVDLSAITEIDTIGAELIMYFM 62
           NGI    F GN+      +IA +    +  SI+ S+  I++   +   D   A  I   +
Sbjct: 8   NGILNIFFNGNFDYKLNPKIAHNFKNIVKNSIKNSEKIILNFKDVENFDYFFAVFIKKSL 67

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            K +   ++   +  I+++F  +      +  ++K       N        IG   +   
Sbjct: 68  IKAN--YEIINENEKIKKIFKTLENADFSENIHKKN-----INFIIKTLNEIGIATIDAK 120

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            +  +    +G              +    L  +       G+  V +V L +F+ G V+
Sbjct: 121 KNLTNLTSFMGEFFIKFFALTPKKMR----LKEMSNCAKDAGIDAVFIVSLTAFLVGIVL 176

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A  G+  L+QFGA I+ ID+M +L LREI  L+ A++IAGRS S+  A+IG MKI EEID
Sbjct: 177 AYIGSDMLAQFGASIYIIDIMGMLTLREIAPLIAAIVIAGRSASSFTAQIGVMKITEEID 236

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++TMG D    L  PRI A+II  P +  LA+  +I    IV   Y +I FA +  RF 
Sbjct: 237 AMKTMGFDPFYFLCMPRILAMIIITPFVIFLADAVSIFSQMIVCDAYLEISFADYLERFK 296

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           ST  + +   G++KAPF    I IV    GF V   + S+G+  T  VV +I  VI +D+
Sbjct: 297 STIEIRHFLVGIVKAPFFGAIIAIVGCLRGFEVKNDTQSIGEYTTISVVNAIFWVIALDA 356

Query: 363 LFAIFYFAIGI 373
            FA+ +  + I
Sbjct: 357 FFAVMFSELKI 367


>gi|71906845|ref|YP_284432.1| hypothetical protein Daro_1206 [Dechloromonas aromatica RCB]
 gi|71846466|gb|AAZ45962.1| Protein of unknown function DUF140 [Dechloromonas aromatica RCB]
          Length = 368

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 94/365 (25%), Positives = 165/365 (45%), Gaps = 13/365 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G W   E+  +   +   +           DLSA+T +D+  A L+          
Sbjct: 14  VVLSGAWTLAEMLPMLSFLQAELTNQSHHTR-HWDLSAVTRLDSAAAVLLWRTWGGQWPA 72

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                V      +   ++   R+  +   P+         +L   IG  + K + +    
Sbjct: 73  SL--DVDEMHRAVLVRVAELPREMPEQVLPR--------VHLPEFIGVLLFKALANVRGM 122

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             + G ++ +                     +Y  G   +PV  L+ F+ G  I+   A 
Sbjct: 123 VALFGQLLLDCAYLFRHPKDVP--WREFTSNVYKAGALALPVTALVGFLIGVTISYLSAL 180

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL  FGA++F ++++ I  +RE+G +L AV++AGRSGSA+ A+IG M++ EEIDA+ TMG
Sbjct: 181 QLKSFGADLFIVNILGISIIRELGPVLVAVLVAGRSGSAMTAQIGVMRVTEEIDALSTMG 240

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +     ++ P+++ L +++PLL +  +  A+ G  +      D+    F         +A
Sbjct: 241 ISRSIRVVLPKVFGLTVAMPLLVLWTSAVALFGGMLAALMQLDLSLIYFLENLPRAVPVA 300

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N+F GL K         +VA   G  V  ++ SL    T+ VV +I+ VI++D++FAIF 
Sbjct: 301 NLFIGLGKGLVFGFVTAVVACHFGLHVKPNTESLSANTTSAVVTAITSVILVDAIFAIFT 360

Query: 369 FAIGI 373
             IG+
Sbjct: 361 RQIGV 365


>gi|307610778|emb|CBX00391.1| hypothetical protein LPW_21111 [Legionella pneumophila 130b]
          Length = 374

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 109/374 (29%), Positives = 183/374 (48%), Gaps = 13/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF- 61
           E     ++  G+W    +  +    +        S    ++   I+  D+ GA  +    
Sbjct: 11  EQKNATYQCCGSWSVLTLEGLPKKFI--TGSLPDSQQITINGEKISAFDSAGALALKKCI 68

Query: 62  --MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             ++K + +I+L   S   +Q+  LI                      + + Y IGK+  
Sbjct: 69  DELKKRNNQIELVNFSDSQQQMLELIESKQDILSYQLPAVSK------EGVLYQIGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             ++       ++G + +   E  A   +F   L S++  +   G+  +P++ L+SF+ G
Sbjct: 123 NKLHQVDGLIILIGDLSTRLFEAFAYWRRF--HLPSIVSVIDSAGLKALPIIGLLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMKINE
Sbjct: 181 VVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMKINE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  F S
Sbjct: 241 EVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFEDFLS 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ ++II
Sbjct: 301 RLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFLIII 360

Query: 360 IDSLFAIFYFAIGI 373
            D+ F+I Y  +G+
Sbjct: 361 ADAAFSIAYSWMGL 374


>gi|302382565|ref|YP_003818388.1| hypothetical protein Bresu_1453 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302193193|gb|ADL00765.1| protein of unknown function DUF140 [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 372

 Score =  241 bits (614), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 106/373 (28%), Positives = 185/373 (49%), Gaps = 12/373 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +  G +V R  G+W +  +   A  +   ++         VDLS +   DT GA  ++  
Sbjct: 11  ATGGGSVLRLTGDWTTMSLGRTAARLSDGLSGRTIQ---SVDLSGLGRFDTAGALALVQA 67

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                             +++ ++    RK +   +        S   +   +G  +   
Sbjct: 68  SG-LTLPKDAWQSRPEAGRIYDMVETLERKSMPAPR-----RQASLTRIFARMGHGVHDA 121

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             +       LG +++ TG         +    + + Q    G+  +P++ + +F  GAV
Sbjct: 122 AAEFLLSMAFLGRLMAATGNAVRHPGAIR--WPAWVSQAERSGLDAMPIIAVTNFFIGAV 179

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           IA  GA  L+QFGA +F++DL+ +  LRE+ VL+TA+++AGRS S+  AE+GSM++N+E+
Sbjct: 180 IAFLGADLLTQFGAGVFAVDLIGVSILRELAVLITAILLAGRSASSFAAEVGSMRMNQEV 239

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MG+D  + L+ PR+ A+++ +PLLT +   + + G  IV W    +  A F  R 
Sbjct: 240 DAMQVMGVDPFQALVIPRLAAMLVMVPLLTFVGMIAGLFGGLIVTWSQLALGPAFFLQRM 299

Query: 302 HSTAT-LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             T     ++  GL KAP  A  I  +  ++G AV     SLG++VT  VVQ+I  +I +
Sbjct: 300 VDTPDMFTHMLVGLSKAPVFAIVIAAIGCRQGLAVSGDVESLGRRVTAAVVQAIFAIIFL 359

Query: 361 DSLFAIFYFAIGI 373
           D++FA+ Y  + I
Sbjct: 360 DAVFALIYLELDI 372


>gi|148359621|ref|YP_001250828.1| ABC transporter permease [Legionella pneumophila str. Corby]
 gi|296107663|ref|YP_003619364.1| putative ABC transport system permease protein [Legionella
           pneumophila 2300/99 Alcoy]
 gi|148281394|gb|ABQ55482.1| ABC transporter, permease [Legionella pneumophila str. Corby]
 gi|295649565|gb|ADG25412.1| putative ABC transport system permease protein [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 374

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 107/374 (28%), Positives = 183/374 (48%), Gaps = 13/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF- 61
           E     ++  G+W    +  +    +        S    ++   I+  D+ GA  +    
Sbjct: 11  EQKNATYQCCGSWSVLTLEGLPKKFI--TGPLPDSQQITINGEKISVFDSAGALALKKCI 68

Query: 62  --MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
             ++K + +++L   S   +Q+  LI                      + + Y IGK+  
Sbjct: 69  DELKKRNNQVELVNFSDSQQQMLELIESKQDILSYQLPIVSK------EGVLYQIGKESE 122

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             ++       ++G + +   E  A   +F   L S++  +   G+  +P++ L+SF+ G
Sbjct: 123 NKLHQVDGLIILIGDLSTRLFEAFAYWRRF--HLPSIVSVIDSAGLKALPIIGLLSFLIG 180

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   QL  +GA IF   L  +   RE G L+TA+++AGR+ S+  A+IGSMKINE
Sbjct: 181 VVLAYQMGLQLETYGANIFIAYLSGMAIFREFGPLITAIIVAGRTSSSFTAQIGSMKINE 240

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DAI TMGL    +L+ P++  L+I  PLL   A+  +I GA I+     +I F  F +
Sbjct: 241 EVDAILTMGLSPTELLVLPKVLGLLIVFPLLIFWADVFSIWGAMIMSKNMLNIGFEDFLT 300

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R   +  L  +  GL KAP  +  I +V   +GF V   ++S+G + T  VVQ++ ++II
Sbjct: 301 RLRDSVGLNQMMLGLYKAPAFSILIALVGCFQGFRVESSADSIGSQTTKSVVQALFLIII 360

Query: 360 IDSLFAIFYFAIGI 373
            D+ F+I Y  +G+
Sbjct: 361 ADAAFSIAYSWMGL 374


>gi|33591357|ref|NP_879001.1| putative integral membrane protein [Bordetella pertussis Tohama I]
 gi|33570999|emb|CAE40477.1| putative integral membrane protein [Bordetella pertussis Tohama I]
          Length = 376

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 95/366 (25%), Positives = 172/366 (46%), Gaps = 10/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V   +G+W    ++   +        +        DL  +  +DTIGA L+     +   
Sbjct: 21  VCHVSGDWSMQALAAPGEVERRRAALARVDPDQRWDLRGVERLDTIGAHLLWGAWGQQLP 80

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +    S    ++F  +     + +    P   +           IG  +     +  +
Sbjct: 81  --ERVRWSDGQREVFQTLQRNRGEALPAPAPADRW------GWLRAIGDAVFDAGRNGRA 132

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G ++ + G F       +G    +  Q+Y  G   + +  L+ F+ G V++   A
Sbjct: 133 LVIMFGQLVLDLGAFLRRPS--RGPWREISAQVYRTGAQALGITALVGFLIGVVLSYLSA 190

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  M
Sbjct: 191 QQLQMFGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMLVM 250

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+   + LI PR+ AL I++PLL +  +  A++G  +       +    F +      +L
Sbjct: 251 GISHGQRLILPRVIALAITMPLLVVWTDAMALLGGMLAAQMQLGVSAQWFLTSLPDAISL 310

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            N + G+ K       I +VA   G  +  ++ SLG+  TT VV SI+ VI++D+L+A+ 
Sbjct: 311 TNYWIGMFKGVSFGILIALVACHFGLCIQPNTESLGRGTTTSVVTSITGVILVDALYAVI 370

Query: 368 YFAIGI 373
           + +IGI
Sbjct: 371 FSSIGI 376


>gi|319761111|ref|YP_004125048.1| hypothetical protein Alide_0383 [Alicycliphilus denitrificans BC]
 gi|317115672|gb|ADU98160.1| protein of unknown function DUF140 [Alicycliphilus denitrificans
           BC]
          Length = 388

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 83/372 (22%), Positives = 170/372 (45%), Gaps = 13/372 (3%)

Query: 3   ENGITVFRF--AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++G    R    G+W +   ++      +A             L  +  +D +GA+++  
Sbjct: 27  QDGTATPRALPQGDWVAAAFADRRAWRRLAAQLKACGPGHAWSLQGLARLDHVGAQVLWN 86

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +         +S    ++   ++                      +    +G  +++
Sbjct: 87  HWGRAWPA--QVDLSAAQREMLERVARFSTPCAPAPP-------WRLADQIDRLGVLVLR 137

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
            +        ++G ++ +      +  +       +   +Y +G   + +  L+ F+ G 
Sbjct: 138 ALGHLADMVELVGQLLLDLLRLVRNPARAP--WRDISGHVYQMGAKALHITALVGFLIGV 195

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A   + QL QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE
Sbjct: 196 VLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAILVAGRSGSAITAQIGVMRVTEE 255

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     L+ PR  AL +++PL+ +    +A+ G  +       I  A F   
Sbjct: 256 LDAMRVMGIAHGFRLVMPRALALGLAMPLIALWTTLAALAGGMLAADLTMGISSAYFLQA 315

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +   ++N++  + K+      I ++    G  V  ++ SLG+  T  VV +I++VI++
Sbjct: 316 LPAAVKVSNLWLAMAKSVVFGVFIALIGCHWGLRVKPNTQSLGEGTTASVVSAITMVIVV 375

Query: 361 DSLFAIFYFAIG 372
           D+LFA+ +  +G
Sbjct: 376 DALFAVAFKNLG 387


>gi|157165030|ref|YP_001466748.1| MTA/SAH nucleosidase [Campylobacter concisus 13826]
 gi|112799982|gb|EAT97326.1| ABC transport system permease [Campylobacter concisus 13826]
          Length = 368

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 103/370 (27%), Positives = 174/370 (47%), Gaps = 14/370 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           NG    +FAG +   +   +               +   D S +  ID     +++    
Sbjct: 13  NGTATIKFAGEFSYKDAKNLQSIFKKIQKLK---GNVKFDFSELKSIDYA---VLILLKN 66

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
             +GK      +    +  S +    +   K   P  S       N    +G+KI +   
Sbjct: 67  TLNGKKFEIITNDEKIKAMSDLLNDEKIDFKYMPPHNS------LNFFSRLGEKICEGFV 120

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +       LG  +  +     +    +         +   GV+ V +V L +F+ G V+A
Sbjct: 121 NLLEFGSFLGEFLIKSVRILFNPANLR--FREFSNYIKDGGVNAVFIVSLTAFLIGVVLA 178

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G+  L+ FGA IF +++M +L LRE+  L+ A+++AGRS S+  A+IG+MK+ EEIDA
Sbjct: 179 YLGSAMLASFGASIFIVEIMGMLTLREVAPLIAAIVVAGRSASSFTAQIGAMKLTEEIDA 238

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++TMG +    L+ PRI A+++ +P++  +A+  +I+G  I+     DI F+ + +RF  
Sbjct: 239 MKTMGFEPFNFLVLPRIIAMVLCVPVIIFIADSISILGQMIICQTILDISFSDYLNRFRE 298

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              L +   G+IKAPF    I I+    GF V  ++ SLG   T  VV +I  VI +D+ 
Sbjct: 299 MVELRHFAVGMIKAPFFGAVIAIIGCMRGFGVSQNAQSLGAMTTVSVVNAIFWVIALDAF 358

Query: 364 FAIFYFAIGI 373
           FAI +  + I
Sbjct: 359 FAIIFMWLKI 368


>gi|294054794|ref|YP_003548452.1| protein of unknown function DUF140 [Coraliomargarita akajimensis
           DSM 45221]
 gi|293614127|gb|ADE54282.1| protein of unknown function DUF140 [Coraliomargarita akajimensis
           DSM 45221]
          Length = 366

 Score =  240 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 93/369 (25%), Positives = 173/369 (46%), Gaps = 9/369 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQS-DSAIVDLSAITEIDTIGAELIMYFMEK 64
               R  G+W        + ++  A++    S  +   D   + E DT     I    + 
Sbjct: 6   GLCVRIYGDWLLGNTRPGSQELESALSVVTTSEQAIRFDAGDLGEWDTGLLIFIRRCYDL 65

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
              +      S   E   ++++ +         P+ +       +    +G++ +     
Sbjct: 66  AQERGLEVDFSGLPEGAQNMMALSLAV------PEPAKADGRKVSWLSRVGERSLAVGGG 119

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
             S     G  + +   F     + +             GV  +P+V+L++ +TG +IA 
Sbjct: 120 VRSYCDFFGQFLLDLLAFVTGRGQVRR--RDFFLLCQETGVQALPIVMLLNCLTGLIIAF 177

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            G  QL +F A+IF  DL+ +   RE+G ++T V++AGR+G+A  A+IGSM++NEE+DA+
Sbjct: 178 IGVIQLQKFAADIFVADLVGLATARELGAVITGVIMAGRTGAAFAAQIGSMQVNEEVDAL 237

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            T G+  ++ L+ PR+ AL++ +PLL ++A+   I+G  I+     D+    +F++ H  
Sbjct: 238 TTFGISPMQFLVVPRVVALVLMMPLLGVVADIVGILGGLIIAVSISDVSVIQYFNQVHQA 297

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L + F G+ K       IGI     G   G  ++S+G   T+ VV SI+ +++ D++F
Sbjct: 298 VGLNDFFIGIFKCAVFGLIIGIAGCYRGLNCGRDASSVGLATTSAVVTSITWLVVADAIF 357

Query: 365 AIFYFAIGI 373
           A+    +GI
Sbjct: 358 AVLCHLLGI 366


>gi|254417869|ref|ZP_05031593.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
 gi|196184046|gb|EDX79022.1| conserved hypothetical protein [Brevundimonas sp. BAL3]
          Length = 372

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 100/373 (26%), Positives = 186/373 (49%), Gaps = 12/373 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G    R  G+W +  +  +   +   ++         VD   +   DT GA  ++  
Sbjct: 11  AGDGTAKLRLVGDWTTTALGRLPQRLGKDLDGR---KIESVDTRDLGRFDTAGALALVQA 67

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                             +++++I    RK     K        +F +    IG+ +  F
Sbjct: 68  SH-CGVPKSAWTERPEAGRIYTMIEALERKSSPPPKQ-----PGAFTSAFAKIGRGVYDF 121

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             ++      LG ++    E   +    +    + + Q    G+  +P+V++ +F  GAV
Sbjct: 122 GAEAMLSLAFLGRLMEAVVEAAKNPGGIR--WPAWVSQAERAGLDAIPIVMVTNFFIGAV 179

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  G   L+ FGA++F++ L+ +   RE  V++ +V++AGRS SA  AEIGSM++N+E+
Sbjct: 180 VAFIGVDLLTDFGAQVFAVQLIGVAMFREFAVVIASVLLAGRSASAFAAEIGSMRMNQEV 239

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MG++  + L+ PR+ AL++ LPLLT +     ++G  IV W   ++  A FF R 
Sbjct: 240 DAMQVMGVNPFQALVVPRLAALVLMLPLLTFMGMIGGLLGGLIVCWSSLNLGPAFFFQRL 299

Query: 302 HSTATL-ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
               ++  ++  GL+KAP  A  I  +  ++G +V     SLG++VT  VVQ+I  +I++
Sbjct: 300 VEDGSMAQHMMVGLVKAPVFALVIAAIGCRQGMSVAGDVESLGRRVTAAVVQAIFAIILL 359

Query: 361 DSLFAIFYFAIGI 373
           D++FA+ +  + I
Sbjct: 360 DAVFALMFLELDI 372


>gi|317153918|ref|YP_004121966.1| hypothetical protein Daes_2214 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944169|gb|ADU63220.1| protein of unknown function DUF140 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 431

 Score =  240 bits (612), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 93/376 (24%), Positives = 174/376 (46%), Gaps = 14/376 (3%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++  G   F   G   +P  + + D+    +  +    +   D S I  +D  G  L++ 
Sbjct: 67  VTGAGQLRFEIRGRLDAPGTAHVWDEASR-VASAGSGGAVEADCSGIEYMDGSGMALLLK 125

Query: 61  FME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
             E   +  G + L  ++    QL  L             P  +   +  + L   +G+ 
Sbjct: 126 LREVVAEAGGTLSLVNLAPRHRQLIDLTG-------DRPLPGWNPADSERRGLAERVGRA 178

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
               +         +G              + +     ++    +VGV  + ++ L+ F+
Sbjct: 179 TRDALTGIREMVEFVGEASVIITRSLLHPSRVR--WKDVLLSCVHVGVDSLFIISLLGFL 236

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G +++ Q A  L +FG EIF  +++ ++  RE+G L+TA+++A RSGSA  AEIG+MKI
Sbjct: 237 MGLIMSFQSAISLQRFGGEIFVPNMLGLVMFREMGPLVTAILLAARSGSAFAAEIGTMKI 296

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEE+DA+ TMGL  +R L+ P++ + +  +PL+T+  N ++++G ++V+      P   F
Sbjct: 297 NEELDALTTMGLSPMRFLVVPKLLSALAMVPLMTLFFNLASLVGGALVM-LSLGFPLVTF 355

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            SR  S    ++ F G+ KA   +  +  V    G      ++++G   T+ VV  I  +
Sbjct: 356 TSRVFSYVHYSDFFGGMAKALVFSILVAGVGCLRGMQTRSGASAVGLSTTSAVVTGIIFI 415

Query: 358 IIIDSLFAIFYFAIGI 373
              D LFA+ ++ + I
Sbjct: 416 AFADGLFAVAFYYLKI 431


>gi|121592684|ref|YP_984580.1| hypothetical protein Ajs_0250 [Acidovorax sp. JS42]
 gi|120604764|gb|ABM40504.1| protein of unknown function DUF140 [Acidovorax sp. JS42]
          Length = 372

 Score =  239 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 85/361 (23%), Positives = 168/361 (46%), Gaps = 11/361 (3%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
            G+W +   ++      +A             L  +  +D +GA+++     +       
Sbjct: 22  QGDWVAAAFADRRAWRRVAAQLKECGPGVAWSLQGVQRLDHVGAQILWNHWGRAW----- 76

Query: 72  QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHI 131
                   +L         +  +   P          +    +G  ++  ++       +
Sbjct: 77  ----PEQLELTENQREMLERVAQYTTPCEPPAPWRLGDQVDRLGVMVLHALDHVRHLVIL 132

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           +G ++ +      +    +G    +   +Y +G + +P+  L+ F+ G V+A   + QL 
Sbjct: 133 VGQLVLDVLRLLRNPR--RGPWRDISGHLYRMGATALPITALVGFLIGVVLAYLMSLQLR 190

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+R MG+  
Sbjct: 191 QFGAEAFIVNILGISLIRELGPMLGAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPH 250

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
              L+ PR  AL +++PL+ +    +A+ G  +       I  A F     +   ++N++
Sbjct: 251 GFRLVMPRALALALAMPLVALWTTLAALAGGMLAADLTMGISSAYFAQALPAAVNVSNLW 310

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
             + K+      I ++    G  V  ++ SLG+  T  VV +I++VII+D+LFA+ +  +
Sbjct: 311 LAMSKSVVFGVFIALIGCHWGLRVKPNTQSLGEGTTASVVSAITMVIIVDALFAVAFKNV 370

Query: 372 G 372
           G
Sbjct: 371 G 371


>gi|254450464|ref|ZP_05063901.1| ABC transporter, inner membrane subunit [Octadecabacter antarcticus
           238]
 gi|198264870|gb|EDY89140.1| ABC transporter, inner membrane subunit [Octadecabacter antarcticus
           238]
          Length = 376

 Score =  239 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 113/371 (30%), Positives = 180/371 (48%), Gaps = 8/371 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S +        G    P +++I               +    LS +T  DT  A  I   
Sbjct: 13  STDAAVTMTLRGAMTLPYVTQIVAKFDTL----PMDRTVRAYLSGVTRFDTSAAWAIASL 68

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +     +   +        SL+                            IG  +V  
Sbjct: 69  RTRLETAGQHLEIRGAGIGHESLLKSVTDAMPVITPA--PVVAGGLIEWVAAIGSSMVDA 126

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +          GL +S          +F+  L +L+     VG   VP+V L++F+ G V
Sbjct: 127 VTFVLELIGYFGLFLSRLLRAIRHPKEFR--LTALVHHCQEVGFKAVPIVALMAFLIGVV 184

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A QG+ QL QFGAE+F +DL+++  LRE+G+LLT++++AGR+ SA  A IGSMK+ EEI
Sbjct: 185 LAFQGSTQLKQFGAEVFIVDLIAVSILRELGILLTSIIVAGRTASAFTAAIGSMKMREEI 244

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R++GLD    L  PRI AL++ LP+L ++AN   + G +I+ W    I   +F +R 
Sbjct: 245 DAMRSLGLDPAATLFVPRILALVLMLPILGLIANVMGLFGGAIMAWIDLGISPEMFMTRL 304

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            +   ++++  G+IKAP  A  IG+V    G  V  ++ SLG+  ++ VV +I  VI+ D
Sbjct: 305 VNGTDVSHLAAGMIKAPVFALIIGVVGCHAGMQVQSNAESLGRMTSSSVVAAIFAVIMAD 364

Query: 362 SLFAIFYFAIG 372
           ++F+IF+  IG
Sbjct: 365 AVFSIFFAQIG 375


>gi|315639122|ref|ZP_07894289.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter upsaliensis JV21]
 gi|315480826|gb|EFU71463.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Campylobacter upsaliensis JV21]
          Length = 368

 Score =  239 bits (611), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 101/338 (29%), Positives = 166/338 (49%), Gaps = 10/338 (2%)

Query: 39  SAIVDLSAITEIDTIGAELIMYF---MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKN 95
             I+D   +  ID  G    +     ++K     +   +S   + LF L    +++ +K 
Sbjct: 38  QCILDFHHLEFIDMAGVRFFLALEYELQKRGIVSQRVHLSEKFDALFELCEKNYQRILKE 97

Query: 96  QKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLS 155
            K            L  ++G   +  +         +G   +   ++      F+   ++
Sbjct: 98  PKKHFDT-----AELFVNLGVLSLNLLGILKQFICFVGEFFTAFFQYFKKPKAFR--FIA 150

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
            +  +    +  +P+VIL + + G V+A Q AFQL+QFGA IF +DL+ I   RE+  L+
Sbjct: 151 FLYHIENSALKALPIVILTALLVGVVLAYQAAFQLAQFGANIFIVDLVGISATRELAPLI 210

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
            A++IAGRS S+  A+IG MKI +EI A+ TMG      +I PR+ AL++++PL+  +++
Sbjct: 211 AAIVIAGRSASSYTAQIGVMKITDEIAAMNTMGFSTFHFIIIPRVIALVVAMPLIVAVSD 270

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
           F +I G  +V     DI F  F  RF     L ++  GLIKAP     IG++A   G  V
Sbjct: 271 FVSIFGGMMVAHLNLDINFIEFLRRFKEAVDLKHVIIGLIKAPIFGFLIGLIACFRGLEV 330

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
              + S+G   T  VV +I  VI  D+LF++    +GI
Sbjct: 331 KHTTQSIGIYTTKSVVNAIFWVIAFDALFSVILTQMGI 368


>gi|221199880|ref|ZP_03572923.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2M]
 gi|221207452|ref|ZP_03580461.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2]
 gi|221172655|gb|EEE05093.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2]
 gi|221180119|gb|EEE12523.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD2M]
          Length = 446

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 166/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     VV           +  DLS I  +D +G + +     +   
Sbjct: 91  TVRLTGQWTALALARNRGAVVRRAESVATGSVSEWDLSGIGRLDHVGGQALWRVWGRKLP 150

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R         L    G  +  F      
Sbjct: 151 PGIALTATQ-----RTIFERIERLDSQREAPERVVRVGPITRL----GLMLFAFAEHLHG 201

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 202 GIAMFGRVILDALSVLRRPQTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 259

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 260 QQLQMFGANRYIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 319

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 320 GIPHGLRLILPRVLALGVAMPLLVMWTNIVALTGGALAAKMVLGIDVNYFVRSLPGVVPI 379

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 380 ANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 439

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 440 FQNVGL 445


>gi|30248137|ref|NP_840207.1| ABC transporter permease [Nitrosomonas europaea ATCC 19718]
 gi|30180022|emb|CAD84017.1| possible ABC transport permease [Nitrosomonas europaea ATCC 19718]
          Length = 386

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 85/375 (22%), Positives = 178/375 (47%), Gaps = 15/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDV---VMAINKSIQSDSAIVDLSAITEIDTIGAELI 58
           +  G T+ +  G++    +      V   +  +     + S   DL+ ++++D  GA ++
Sbjct: 20  TAAGDTLLQLTGSFTLTSLDRSFPTVTKELAKLASQSDASSLHWDLTDVSQLDYAGAVML 79

Query: 59  MYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                +      L  +    E++F  +  +     + +                 +GK++
Sbjct: 80  WRIWGEQRPAHLL--LRPEQERMFLRLEKSVSLPEQPR--------RILFLPISMLGKQL 129

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           ++F++       + G ++ +         +       +   +Y  G   + +  ++ F+ 
Sbjct: 130 LRFLDHLTGMITLSGQIVLDLFFLMTHPGRIPA--REISANLYRTGAQALGITAVVGFLI 187

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V++   + QL  FGA+I+ ++++ +  +RE+G +L A+++AGRSGSA+ A++G M++ 
Sbjct: 188 GIVLSYLTSEQLHMFGADIYIVNILGMSIIRELGPMLAAILVAGRSGSAMTAQLGVMRVT 247

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EE+DA+  MG+     L+ P+I  L I+LPL+ +  +  A++G  +       +      
Sbjct: 248 EELDALTVMGIPHSMRLVLPKIIGLGIALPLIVLWTSAIALLGGLVAAELQIGLSIHYAL 307

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +    T  +AN++ GL K       I ++A   G  +  ++ SLG+  T  VV SI+ VI
Sbjct: 308 TALPDTVPIANLWLGLGKGMVCGMTIALIACHFGLRIKPNTESLGEGTTNSVVTSITAVI 367

Query: 359 IIDSLFAIFYFAIGI 373
           +ID++FA+ +  IGI
Sbjct: 368 LIDAIFAVAFSNIGI 382


>gi|124386096|ref|YP_001027344.1| ABC transporter, permease protein [Burkholderia mallei NCTC 10229]
 gi|124294116|gb|ABN03385.1| ABC transporter, permease protein [Burkholderia mallei NCTC 10229]
          Length = 428

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 168/368 (45%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++    +V   I +  +      DLS +  +D +G + +     + 
Sbjct: 71  GRTVRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR 130

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L        ++  +    + S       +     G+ +  F    
Sbjct: 131 ---------LPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHL 181

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG +I +                 +   +Y  G   +P+  L++F+ G V++  
Sbjct: 182 YGGIALLGGLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYL 239

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 240 SAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 299

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S  
Sbjct: 300 VMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVV 359

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 360 PIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 419

Query: 366 IFYFAIGI 373
           I +  +G+
Sbjct: 420 ILFQNVGL 427


>gi|307635079|gb|ADI85448.2| ABC transporter, membrane protein of unknown function DUF140
           [Geobacter sulfurreducens KN400]
          Length = 380

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 86/375 (22%), Positives = 164/375 (43%), Gaps = 14/375 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY- 60
           S +G    R  G+W +  +      V   +  +  S   + +   +   D+     ++  
Sbjct: 17  SADGTLSLRLEGDWLAGSLPLPPGAVEDELAVAPASR-LLFETGDLGRWDSGLITFLIRV 75

Query: 61  --FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                          +     +L +L +    + + +   +          L   I  ++
Sbjct: 76  QALCAGQGMAFDGGNLPEGARRLLALATAVPEQTLTHGGSRPP--------LLERIADRV 127

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +         +  LG V    G   A   +F+     L+  M   G   +P+V LISF+ 
Sbjct: 128 IGMWKSMVEMSAFLGEVTVACGRLLAGRARFRR--SELLAIMQECGAQALPIVSLISFLV 185

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++A  GA QLS FGA+I+   L+ I  +R +G ++T +++AGR+G+A  A +G+M++N
Sbjct: 186 GLILAFVGAVQLSMFGAQIYVASLVGIGIVRIMGAIMTGIIMAGRTGAAFAARLGTMQVN 245

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+ T+G+  V  L+ PR+ AL++ +PLL + A+   I+G   V     D+    + 
Sbjct: 246 EEIDALATLGISPVEFLVIPRVAALVLMMPLLCLYADLMGILGGLAVGVLMLDLNVTEYI 305

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           +       L + + GL  +      + +     G   G  ++S+G   T+ VV  I  ++
Sbjct: 306 TMTKKAVRLKDFWVGLFHSGVFGVLVALAGCLRGIQCGRSASSVGDAATSAVVTGIVSIV 365

Query: 359 IIDSLFAIFYFAIGI 373
           +  ++  +    +GI
Sbjct: 366 VATAVITVICNILGI 380


>gi|224371971|ref|YP_002606137.1| ABC-type transporter, permease protein [Desulfobacterium
           autotrophicum HRM2]
 gi|223694690|gb|ACN17973.1| ABC-type transporter, permease protein [Desulfobacterium
           autotrophicum HRM2]
          Length = 373

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 108/372 (29%), Positives = 178/372 (47%), Gaps = 15/372 (4%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY----F 61
            T    +G+     +S++ +    A+     +   ++DL  +  +D+ GA L+ +    +
Sbjct: 13  GTTVTLSGSLDIAGVSKVWEKAEKAL---FGTGDLVIDLKRVDHMDSAGAALVWFIKTTW 69

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++  GKI + G+    +Q+  L       +                +     GK     
Sbjct: 70  KQRTGGKISVLGLKPAFKQVMDLTETIPDTRD-----GEKKPKKKPPSFVETRGKNFADQ 124

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +  + S   ++G +              +      +      GV+ +P+V LISF+ G V
Sbjct: 125 MEKATSFIALVGQITRALIHAFFHPLSVR--WKDALLTAERSGVNALPIVALISFIVGLV 182

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q A  +  FGAEI+  +L+ I  +RE+G L+TA+++AGRSGSA  AEIG+MKINEEI
Sbjct: 183 MAFQAAMPMKMFGAEIYVANLIGIAMVRELGPLMTAIILAGRSGSAFAAEIGTMKINEEI 242

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ TMGLD VR L+ PRI A +   PLLTI +NF  I+G SIV       P   ++S+ 
Sbjct: 243 DALSTMGLDPVRFLMVPRILAAVFITPLLTIFSNFVGIMGGSIV-LLSMGYPAITYYSQV 301

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            S  T  +   GL+K       I       G        ++G   T+ VV  I+++ + D
Sbjct: 302 ISFVTWIDFTGGLVKCFVFGILISAAGCIRGIETQSGPGAVGASTTSAVVTGITLIAVFD 361

Query: 362 SLFAIFYFAIGI 373
            +F++ ++ +GI
Sbjct: 362 GIFSVLFYCLGI 373


>gi|53802513|ref|YP_112711.1| ABC transporter permease [Methylococcus capsulatus str. Bath]
 gi|53756274|gb|AAU90565.1| putative ABC transporter, permease protein [Methylococcus
           capsulatus str. Bath]
          Length = 406

 Score =  239 bits (610), Expect = 5e-61,   Method: Composition-based stats.
 Identities = 89/371 (23%), Positives = 172/371 (46%), Gaps = 13/371 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           E+G  V    G+W    +   + D+   + ++ +      DL  +  +D+ GA ++    
Sbjct: 48  EDGTAVVH--GHWNLRGLIAASPDLRERLCRAARRPDLEWDLRGVNVLDSAGAFVLWQAW 105

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +                L        R+      P           +   I   I    
Sbjct: 106 GER---------LPERIALRHEQQSAFRRWQTGGIPAVRDGRRPPVPIRRRIIAAIAGLG 156

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
           +   +   +LG +I +                 +   ++  G   + +  L+ F+ G V+
Sbjct: 157 SHLLAVLALLGQLILDLAHLARHPADIP--WREISATIHETGGRALGITALVGFLIGVVV 214

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   + QL  FGA+++ ++++ +  +RE+G LL A+++AGRSGS++ A IG M++ +E+D
Sbjct: 215 SYLSSLQLKTFGAQVYIVNILGMSIIRELGPLLAAILVAGRSGSSMTARIGVMRVTQELD 274

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+  MG+     LI P++ AL+++LPLL +  +  A+ G ++      +I +  FF +  
Sbjct: 275 ALAAMGISQSLRLILPKVVALVVALPLLVVWTDVVALAGGAVSAHLELEIGYHQFFQKLP 334

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
           S   +AN   GL KA      + ++A   G  +  ++ SLG + T  VV SI++VI++D+
Sbjct: 335 SAVPVANFAIGLGKAAVFGLFVALIACHYGLRIAPNTESLGNETTNSVVVSITLVILVDA 394

Query: 363 LFAIFYFAIGI 373
           +FAI + ++GI
Sbjct: 395 VFAILFRSVGI 405


>gi|301060039|ref|ZP_07200913.1| conserved hypothetical protein [delta proteobacterium NaphS2]
 gi|300445918|gb|EFK09809.1| conserved hypothetical protein [delta proteobacterium NaphS2]
          Length = 376

 Score =  239 bits (610), Expect = 6e-61,   Method: Composition-based stats.
 Identities = 94/376 (25%), Positives = 175/376 (46%), Gaps = 12/376 (3%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAEL--- 57
           ++E+        GNW+       +  ++  +++         D + +   D+        
Sbjct: 10  LTESETLTVHLQGNWQMESGVPSSGALLDQLDQHSSIKRIEFDATELGSWDSSLPIFFFE 69

Query: 58  IMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
           I     +   K++  G+   + QL  L +          K + +    S      H+G +
Sbjct: 70  ISKLAVEKKTKVQKDGLPAGVRQLIDLATAV-------PKKEDARQTVSRAGFFGHVGSE 122

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           ++ F   +      +G              +F+   L +  Q    G   VP+V LISF+
Sbjct: 123 VIDFTKSAGELITFIGAAFEAFVRMITGRARFRATDLGIFLQ--EAGAQAVPIVSLISFL 180

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G ++A  G  QLS FGA+++  DL+ I  +RE+G ++T +++AGR+G+A  A++G+M++
Sbjct: 181 VGLILAFVGILQLSMFGAQVYVADLVGIAMVREMGAIMTGIIMAGRTGAAYAAQLGTMQV 240

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEEIDA+ T+ +  +  L+ PR+ AL + +PLL + A+   I+G ++V    Y I   V+
Sbjct: 241 NEEIDALETLAIPPMEFLVLPRMVALAVMMPLLVLYADLMGILGGALVAVGMYKIDIIVY 300

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            SR  S  TL+++F GL         + +     G   G  ++++G   T+ VV  I  +
Sbjct: 301 LSRTKSAVTLSDLFIGLFMGAVFGVLVALSGCLRGIQCGRSASAVGDATTSAVVTGIVAI 360

Query: 358 IIIDSLFAIFYFAIGI 373
           II  ++  +    +GI
Sbjct: 361 IIATAVITVLCSILGI 376


>gi|315498539|ref|YP_004087343.1| hypothetical protein Astex_1526 [Asticcacaulis excentricus CB 48]
 gi|315416551|gb|ADU13192.1| protein of unknown function DUF140 [Asticcacaulis excentricus CB
           48]
          Length = 377

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 105/367 (28%), Positives = 172/367 (46%), Gaps = 6/367 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
               V    G+W +  + +  + +  A+  +        DL      DT GA  +   + 
Sbjct: 14  GEARVVSLTGDWTAIGLRDAGERLKSALKSASAVRVETDDLKG---FDTAGAYALRTALG 70

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                         +  ++ LI     + ++ QK       +        +G+      N
Sbjct: 71  ALGDDALFSH-DPRLSAVYELIRDIQPQVVEAQKKTAQQKAHPIIAELAQLGRNTEDVFN 129

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D       +G +I        +  + +     L+ QM   G   + VV + +F  GAVIA
Sbjct: 130 DLRDLNVFIGQLIVTAFMSLVTPGRIR--WTPLVAQMQQAGFGALMVVCVTNFFVGAVIA 187

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G  QL QFGA +F+++L+ I  LRE G ++ AV+IAGRS S+  AEIG+MK+N+EI A
Sbjct: 188 FLGILQLQQFGAAVFAVELIGISVLREFGPVIAAVLIAGRSASSFTAEIGAMKMNQEISA 247

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG++    LI PR+ AL++++PL+T   + + ++G  +V+W         F  R   
Sbjct: 248 MRVMGINPFDALIFPRLAALVLTMPLITFAGSMAGLLGGFVVVWAQLGYGPHFFSIRMTE 307

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                N F G+IK P  A AI I+  + G  V     SLG++VT  VVQ+I  +I+ID++
Sbjct: 308 YVPFVNFFVGMIKVPLFAIAITIIGCRLGMNVTEDVISLGRQVTRAVVQAIFTIILIDAI 367

Query: 364 FAIFYFA 370
            A+ +  
Sbjct: 368 VAMMFNG 374


>gi|302342029|ref|YP_003806558.1| hypothetical protein Deba_0592 [Desulfarculus baarsii DSM 2075]
 gi|301638642|gb|ADK83964.1| protein of unknown function DUF140 [Desulfarculus baarsii DSM 2075]
          Length = 380

 Score =  239 bits (609), Expect = 7e-61,   Method: Composition-based stats.
 Identities = 90/364 (24%), Positives = 171/364 (46%), Gaps = 7/364 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            G       G     ++ E    +   + K +   S ++DLS +  +DT GA  +     
Sbjct: 19  GGDLHVSLRGRLGVNQLPEFQTAIARVL-KELAPRSVLLDLSRLDYLDTSGAMAV-KIWA 76

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
               +     +     +   +++     +++               +   +G+   +   
Sbjct: 77  AAPPQDLAVRLEAGQSRFRDMLALIDVDQVRKPAINPDKRD---AGMLEGMGQSARRMGE 133

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                   +G    +     A     +     ++  M  VGV G+P+V LI  + G ++A
Sbjct: 134 QIGQLLAFVGQATKSVLMVVARPATLRM--GDVLAYMQQVGVDGLPIVSLIGLLLGMIMA 191

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              + QL  FGA+++   L+++  +RE+G ++TA+++AGRSGS+  AEIG+MK+NEE+DA
Sbjct: 192 FMSSLQLKSFGADVYVATLVAVAMVRELGPIMTAILVAGRSGSSFAAEIGTMKVNEEVDA 251

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MG D V  L  P++ A ++ +PLLT+ +  +AI+G  IV     D+    + +   S
Sbjct: 252 LTVMGYDPVIFLALPKVIAAVLMVPLLTLFSIAAAIMGGLIVGVAGLDLTPYTYLNESIS 311

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           +    ++ T + KA      I ++  ++GF V   +  +GK  T+ VV ++ ++I+ DS+
Sbjct: 312 SFDAGDLMTSMFKAAVFGLLIAVIGCQKGFTVEGGAAGVGKATTSAVVAALFLIIVTDSV 371

Query: 364 FAIF 367
           FAI 
Sbjct: 372 FAII 375


>gi|257459529|ref|ZP_05624638.1| ABC transport system permease [Campylobacter gracilis RM3268]
 gi|257442954|gb|EEV18088.1| ABC transport system permease [Campylobacter gracilis RM3268]
          Length = 367

 Score =  238 bits (608), Expect = 8e-61,   Method: Composition-based stats.
 Identities = 114/372 (30%), Positives = 174/372 (46%), Gaps = 14/372 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S  G       G W           ++         +   + LS I+ +D   A +I   
Sbjct: 10  SSGGKNTLSLRGQW---NYKSSRSQLLALKKAVKNLNELELSLSEISNLDYFMALMIKNA 66

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           +     ++ L   S    ++ S +           + +R        N    IG      
Sbjct: 67  L--AGKRVSLVEDSCKAAKILSFMDDKTIDFSYVPESRR-------LNFLAQIGLYCHLG 117

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           I    S A  LG   S    F     KF+      +  +   G+  + +V L +F+ G V
Sbjct: 118 ILGLLSLASFLGEFFSKLAAFIIHPMKFR--FKETVNFIKDSGIDALFIVSLTAFLIGIV 175

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  G+  LS+FGA I+ ID+M  L LRE+  L+ A++IAGRS S+  A+IG MKI EEI
Sbjct: 176 LAYIGSDMLSKFGASIYIIDIMGALTLREVAPLIAAIVIAGRSASSFTAQIGVMKITEEI 235

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+RTMG D    L  PRI A+++ +PL+  +A+  +I    IV   Y DI F+ +  RF
Sbjct: 236 DAMRTMGFDPFYFLAMPRIIAMVLIMPLVIFIADSVSIFAQMIVCDAYLDIAFSDYLDRF 295

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            ++  L +   G+IKAPF    I I+    GF V  ++ S+G+  T  VV +I  VI ID
Sbjct: 296 KASVELRHFLVGMIKAPFFGAFIAIIGCMRGFEVKGNTQSIGEYTTISVVNAIFWVIAID 355

Query: 362 SLFAIFYFAIGI 373
           ++FA+ +  IG+
Sbjct: 356 AVFAVLFSEIGL 367


>gi|330822969|ref|YP_004386272.1| hypothetical protein Alide2_0328 [Alicycliphilus denitrificans
           K601]
 gi|329308341|gb|AEB82756.1| protein of unknown function DUF140 [Alicycliphilus denitrificans
           K601]
          Length = 372

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 83/372 (22%), Positives = 170/372 (45%), Gaps = 13/372 (3%)

Query: 3   ENGITVFRF--AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           ++G    R    G+W +   ++      +A             L  +  +D +GA+++  
Sbjct: 11  QDGTATPRALPQGDWVAAAFADRRAWRRLAAQLKACGPGHAWSLQGLARLDHVGAQVLWN 70

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +         +S    ++   ++                      +    +G  +++
Sbjct: 71  HWGRAWPA--QVDLSAAQREMLERVARFSTPCAPAPP-------WRLADQIDRLGVLVLR 121

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
            +        ++G ++ +      +  +       +   +Y +G   + +  L+ F+ G 
Sbjct: 122 ALGHLADMVELVGQLLLDLLRLVRNPARAP--WRDISGHVYQMGAKALHITALVGFLIGV 179

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A   + QL QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE
Sbjct: 180 VLAYLMSLQLRQFGAEAFIVNILGISLIRELGPMLGAILVAGRSGSAITAQIGVMRVTEE 239

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+R MG+     L+ PR  AL +++PL+ +    +A+ G  +       I  A F   
Sbjct: 240 LDAMRVMGIAHGFRLVMPRALALGLAMPLIALWTTLAALAGGMLAADLTMGISSAYFLQA 299

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             +   ++N++  + K+      I ++    G  V  ++ SLG+  T  VV +I++VI++
Sbjct: 300 LPAAVKVSNLWLAMAKSVVFGVFIALIGCHWGLRVKPNTQSLGEGTTASVVSAITMVIVV 359

Query: 361 DSLFAIFYFAIG 372
           D+LFA+ +  +G
Sbjct: 360 DALFAVAFKNLG 371


>gi|329890329|ref|ZP_08268672.1| hypothetical protein BDIM_20300 [Brevundimonas diminuta ATCC 11568]
 gi|328845630|gb|EGF95194.1| hypothetical protein BDIM_20300 [Brevundimonas diminuta ATCC 11568]
          Length = 372

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 103/373 (27%), Positives = 186/373 (49%), Gaps = 12/373 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S++G T  R AG+W +  +  + D +   ++         +DL  +   DT GA  +   
Sbjct: 11  SQDGQTRLRLAGDWSTVAVGRMGDRLKAELDGRS---VTALDLDDLGRFDTAGALAVAQA 67

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           M +         V     +L+ +++            +              +G+ +  F
Sbjct: 68  MSR-PIPESAWSVRPEAGRLYRMVAKLD-----CMTAEPPRRSAPMTRGFAKVGRGVYDF 121

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             ++      LG +++          + +    +   Q    G+  +P+V++ +F  GAV
Sbjct: 122 GAEAMLSLAFLGRLMAAVLTTLKHPGRIR--WAAWFSQAERTGLDAIPIVVVTNFFIGAV 179

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  G   L+QFGA +F++ L+ +   RE  V++TAV++AGRS S+  AEIGSM++ +E+
Sbjct: 180 VAFIGVDLLTQFGAGVFTVQLIGVAVFREFAVVITAVLLAGRSASSFAAEIGSMRMTQEV 239

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ MG+D  + L+ PR+ AL++ LPLLT LA    ++G  +V W   ++  A FF R 
Sbjct: 240 DAMKVMGVDPFQALVIPRLAALLVMLPLLTFLAMVGGLLGGVLVAWSQLNLGPAFFFQRL 299

Query: 302 HST-ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                   ++  GLIKAP  A  +  +  ++G +V     SLG++VT  VVQ+I  +I++
Sbjct: 300 VEDGYMPTHMMVGLIKAPVFALVVAAIGCRQGMSVAGDVESLGRRVTAAVVQAIFAIILL 359

Query: 361 DSLFAIFYFAIGI 373
           D++FA+ +  + I
Sbjct: 360 DAVFALIFIELKI 372


>gi|221211088|ref|ZP_03584067.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD1]
 gi|221168449|gb|EEE00917.1| putative ABC transporter, permease protein [Burkholderia
           multivorans CGD1]
          Length = 446

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 166/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     VV           +  DLS I  +D +G + +     +   
Sbjct: 91  TVRLTGQWTALALARNRGAVVRRAESVATGSVSEWDLSGIGRLDHVGGQALWRVWGRKLP 150

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R         L    G  +  F      
Sbjct: 151 PGIALTATQ-----RTIFERIERLDSQREAPERIVRVGPVTRL----GLMLFAFAEHLHG 201

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 202 GIAMFGRVILDALSVLRRPQTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 259

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 260 QQLQMFGANRYIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 319

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 320 GIPHGLRLILPRVLALGVAMPLLVMWTNIVALTGGALAAKMVLGIDVNYFVRSLPGVVPI 379

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 380 ANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 439

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 440 FQNVGL 445


>gi|167647526|ref|YP_001685189.1| hypothetical protein Caul_3564 [Caulobacter sp. K31]
 gi|167349956|gb|ABZ72691.1| protein of unknown function DUF140 [Caulobacter sp. K31]
          Length = 371

 Score =  238 bits (607), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 113/370 (30%), Positives = 196/370 (52%), Gaps = 11/370 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
            G      +G+W +  + +  + ++ A++    SD+  +DL  ++  DT GA  I+   +
Sbjct: 13  EGRKTVMLSGDWTARGMVDAGERLITALD---GSDAVDLDLRDLSRCDTAGAYAIIRAAD 69

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                  ++  S  + +L  L+    + + +   PQ       F+ L   IG+ +    +
Sbjct: 70  GRVSAGHIKANSRTL-RLLQLVGDAIQVEPEAAPPQ-----KGFQALLERIGRGVYGLGD 123

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           D       LG ++   G   A   + +     ++      G+  +P+V + +F  GAV+A
Sbjct: 124 DLYGTLGFLGHLLVAIGRCIAKPSRIR--WAPVVALAERSGLDAIPIVAVTTFFIGAVVA 181

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA  L+QFGA++F+++L+ I  LRE  +L+TA+++AGRS S+  AEIGSMK+N+EIDA
Sbjct: 182 LLGANLLTQFGAQVFAVELIGISVLREFNILITAILLAGRSASSFAAEIGSMKMNQEIDA 241

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++ MG+D    L+ PR  AL+I++PLLT +A  + + G  +V W   D+    F  R   
Sbjct: 242 MQVMGVDPYEALVLPRFAALLITIPLLTFIATLAGLAGGMLVTWAVLDLSPTFFLQRMQD 301

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           +  + + + GL KAP MA  I  +  ++G  VG    SLG++VT  VV +I  +I ID++
Sbjct: 302 SVGVQHYWIGLSKAPVMAMVIAAIGCRQGMEVGNDVESLGRRVTAAVVHAIFAIIAIDAV 361

Query: 364 FAIFYFAIGI 373
           FA+ Y  + +
Sbjct: 362 FALIYMELDL 371


>gi|121607910|ref|YP_995717.1| hypothetical protein Veis_0920 [Verminephrobacter eiseniae EF01-2]
 gi|121552550|gb|ABM56699.1| protein of unknown function DUF140 [Verminephrobacter eiseniae
           EF01-2]
          Length = 374

 Score =  237 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 94/366 (25%), Positives = 174/366 (47%), Gaps = 13/366 (3%)

Query: 10  RFAGNWKSPEISEI--ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           +  G W + E+        +   + K     +   DL A+  +D +GA+L+    ++   
Sbjct: 20  QLYGRWGAAELGNAAQWQALSGQLRKHPAVPTLGWDLRALQWLDHVGAQLLWNHWQRAWP 79

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +      S       S+++   +       P              H+G  ++  +  +  
Sbjct: 80  QQLACTDSQ-----RSMLARVAQFSTTAPPPAPW----RLAAQVDHLGLLVLHGVEHARH 130

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG ++ +      +    +G    +   +Y +G + +P+  L+ F+ G V+A   +
Sbjct: 131 ILEMLGQLVLDLARLARAPR--RGPWRDVSGHLYRMGATALPITALVGFLIGVVLAYLMS 188

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 189 LQLRQFGAESFIVNILGISLIRELGPMLAAILVAGRSGSAITAQIGVMRVTEELDAMRVM 248

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     L+ PR  AL +++PLL++    +A+ G  +       I  A F     +    
Sbjct: 249 GIAHGFRLVLPRTLALALAMPLLSLWTTLAALAGGMLAADLTMGISPAYFAQALPAAVRP 308

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            N+   + K+      I ++    G  V   + SLG+  T  VV +I++VI++D+LFA+ 
Sbjct: 309 GNLGLAMAKSVVFGAGIALIGCHWGLRVRPDTQSLGEGTTASVVSAITMVIVVDALFAVT 368

Query: 368 YFAIGI 373
           +  IGI
Sbjct: 369 FKTIGI 374


>gi|222109464|ref|YP_002551728.1| hypothetical protein Dtpsy_0244 [Acidovorax ebreus TPSY]
 gi|221728908|gb|ACM31728.1| protein of unknown function DUF140 [Acidovorax ebreus TPSY]
          Length = 372

 Score =  237 bits (606), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 85/361 (23%), Positives = 167/361 (46%), Gaps = 11/361 (3%)

Query: 12  AGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKL 71
            G W +   ++      +A             L  +  +D +GA+++     +       
Sbjct: 22  QGEWVAAAFADRRAWRRVAAQLKDCGPGVAWSLQGVQRLDHVGAQILWNHWGRAW----- 76

Query: 72  QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHI 131
                   +L         +  +   P          +    +G  ++  ++       +
Sbjct: 77  ----PEQLELTENQREMLERVAQYTTPCEPPAPWRLGDQVDRLGVLVLHALDHVRHLVIL 132

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           +G ++ +      +    +G    +   +Y +G + +P+  L+ F+ G V+A   + QL 
Sbjct: 133 VGQLVLDVLRLLRNPR--RGPWRDISGHLYRMGATALPITALVGFLIGVVLAYLMSLQLR 190

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           QFGAE F ++++ I  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+R MG+  
Sbjct: 191 QFGAEAFIVNILGISLIRELGPMLGAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPH 250

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
              L+ PR  AL +++PL+ +    +A+ G  +       I  A F     +   ++N++
Sbjct: 251 GFRLVMPRALALALAMPLVALWTTLAALAGGMLAADLTMGISSAYFAQALPAAVNVSNLW 310

Query: 312 TGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
             + K+      I ++    G  V  ++ SLG+  T  VV +I++VII+D+LFA+ +  +
Sbjct: 311 LAMSKSVVFGVFIALIGCHWGLRVKPNTQSLGEGTTASVVSAITMVIIVDALFAVAFKNV 370

Query: 372 G 372
           G
Sbjct: 371 G 371


>gi|261885878|ref|ZP_06009917.1| MTA/SAH nucleosidase [Campylobacter fetus subsp. venerealis str.
           Azul-94]
          Length = 354

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 109/337 (32%), Positives = 178/337 (52%), Gaps = 13/337 (3%)

Query: 28  VMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISF 87
             ++ +        +DL  +  ID   A        K++   KL   +   +++F+L+S 
Sbjct: 25  KKSLKELRSLKVDTLDLKNLIRIDYSAATFFA----KHYNCPKLINSNDKFDKIFALVSD 80

Query: 88  THRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSY 147
            +   ++  K ++S       NL   IGK I+   N+  S    LG  + N  +   + +
Sbjct: 81  KYILNLQIIKFKKS-------NLIEQIGKNIINLKNELVSFCIFLGEFLFNLTKSLLNPF 133

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
             +     L    Y  G+S V +V L SF+ G V+A QGA  L  FGA I+ +D+M I+ 
Sbjct: 134 TVR--FKELSNHFYSAGISAVFIVCLTSFLIGIVLAYQGATMLENFGASIYVVDIMGIMT 191

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           LRE+G L+ A+++AGRS S+  A+IG MKI +E++A++TMG +  R ++ PR+ ALI+++
Sbjct: 192 LREVGPLIAAIVVAGRSASSYTAQIGVMKITDELEAMKTMGFEPFRFIVMPRVLALILAM 251

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIV 327
           P +  LAN  +I G  +V   Y D+ F+ +  RF S+  L + + GL KAPF    I ++
Sbjct: 252 PFIVFLANAVSIFGQMMVCNWYLDLSFSDYLERFRSSIALRHFWVGLFKAPFFGAVIALI 311

Query: 328 AMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             K GF V    NS+G+  T  VV  I  +  +D++F
Sbjct: 312 GCKRGFEVSGSINSVGELTTRSVVHEIFWISALDAIF 348


>gi|260425314|ref|ZP_05779294.1| ABC transporter, inner membrane subunit [Citreicella sp. SE45]
 gi|260423254|gb|EEX16504.1| ABC transporter, inner membrane subunit [Citreicella sp. SE45]
          Length = 366

 Score =  237 bits (605), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 113/367 (30%), Positives = 196/367 (53%), Gaps = 9/367 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
                G+     ++     +        +      DLS +  +DT GA L+         
Sbjct: 8   TIVLRGDVNLASLASTRAIL------GCEGTIKAFDLSGVGVLDTAGAWLLASCRNAAAL 61

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF-FYNSFKNLHYHIGKKIVKFINDSC 126
           + +   V         L+           K ++    +++  +    +G+ + K ++   
Sbjct: 62  RGETIAVIGASPAQTLLLETVTDAMADAAKVRQPRGLHHAMGDGLVGLGEAVSKKVSSIA 121

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                LGLV++  G       + +  L +L+  M+  G++ VP+V+L+ F+ G V++ QG
Sbjct: 122 ESLGFLGLVMAQFGWTVLHPSRLR--LTALVHHMHLAGLNAVPIVVLMGFLIGIVLSFQG 179

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL QFGAE++ +DL++I  LRE+G+LLTAV++AGRS SA  A IGSMK+ EEIDA+R 
Sbjct: 180 ASQLKQFGAEVYVVDLIAISILRELGILLTAVIVAGRSASAFTATIGSMKMREEIDAMRV 239

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GLD + +L+ PR+ AL+I LPLL  +A+ + ++G +++ W    I   +F ++  +   
Sbjct: 240 LGLDPIELLVLPRVLALVILLPLLGFIADMAGLVGGALMAWIELGISPGMFRTQLLNNTD 299

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           ++++  GL KAP  A  IG+V   +G  V   + SLG + +  VV +I +VI++D++F+I
Sbjct: 300 VSHLLIGLAKAPVFAVIIGVVGCHQGMQVKGDTESLGNRTSRSVVAAIFLVIVVDAMFSI 359

Query: 367 FYFAIGI 373
           F+   GI
Sbjct: 360 FFAVWGI 366


>gi|89902676|ref|YP_525147.1| hypothetical protein Rfer_3917 [Rhodoferax ferrireducens T118]
 gi|89347413|gb|ABD71616.1| protein of unknown function DUF140 [Rhodoferax ferrireducens T118]
          Length = 376

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 92/368 (25%), Positives = 175/368 (47%), Gaps = 15/368 (4%)

Query: 10  RFAGNWKSPEISEIADDVVMA----INKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
           R +G+W +  ++E A+   +     +  +  +     DL  +  +D  GA+++     + 
Sbjct: 20  RLSGDWSAARLAEPANWASLQSGLALGAAGAALEVSWDLRDLQRLDHTGAQVLWNAWGRQ 79

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +  L  +      + S +            P       S   L   +G  +   I+  
Sbjct: 80  WPRQLL--IEPAQRAMLSRVEQ-------YALPPPVARRTSAWQLFLALGALVWLLIDHL 130

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +  L               KG    +   ++ +G + +P+  L+ F+ G V+A  
Sbjct: 131 RDATRL--LGQLLLDTLRLLRAPAKGPWRDVSGHLFSIGATALPITALLGFLIGVVLAYL 188

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            + QL QFGA+ F ++++ +  +RE+G +L A++IAGRSGS I A+IG M++ EE+DA+R
Sbjct: 189 MSLQLRQFGADSFIVNILGLSVIRELGPVLAAILIAGRSGSTITAQIGVMRVTEELDAMR 248

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     L+ PR  A+ +++PLLT+  + +A++G  +       +  A FF+      
Sbjct: 249 VMGIAKGYRLVLPRAIAMALAMPLLTVWTSLAALLGGMLAADLTMGVTPAYFFAALPRAV 308

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            ++N+   + K+      I ++    G  V  ++ SLG+  T  VV SI++VI++D++FA
Sbjct: 309 EVSNLTLAMGKSVVFGLLIALIGCHYGLRVKPNTESLGQGTTASVVTSIAMVILVDAVFA 368

Query: 366 IFYFAIGI 373
           + +  IGI
Sbjct: 369 LVFKDIGI 376


>gi|322378616|ref|ZP_08053052.1| hypothetical protein HSUHS1_0274 [Helicobacter suis HS1]
 gi|322380555|ref|ZP_08054721.1| hypothetical integral membrane protein [Helicobacter suis HS5]
 gi|321147017|gb|EFX41751.1| hypothetical integral membrane protein [Helicobacter suis HS5]
 gi|321148923|gb|EFX43387.1| hypothetical protein HSUHS1_0274 [Helicobacter suis HS1]
          Length = 368

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 108/366 (29%), Positives = 183/366 (50%), Gaps = 8/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
                G+W     ++    +   +  +   ++  +D   +  +D +   L+   + +   
Sbjct: 11  TLVLQGSWDFKTSAKALTHLKTILKDAPPIEA--IDFKGVASLDFVFLMLLYDLLGR--R 66

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           K +    S +  ++  ++    R      K +       F N    +G+ +V F N   +
Sbjct: 67  KPEFLNPSAYNAKVLEVVETWIRANPSILKQEHVSRV--FINPLEKLGRGVVSFYNTLLN 124

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
             +  G++I   G               LI  ++  G   +PV IL  FV G  IA +GA
Sbjct: 125 TFNFCGMIIYYVGLAFIRPKS--VCWTPLIHHIHESGFKVLPVSILTVFVVGFAIALEGA 182

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL + G  + SI++ + L LRE+G  + A+++AGRS S+  A+IG+MKI EE+DA+ TM
Sbjct: 183 VQLQELGFPMMSIEMTAKLALREMGPFILALVVAGRSASSFTAQIGAMKITEELDAMETM 242

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL+    L+ PR+ AL+I++PLL  LA+  A++GA I I     I FA + +R H    L
Sbjct: 243 GLNPFAFLVLPRVVALVIAMPLLVFLADAFALLGAMIAIKYQLGIGFAHYVARLHENVGL 302

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           ++ F GLIKAPF   AI +V    GF V  ++ S+G+  T  VV S+  +I +D+LF++ 
Sbjct: 303 SHFFIGLIKAPFWGFAIALVGCMRGFEVKGNTESIGQLTTISVVNSLFWIIFLDALFSVI 362

Query: 368 YFAIGI 373
           +  + +
Sbjct: 363 FSRLDV 368


>gi|187476645|ref|YP_784668.1| membrane protein [Bordetella avium 197N]
 gi|115421231|emb|CAJ47736.1| putative membrane protein [Bordetella avium 197N]
          Length = 377

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 94/366 (25%), Positives = 168/366 (45%), Gaps = 10/366 (2%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V    G+W    ++            +        DL  I  +DTIGA L+     +   
Sbjct: 22  VVYLGGDWSLQALAVRGQVQARRDALAQTHAHTRWDLRGIQRLDTIGANLLWRLWGE--R 79

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +   ++    ++F+ ++                      +    IG+ I    ++   
Sbjct: 80  LPERVRLTDGQREVFNALAVNPGAVAPAPPVTDR------LSWVRAIGQAIFDAAHNGIM 133

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG ++ +           +G    +  Q+Y  G   + +  L+ F+ G V++   A
Sbjct: 134 LLRMLGQLVLDFIGLLLRPS--RGPWREISAQIYRTGAQALGITALVGFLIGVVLSYLSA 191

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  M
Sbjct: 192 QQLQMFGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMSVM 251

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+   + LI PR+ AL I++PLL +  +  A++G  +       I    F     +  T+
Sbjct: 252 GISQSQRLILPRVVALAITMPLLVLWTDAMALLGGMLAAQMQLGISAQWFLESLPNAVTI 311

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            N + G++K       I +VA   G  +   + SLG+  TT VV SI+ VI++D+L+A+ 
Sbjct: 312 TNYWIGMVKGVSFGVLIALVACHFGLRIKPDTESLGRGTTTSVVTSITGVILVDALYAVI 371

Query: 368 YFAIGI 373
              +GI
Sbjct: 372 LSGMGI 377


>gi|190572714|ref|YP_001970559.1| putative ABC transporter permease [Stenotrophomonas maltophilia
           K279a]
 gi|190010636|emb|CAQ44245.1| putative permease component of ABC transporter protein
           [Stenotrophomonas maltophilia K279a]
          Length = 373

 Score =  237 bits (604), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 110/365 (30%), Positives = 187/365 (51%), Gaps = 13/365 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + R +G W        A+ +     + +      +D + I ++D+ G   ++    +   
Sbjct: 21  LIRLSGTWTLKTALAAAEVL-----RGVPDTLTGIDATGIEKMDSAGVLQVLRVAHRADL 75

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                      + L   I      + + +                 +G  +    ++  +
Sbjct: 76  GEDALQFRPDHQALVCTIEEVADDRPRPK------RDFGVLAALERLGVSVHATGHNIKA 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG  +           +F+  L + + QM  VG+  VP+V L+S++ GAVIA  G+
Sbjct: 130 LCSFLGENLVKAARLVKEPRRFR--LTATVHQMEQVGLDAVPLVALLSYLVGAVIAFLGS 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L  FGAEI+ ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDA+RT+
Sbjct: 188 TILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDAMRTL 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD + +L+ PR+ AL+++LPLLT +A  + + G   V     DIP  ++ +R H T  +
Sbjct: 248 GLDPIDLLVLPRLLALLVTLPLLTFIAMIAGLAGGITVGAFDLDIPPQMYIARMHETMEV 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            ++  GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+  A++
Sbjct: 308 RHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQSVGERTTSSVVQTISLVIIIDAFAALW 367

Query: 368 YFAIG 372
           +  + 
Sbjct: 368 FMHMD 372


>gi|254524872|ref|ZP_05136927.1| ABC transporter permease [Stenotrophomonas sp. SKA14]
 gi|219722463|gb|EED40988.1| ABC transporter permease [Stenotrophomonas sp. SKA14]
          Length = 370

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 187/365 (51%), Gaps = 13/365 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           + R +G W        A+ +     + +      +D + I ++D+ G   ++    +   
Sbjct: 18  LIRLSGTWTLKTALAAAEVL-----RGVPEKLTGIDATGIEQMDSAGVLQVLRVAHRADL 72

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                      + L   I      + K +                 +G  +    ++  +
Sbjct: 73  GEDALHFRQDHQALVCTIEEVADDRPKPK------RDFGVLAALERLGVSVHATGHNIKA 126

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG  +           +F+  L + + QM  VG+  VP+V L+S++ GAVIA  G+
Sbjct: 127 LCSFLGENLVKAARLVKEPRRFR--LTATVHQMEQVGLDAVPLVALLSYLVGAVIAFLGS 184

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L  FGAEI+ ++L++I  LRE  VLLTA+++AGR+ SA  A+IG+MK  EEIDA+RT+
Sbjct: 185 TILRDFGAEIYVVELVNIAFLREFAVLLTAIVLAGRTASAFTAQIGAMKAREEIDAMRTL 244

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GLD V +L+ PR+ AL+++LPLLT +A  + + G   V     DIP  ++ +R H T  +
Sbjct: 245 GLDPVDLLVLPRLLALLVTLPLLTFIAMVAGLAGGITVGAFDLDIPPQMYIARMHETMEV 304

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            ++  GL KAP  A  IG++   EG  V   + S+G++ T+ VVQ+IS+VIIID+  A++
Sbjct: 305 RHMLVGLSKAPVFALVIGLIGCLEGLKVEGTAQSVGERTTSSVVQTISLVIIIDAFAALW 364

Query: 368 YFAIG 372
           +  + 
Sbjct: 365 FMHMD 369


>gi|207727753|ref|YP_002256147.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum MolK2]
 gi|206590994|emb|CAQ56606.1| abc-type transport system involved in resistance to organic
           solvents, permease component protein [Ralstonia
           solanacearum MolK2]
          Length = 374

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 95/371 (25%), Positives = 175/371 (47%), Gaps = 12/371 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +G +V   +G+W +  ++E A         ++   ++    L+ +  ID  GA+L+    
Sbjct: 15  DGRSVAYLSGDWTTLALAERAGVRSARRQIRAGLDNANAWCLTEVGRIDHFGAQLLWRAW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                  +         ++   ++                      N    +G  ++ F 
Sbjct: 75  GNRWP--EHLDARADQRRMIDRVARLD-------PGGWKKRIAPRINPVTVLGGAMLDFA 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G ++ +   F  + +  +G    +   +Y  G   + +  L+ F+ G V+
Sbjct: 126 GHLRIGVAMVGQLMFDLLRFARAPH--RGPWREISANIYSTGYKALGITALVGFLIGIVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FGA IF ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+D
Sbjct: 184 SYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELD 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG+     LI P++ AL I++PLL    +  A+ G  +      DI    F +   
Sbjct: 244 AMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALAGGILAAKFQLDISPTYFITSLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN++ G+ K       I +VA   G  +  ++ SLG+  TT VV SI++VI+ D+
Sbjct: 304 DAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNTQSLGEGTTTSVVVSITVVILADA 363

Query: 363 LFAIFYFAIGI 373
           +FAI +  +GI
Sbjct: 364 VFAILFKDVGI 374


>gi|121998618|ref|YP_001003405.1| hypothetical protein Hhal_1839 [Halorhodospira halophila SL1]
 gi|121590023|gb|ABM62603.1| protein of unknown function DUF140 [Halorhodospira halophila SL1]
          Length = 376

 Score =  236 bits (603), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 108/365 (29%), Positives = 182/365 (49%), Gaps = 8/365 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G+W           ++  + ++       VDLSA+  +DT GA L+   +     +
Sbjct: 18  VRIRGDWTLAHY----RTLLRQVEQTRLGGEPRVDLSALGRLDTAGATLLARLLGAARVE 73

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQ-KPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
              +       +   L+        + +  P+          L   +G ++    +    
Sbjct: 74  ALARSTPELSAERRKLLQAVAAASERARTAPEPRGDPYFLGQLTIGLGAQMTHAGHQLAR 133

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
                GLVI+         ++++  L ++ RQ+ +  +  +P+V L++F  GAVIA  G 
Sbjct: 134 AIGFTGLVIAAFAAGLLRPWRWR--LAAVSRQLQHTALEALPIVALLTFAVGAVIAVLGV 191

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L +FGA IF++DL++   LRE GV+LTA+++AGRS SA  A+IGSMK NEE+DA+R  
Sbjct: 192 TVLGRFGAGIFTVDLVAYAFLREFGVVLTAILLAGRSASAFTAQIGSMKANEELDAMRAQ 251

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G   + +L+ PR+ AL+I++PLL+ +A    + G  +V     D+P        +S  ++
Sbjct: 252 GFSPIEMLVIPRVVALLIAVPLLSFVAVVCGLAGGGLVTLLNVDVPAGR-IIALYSDISV 310

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           ++   GL KAP  A  I I+   EG      + S+G   T+ VVQSI  VII++++ A+ 
Sbjct: 311 SHYLAGLAKAPIFAFVIAIIGCLEGIKCSASAQSVGTHTTSAVVQSIFWVIILNAVAALI 370

Query: 368 YFAIG 372
           Y  +G
Sbjct: 371 YVELG 375


>gi|217970678|ref|YP_002355912.1| hypothetical protein Tmz1t_2277 [Thauera sp. MZ1T]
 gi|217508005|gb|ACK55016.1| protein of unknown function DUF140 [Thauera sp. MZ1T]
          Length = 371

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 97/369 (26%), Positives = 168/369 (45%), Gaps = 12/369 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G    R AG+W    + E    +  A+        A   L A+  +D+ GA L+      
Sbjct: 13  GAEGIRLAGDWTLRGLDECLPTLRRALATVP--PDARWSLRAVRRMDSFGALLLWQAWGG 70

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                           +   I     + +       +       +    +GK +  F   
Sbjct: 71  RWPAALE--ADDAQRAIIGRIENASARALPEPPRASA------LDAVALLGKGLFAFAGH 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 +LG ++ + G        +   LL +   ++ VGV  +PV  L+ F+ G V++ 
Sbjct: 123 LSGFVALLGRLVLDLGHLLHHPRDWP--LLEISANLHKVGVKAMPVSALVGFLIGVVLSY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FGA+ F ++++ +  +RE+G +L +V++AGRSGSA+ A++G M++ EEIDA+
Sbjct: 181 LSALQLRTFGADAFIVNILGMGIIRELGPVLVSVLVAGRSGSAMTAQLGVMRVTEEIDAL 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             MG+     L+ P++ AL +++PLL +  +  A+ G  +  W    I    F       
Sbjct: 241 AAMGVSRSLRLVLPKVVALSLAMPLLVLWTSAIALFGGWVSAWVELGIGLQFFLRALPDA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +AN++ GL K       I +VA   G  V   + SL    T  VV +I++VI++D++F
Sbjct: 301 VPVANLYIGLAKGAVFGFLIALVACHFGLRVKPDTESLSANTTASVVAAITVVILVDAVF 360

Query: 365 AIFYFAIGI 373
           AI   +IG+
Sbjct: 361 AIATRSIGL 369


>gi|167561346|ref|ZP_02354262.1| ABC transporter, permease protein [Burkholderia oklahomensis EO147]
 gi|167568578|ref|ZP_02361452.1| ABC transporter, permease protein [Burkholderia oklahomensis C6786]
          Length = 374

 Score =  236 bits (602), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 92/366 (25%), Positives = 169/366 (46%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++    +V   I +  +      DLS +  +D +G + +     +   
Sbjct: 19  TVRLYGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVVRLDHVGGQALWRVWGRRLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +            L         +  +  + + +       +     G+ +  F      
Sbjct: 79  EGL---------ALTDNQRTVFERIERLDEGREAPEPVVRIDPITRFGQGLFTFGEHLYG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG ++ +                 +   +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIGLLGRLVIDLLSVLRRPRTMP--WTEISANVYAAGAKALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S   +
Sbjct: 248 GIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLAIDLNFFVRSLPSVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLWIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|242278699|ref|YP_002990828.1| hypothetical protein Desal_1226 [Desulfovibrio salexigens DSM 2638]
 gi|242121593|gb|ACS79289.1| protein of unknown function DUF140 [Desulfovibrio salexigens DSM
           2638]
          Length = 371

 Score =  236 bits (602), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 93/368 (25%), Positives = 168/368 (45%), Gaps = 8/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
            +    +G   +    E+ D    A+     +   +V+ S I  +D  GA L M      
Sbjct: 12  GSTMNISGRLDAEGAGEVWDKARAAVA----AGCLVVECSGIEYLDGGGASLFMMMKAGC 67

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +     ++    +  S +              +       +     +G+       D 
Sbjct: 68  RDRGSSLVINGLRPEFASFLELFD-LDKAAPPSGQVKRKGGIRGWITSVGQSGQAVAADM 126

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
             Q    G  +  +        K +            VG  G+P+++LI F+ G +++ Q
Sbjct: 127 REQIEFTGNCVLASLSTATLKNKLR--WPDFWLTCEKVGADGLPIILLIGFLMGLIMSFQ 184

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A  L +FGAEIF  +++ ++  RE+G ++TA+++AGR+GSA  AEIG+MK+NEE+DA+ 
Sbjct: 185 SAVSLMRFGAEIFVPNMLGLVMFRELGPMVTAILLAGRTGSAFAAEIGTMKVNEELDALN 244

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TMGL+ V  L+ PR+ A +   PLLT+  NF +++G ++V+      P A +  R     
Sbjct: 245 TMGLNPVSFLVLPRVLATVCMTPLLTLFFNFMSLVGGALVM-LSMGYPLATYCGRVFENV 303

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
              +   G+IKA   +  +  +  + G      ++++G   T+ VV  I ++ + D +FA
Sbjct: 304 QWMDFSGGMIKAVVFSFLVAGIGCQRGLVTKSGASAVGDSTTSAVVSGIILIAVFDGIFA 363

Query: 366 IFYFAIGI 373
           + +F  GI
Sbjct: 364 VIFFLTGI 371


>gi|303327433|ref|ZP_07357874.1| ABC transporter, permease protein [Desulfovibrio sp. 3_1_syn3]
 gi|302862373|gb|EFL85306.1| ABC transporter, permease protein [Desulfovibrio sp. 3_1_syn3]
          Length = 375

 Score =  236 bits (601), Expect = 6e-60,   Method: Composition-based stats.
 Identities = 79/366 (21%), Positives = 152/366 (41%), Gaps = 7/366 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           +    G W   E      D  +A     +     ++ + +   DT     ++  ++    
Sbjct: 17  LVSVGGRWNMEEPWPEEADAALAGIADQRVRELRLEANGLGRWDTSLLVFLVQMVKAARA 76

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
           +     ++     L   +             + +    S       +G   +        
Sbjct: 77  RKLDVDLA-----LPEGLERLLHMAFAVPAQEGAARKKSDATFLSGLGDAALSLPPTVGD 131

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
                G V  +         K +      +  MY  GV  +P++ + S + G ++A  GA
Sbjct: 132 FLSFCGEVTLSIWRLFLGRSKMRSQ--DFVAAMYECGVQALPIISVTSMLFGLILAFVGA 189

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL+QFGA+I+   L+ I  LR +G ++  V+++GR G+A  A IG+M++NEE+DA+ T+
Sbjct: 190 VQLTQFGAQIYVAGLVGIGMLRVMGAVMVGVVMSGRVGAAYAALIGTMQVNEEVDALATL 249

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+  V  L+ PR+ AL   +PLLT+ A+   ++G  +V     D+    + +        
Sbjct: 250 GISPVDFLVLPRVLALTAMVPLLTLYADLMGVLGGYLVGVMMLDLNPMEYINATTQMVPF 309

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            ++  GL+        I +    +G   G  + ++G+  TT VV SI  +I+  +   + 
Sbjct: 310 KHVLIGLVYGTVFGVVIAVAGCYQGMRCGRSAQAVGQATTTAVVHSIVGIIVATAAITVI 369

Query: 368 YFAIGI 373
              +G+
Sbjct: 370 CNVLGV 375


>gi|167585308|ref|ZP_02377696.1| hypothetical protein BuboB_08232 [Burkholderia ubonensis Bu]
          Length = 374

 Score =  235 bits (600), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 97/368 (26%), Positives = 173/368 (47%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++     V   +    +      DLS I  ID +G + +     + 
Sbjct: 17  GPTVRLYGQWTALALARNRGAVARRVAGLAKGRVREWDLSGIERIDHVGGQALWRVWGRK 76

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                   +S     +F  I    R++   ++ +R        +    +G+ +  F    
Sbjct: 77  LPDG--IALSETQRTIFERIERLDRQREAPERIER-------IDPVTRLGRALFTFAEHL 127

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                + G V+ +                     +Y  G   +P+  L++F+ G V++  
Sbjct: 128 QGGIAMFGRVMLDALSVLRRPKTMP--WKETSANVYSAGAQALPITALVAFLIGIVLSYL 185

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 186 SAQQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 245

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     L+ PR+ AL +++PLL +  N  A+ G ++       I F+ F        
Sbjct: 246 VMGIPHGLRLVLPRVLALGVAMPLLVMWTNIIALTGGALAAKLALGIDFSFFVRSLPGVV 305

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 306 PIANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 365

Query: 366 IFYFAIGI 373
           + +  +G+
Sbjct: 366 MLFQNVGL 373


>gi|163744195|ref|ZP_02151555.1| ABC transporter, inner membrane subunit [Oceanibulbus indolifex
           HEL-45]
 gi|161381013|gb|EDQ05422.1| ABC transporter, inner membrane subunit [Oceanibulbus indolifex
           HEL-45]
          Length = 376

 Score =  235 bits (600), Expect = 8e-60,   Method: Composition-based stats.
 Identities = 130/370 (35%), Positives = 209/370 (56%), Gaps = 13/370 (3%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
            +     G+    +++ +  D +     S    ++++D++ +  IDT GA +++      
Sbjct: 18  GSRLSICGDLDIGKVACLDRDWLH----SEMHGASVIDIAGLARIDTAGAWVLIDLQAHA 73

Query: 66  --HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
              G   L+G +    QL   +  +         P +S       +    +G+ +V   +
Sbjct: 74  TVPGGAALEGATQAQAQLIETVRRSMLSDAVAAPPTKS-----VGDRLEILGRTVVLGAH 128

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
            + +    LG V++  G   A   + +  L SL+     VG++ VP+V L+SF+ G V+A
Sbjct: 129 KTVALISFLGQVVATMGGILAHPSRLR--LTSLVHHCQEVGLNAVPIVALMSFLIGVVLA 186

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            QGA QL QFGAE+F +DL++I  LRE+G+LLTA+++AGRSGSA  A IGSMK+ EE+DA
Sbjct: 187 FQGAAQLRQFGAEVFVVDLIAISVLRELGILLTAIIVAGRSGSAFTAAIGSMKMREEVDA 246

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+GLD V IL+ PR+ AL++ LP L  +A+ S ++G +I+ W    +  AVF  R  S
Sbjct: 247 MRTIGLDPVTILVVPRVLALMLMLPALGFIADISGLLGGAIMSWIDLGVSPAVFQMRLTS 306

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + +   G+IKAPF A  IGI+   EG  VG  + SLG+  +T VV SI +VI+ D++
Sbjct: 307 NTDVWHFGVGMIKAPFFALIIGIIGCFEGLKVGGDAESLGRLTSTSVVLSIFMVIVADAM 366

Query: 364 FAIFYFAIGI 373
           F+IF+  +G+
Sbjct: 367 FSIFFAIVGV 376


>gi|167617722|ref|ZP_02386353.1| ABC transporter, permease protein [Burkholderia thailandensis Bt4]
 gi|257140414|ref|ZP_05588676.1| ABC transporter, permease protein [Burkholderia thailandensis E264]
          Length = 374

 Score =  235 bits (599), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 94/366 (25%), Positives = 168/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R +G W +  ++    +V   I +  +      DLS +  +D +G + +     +   
Sbjct: 19  TVRLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALWRVWGRRLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                        L         +  +    + +       +     G+ +  F      
Sbjct: 79  AGI---------ALTDNQRTVFERIERLDAGREAPEPVVRIDPVTRFGQGLFTFGEHLYG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG +I +                 +   +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIALLGGLIVDLLSVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S   +
Sbjct: 248 GIPHGLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFFVRSLPSVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|118497851|ref|YP_898901.1| ABC transporter membrane protein [Francisella tularensis subsp.
           novicida U112]
 gi|194323824|ref|ZP_03057600.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|254373206|ref|ZP_04988695.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. novicida GA99-3549]
 gi|118423757|gb|ABK90147.1| ABC-type transport system permease protein [Francisella novicida
           U112]
 gi|151570933|gb|EDN36587.1| ABC superfamily ATP binding cassette transporter [Francisella
           novicida GA99-3549]
 gi|194322188|gb|EDX19670.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
          Length = 366

 Score =  234 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 108/365 (29%), Positives = 177/365 (48%), Gaps = 7/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              FAG     +I+     +V       +     +D++ I  +DT GA  I+  ++    
Sbjct: 9   TVYFAGLLTLKQINP---KLVEKKVSRSKVKLNRIDITKIQALDTAGAYFILKVLKDLEL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +      H ++  +LI             + S   N      Y +GK     + +  +
Sbjct: 66  TKEDLVFDNHKDK--NLIELVANNFPTKVDKENSHKSNIVFTSIYTLGKNTNNLLQEVKA 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG ++            ++ F   ++   Y   +  + +V+L+S + G V+     
Sbjct: 124 SIGFLGAILLGYLTLIRKP--YRSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             + Q+G +IF +D++ I   RE   L TA++IAGRSGSA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI ALIISLP+LT++A  + IIG  I+      I    F  R  S   +
Sbjct: 242 GEDPIQRLVLPRITALIISLPVLTVIAMIANIIGGIIIADVIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            + + GL+K PF A  I  +   +G AV   S S+GK  TT VV SI ++I++D++FA+ 
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAVA 361

Query: 368 YFAIG 372
              + 
Sbjct: 362 LNGVA 366


>gi|208779915|ref|ZP_03247259.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|254374661|ref|ZP_04990142.1| hypothetical protein FTDG_00836 [Francisella novicida GA99-3548]
 gi|151572380|gb|EDN38034.1| hypothetical protein FTDG_00836 [Francisella novicida GA99-3548]
 gi|208744370|gb|EDZ90670.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 366

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 108/365 (29%), Positives = 177/365 (48%), Gaps = 7/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              FAG     +I+     +V       +     +D++ I  +DT GA  I+  ++    
Sbjct: 9   TVYFAGLLTLKQINP---KLVEKKVSRSKVKLNRIDITKIQALDTAGAYFILKVLKDLEL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +      H ++  +LI             + S   N      Y +GK     + +  +
Sbjct: 66  TKEDLVFDNHKDK--NLIELVANNFPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEVKA 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG ++            ++ F   ++   Y   +  + +V+L+S + G V+     
Sbjct: 124 SIGFLGAILLGYLTLIRKP--YRSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             + Q+G +IF +D++ I   RE   L TA++IAGRSGSA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI ALIISLP+LT++A  + IIG  I+      I    F  R  S   +
Sbjct: 242 GEDPIQRLVLPRITALIISLPVLTVIAMIANIIGGIIIADVIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            + + GL+K PF A  I  +   +G AV   S S+GK  TT VV SI ++I++D++FA+ 
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAVA 361

Query: 368 YFAIG 372
              + 
Sbjct: 362 LNGVA 366


>gi|332184385|gb|AEE26639.1| ABC-type transport system permease protein [Francisella cf.
           novicida 3523]
          Length = 366

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 109/365 (29%), Positives = 179/365 (49%), Gaps = 7/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              FAG     +I+     +V       +     +D++ I  +DT GA  I+  ++    
Sbjct: 9   TIYFAGLLTLKQINP---KLVEKKISRTKVKLKQIDITKIQSLDTAGAYFILRVLKDLGL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             K   +++  ++  +LI             + S   N      Y +GK     + +  +
Sbjct: 66  TKKDLILNSDKDK--NLIELVANNFPTKIDKEYSHKSNIVFTSIYTLGKNTNNLLQEIKA 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG ++            +K F   ++   Y   +  + +V+L+S + G V+     
Sbjct: 124 SIGFLGAILLGYLTLIRKP--YKSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             + Q+G +IF +D++ I   RE   L TA++IAGRSGSA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI ALIISLP+LT++A  + IIG  I+      I    F  R  S   +
Sbjct: 242 GEDPIQRLVLPRITALIISLPVLTVIAMIANIIGGIIIADIIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            + + GL+K PF A  I  +   +G AV   S S+GK  TT VV SI ++I++D++FA+ 
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAVA 361

Query: 368 YFAIG 372
              + 
Sbjct: 362 LNGVA 366


>gi|134297087|ref|YP_001120822.1| hypothetical protein Bcep1808_2996 [Burkholderia vietnamiensis G4]
 gi|134140244|gb|ABO55987.1| protein of unknown function DUF140 [Burkholderia vietnamiensis G4]
          Length = 374

 Score =  234 bits (597), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 170/366 (46%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     +   +     +     DLS I  +D +G + +     +   
Sbjct: 19  TVRLYGQWTALALARNRGAITRRVAGLASARPREWDLSGIERLDHVGGQALWRVWGR--- 75

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             KL       +   ++     R   + + P+R   ++    L    G  I  F      
Sbjct: 76  --KLPAGVELSDTQRTIFERIERLDSQREAPERVVRFDPVTRL----GLAIFTFGEHLQG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGRVILDALSVLRRPQTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A IG M++ EE+DA+R M
Sbjct: 188 QQLQMFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITARIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     L+ PR+ AL +++PLL +  N  A+ G ++       I F  F         +
Sbjct: 248 GIPHGLRLVLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLAIDFNYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGVGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|56708309|ref|YP_170205.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670780|ref|YP_667337.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134301737|ref|YP_001121705.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|187931809|ref|YP_001891794.1| ABC-type transport system permease protein [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|224457429|ref|ZP_03665902.1| ABC-type transport system permease protein [Francisella tularensis
           subsp. tularensis MA00-2987]
 gi|254370792|ref|ZP_04986797.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. tularensis FSC033]
 gi|254875129|ref|ZP_05247839.1| ABC transporter [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|56604801|emb|CAG45880.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110321113|emb|CAL09263.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|134049514|gb|ABO46585.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|151569035|gb|EDN34689.1| ABC superfamily ATP binding cassette transporter [Francisella
           tularensis subsp. tularensis FSC033]
 gi|187712718|gb|ACD31015.1| ABC-type transport system permease protein [Francisella tularensis
           subsp. mediasiatica FSC147]
 gi|254841128|gb|EET19564.1| ABC transporter [Francisella tularensis subsp. tularensis
           MA00-2987]
 gi|282159540|gb|ADA78931.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 366

 Score =  234 bits (596), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 106/365 (29%), Positives = 175/365 (47%), Gaps = 7/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              FAG     +I+     +V       +     +D++ I  +DT GA  I+  ++    
Sbjct: 9   TVYFAGLLTLKQINP---KLVEKKVSRSKVKLNRIDITKIQALDTAGAYFILKVLKDLEL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +      H ++  +LI             + S   N      Y +GK     + +  +
Sbjct: 66  TKEDLVFDNHKDK--NLIELVANNFPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEIKA 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG ++            ++ F   ++   Y   +  + +V+L+S + G V+     
Sbjct: 124 SIGFLGAILLGYLTLIRKP--YRSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             + Q+G +IF +D++ I   RE   L TA++IAGRS SA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLMMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSSSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI ALIISLP+LT++A  + II   I+      I    F  R  S   +
Sbjct: 242 GEDPIQRLVLPRITALIISLPVLTVIAMIANIISGIIIADVIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            + + GL+K PF A  I  +   +G AV   S S+GK  TT VV SI ++I++D++FA+ 
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTTSVVYSIFLIIVVDAIFAVA 361

Query: 368 YFAIG 372
              + 
Sbjct: 362 LNGVA 366


>gi|167579644|ref|ZP_02372518.1| ABC transporter, permease protein [Burkholderia thailandensis
           TXDOH]
          Length = 374

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 94/366 (25%), Positives = 168/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R +G W +  ++    +V   I +  +      DLS +  +D +G + +     +   
Sbjct: 19  TARLSGQWTALALARDRGNVARRIARLAKEPVGEWDLSGVDRLDHVGGQALWRVWGRRLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                        L         +  +    + +       +     G+ +  F      
Sbjct: 79  AGI---------ALTDNQRTVFERIERLDAGREAPEPVVRIDPVTRFGQGLFTFGEHLYG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG +I +                 +   +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIALLGGLIVDLLSVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S   +
Sbjct: 248 GIPHGLRITLPRVLALGVAMPLLVMWTNIIALTGGALAAKFVLGIDLNFFVRSLPSVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|237749352|ref|ZP_04579832.1| ABC transport system permease [Oxalobacter formigenes OXCC13]
 gi|229380714|gb|EEO30805.1| ABC transport system permease [Oxalobacter formigenes OXCC13]
          Length = 374

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 88/370 (23%), Positives = 174/370 (47%), Gaps = 13/370 (3%)

Query: 5   GITVFRFAGNWKSPEISEI--ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
             +     G W+   ++     + +   I+        + DL+ I E+D I A+ +    
Sbjct: 15  DASKVVARGCWRVEVLASAGTINRLKSTIHSYSGKTGIVWDLTRIRELDYISAQFLWESW 74

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
            +         ++    + F+ +    + K+ +      + +  F+N+       + K  
Sbjct: 75  GEKRPANLA--LTEEQGRFFARLEQAGQLKLPDTTKPFLWPWQRFRNI-------VHKVS 125

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                   ++G ++ +   F  +    +G    +   +Y+ G   + +  ++ F+ G V+
Sbjct: 126 EHFSGMVALVGQLMIDIVNFAKAPR--RGPWTEISANIYHAGAQALGITAVVGFLIGVVL 183

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           +   A QL  FG ++F ++L+ I  LRE+G LL A+++AGRSGS++ A++G M++ EE+ 
Sbjct: 184 SYLSAQQLHMFGGDVFLVNLLGISVLRELGPLLAAILVAGRSGSSMTAQLGVMRVTEELS 243

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A++ MGL     LI P++ AL I +PLL I  +  A++G  +       +  + F +   
Sbjct: 244 AMQVMGLPQGFRLIMPKVIALSIVMPLLVIWTDVIALLGGMLAGSYEIGLSMSYFLASLP 303

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               +AN + G+ K       I ++A   G  +  ++ SLG+  T  VV SI++VI+ D+
Sbjct: 304 DAVPIANFWIGVGKGYVFGILIALIACYYGLKIKPNTESLGEGTTRSVVTSITVVILADA 363

Query: 363 LFAIFYFAIG 372
           +FAI    +G
Sbjct: 364 IFAIVLQGVG 373


>gi|77920339|ref|YP_358154.1| ABC transporter permease [Pelobacter carbinolicus DSM 2380]
 gi|77546422|gb|ABA89984.1| ABC-type transport system, permease component [Pelobacter
           carbinolicus DSM 2380]
          Length = 386

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 101/375 (26%), Positives = 174/375 (46%), Gaps = 14/375 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           ++  I    FAG   +   + +   ++  +         +++   I   D  G  L M  
Sbjct: 23  NDAEILSLSFAGKLDAAATALLWKPLLE-LAHQTAPRLLLIEADQINYCDGAGIGLFMEL 81

Query: 62  MEKYHGKI---KLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
             +   +    +L+G+     +L+SL        ++  +P           L   IG++ 
Sbjct: 82  ARQQQKRQQRFELKGLKEEFARLWSLYRPEDFMDLRGSRPHPC-------CLPEEIGRQA 134

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
                     A   G + S            +     +   M   GV+ +P+V LISF+ 
Sbjct: 135 CLAGQGIVDMARFTGELTSALLHAARHPRSVR--WPEVWLVMEKAGVNSLPIVGLISFLI 192

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++A Q    + QFG EI+  +L ++  LRE+G L+TA+++AGRS SA  AE+G+MKIN
Sbjct: 193 GLIMAFQATIPMRQFGVEIYVANLTALSMLRELGPLMTALLLAGRSSSAFAAELGTMKIN 252

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+ TMGL  +  L+  R+ A +I LPLL++ AN   +IG ++V       P   + 
Sbjct: 253 EEIDALTTMGLAPIPFLVVTRVLATVIILPLLSLFANLMGLIGGAVV-LLSLGYPLVTYT 311

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  +   L ++  GL+K    A  +  V    G      ++++G   T  VV  I +++
Sbjct: 312 NQVKAAVNLGDLTGGLVKTLVFALIVAGVGCLYGLKTRSGASAVGDSATRAVVSGIILIV 371

Query: 359 IIDSLFAIFYFAIGI 373
           + D LFA+ Y+ +GI
Sbjct: 372 VADGLFAVVYYFLGI 386


>gi|241668212|ref|ZP_04755790.1| ABC-type transport system permease protein [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254876747|ref|ZP_05249457.1| ABC transporter, permease protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842768|gb|EET21182.1| ABC transporter, permease protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 365

 Score =  233 bits (595), Expect = 3e-59,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 178/359 (49%), Gaps = 7/359 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              F G     +I      ++       + D   +DL+ +T +DT GA +I+   +    
Sbjct: 9   TIYFEGILTLKQID---SKLIDKKISRSKDDIKQIDLTKVTLLDTAGAYIIIKTAKNLRL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +    +   ++  +L+    +      + + S   N   N  Y +GK     +++  +
Sbjct: 66  SKENIIFANEKDK--NLVDIVFKNFPSTAEEELSNKSNVVFNSIYTLGKNTNNLLSEVKT 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG +             +K F   ++   Y   +  + +VIL+S + G V+     
Sbjct: 124 SISFLGAIFLGYITLIRRP--YKAFFSIVLNICYDSTIRALSIVILLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L Q+G +IF +D++ I   RE   L TA++IAGRSGSA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLLMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI AL+ISLP+LT++A  + I G  I+      I    F  R  S   +
Sbjct: 242 GEDPMQRLVLPRITALVISLPVLTVIAMIANIAGGIIIADLIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            + + GL+K PF A  I  +   +G +V   S S+GK  TT VV SI ++I++D++FA+
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLSVKRDSQSVGKATTTSVVYSIFLIILVDAIFAV 360


>gi|239907930|ref|YP_002954671.1| putative ABC transporter permease protein [Desulfovibrio magneticus
           RS-1]
 gi|239797796|dbj|BAH76785.1| putative ABC transporter permease protein [Desulfovibrio magneticus
           RS-1]
          Length = 384

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 89/376 (23%), Positives = 173/376 (46%), Gaps = 12/376 (3%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAE---L 57
           ++  G+    F+G+W+  +     + V  A+  S      ++    +T  D++       
Sbjct: 18  VASGGVVTLTFSGSWRMDQTLPDIEAVRQALAASPAPQKLVLAGEGVTGWDSLFLTQCRA 77

Query: 58  IMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
           I+    +    +    +   +E L +L +    ++   +  +R+ F     ++ Y   + 
Sbjct: 78  IIALARERGVAVDAGALPPGVESLLALAAKVPERQGAARAAKRTPFLERMADMGYGAAQG 137

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +   ++         G V            +       L   +Y   +  + +V LISF+
Sbjct: 138 VRNLLD-------FTGDVTLAAWALVTG--RAVFQRSQLTTLIYQASIDALGIVSLISFL 188

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G ++A  GA QLSQFGA+I+   ++ I  +R +G ++T +++AGR+G+A  AE+G+M++
Sbjct: 189 VGLILAFVGAIQLSQFGAQIYVSTIVGIAMVRVMGAIMTGIIMAGRTGAAYAAELGTMQV 248

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEEIDA+RT G    + L+ PR+ AL++ +PLL I A+   I+G  +V      I    +
Sbjct: 249 NEEIDALRTFGFSPTQFLVLPRMIALVLMMPLLCIYADLMGIMGGFVVGVFMLKINPIQY 308

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +    +  LAN + GL+ +      + +     G   G  +  +G+  T  VV SI  +
Sbjct: 309 LTHTWQSVPLANFWIGLVHSTVFGVLVAMAGCYRGMRCGRSALGVGQATTAAVVTSILAI 368

Query: 358 IIIDSLFAIFYFAIGI 373
           +I  ++  +    IG+
Sbjct: 369 VIATAILTVCCNIIGV 384


>gi|323700846|ref|ZP_08112758.1| protein of unknown function DUF140 [Desulfovibrio sp. ND132]
 gi|323460778|gb|EGB16643.1| protein of unknown function DUF140 [Desulfovibrio desulfuricans
           ND132]
          Length = 381

 Score =  233 bits (594), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 93/374 (24%), Positives = 174/374 (46%), Gaps = 14/374 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
            +G  V   +G   +   + +  + V   + S        D   +T +D  G  L++   
Sbjct: 19  RDGGLVLALSGRLDAAGTTAVWAEAVKGASGS-GFSRLTADCGGVTYMDGSGVALLLKLK 77

Query: 63  E---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
           E   +    I+L  +     +L  L             P++       + L   +G    
Sbjct: 78  ELCAEKKAAIELTNLREEDSRLVDL-------TWDTALPKQRDSERERRGLAEAVGAAGG 130

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +  ++       +G   S  G         +     ++     VGV  + +++LI F+ G
Sbjct: 131 ELWHNVREMIAFVGESFSLLGRAAVHPGMVR--WKDVVLACINVGVESMFIIVLIGFLMG 188

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            +++ Q A  L +FG EIF  +++ ++  RE+G L+T++++A RSGSA  AEIG+MKINE
Sbjct: 189 LIMSFQSAISLQRFGGEIFVPNMLGLVMFREMGPLVTSILLAARSGSAFAAEIGTMKINE 248

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           E+DA+ TMGL  +R L+ P++ A +  +PL+T+  N ++++G ++V+      P   F S
Sbjct: 249 ELDALTTMGLSPMRFLVVPKLLATMAMVPLMTMFFNLASLVGGALVM-LSMGYPLVTFTS 307

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           R  +  +  + + G+ K    +  +  V    G      ++++G   T+ VV  I ++  
Sbjct: 308 RVFANVSATDFWGGMAKGLVFSFLVAGVGCLRGMQTRSGASAVGLSTTSAVVSGIILIAF 367

Query: 360 IDSLFAIFYFAIGI 373
            D LFA+ Y+ +GI
Sbjct: 368 ADGLFAVAYYYLGI 381


>gi|296134762|ref|YP_003642004.1| protein of unknown function DUF140 [Thiomonas intermedia K12]
 gi|295794884|gb|ADG29674.1| protein of unknown function DUF140 [Thiomonas intermedia K12]
          Length = 380

 Score =  232 bits (593), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 100/366 (27%), Positives = 185/366 (50%), Gaps = 14/366 (3%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
             V R  G W +  ++   +  +        +    +D SA T +DT GA L++  M ++
Sbjct: 27  RRVCRLQGAWNAQGLAREPNTHL-----PAGTRHVTLDASA-TTLDTPGALLLVRSMAQW 80

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                   VS        L+    ++ +                L   IG+  +  +++ 
Sbjct: 81  QSAGATVDVSGLSPPQQQLLDLVRQRALALPP------AARRLGLLGDIGRATLIALDEL 134

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +    +G ++          ++ +     +I ++   G+  + ++ L+SF+ G V+A Q
Sbjct: 135 RALLAFVGELVWRGAPLLLQPWRVR--WREVIHEIDAAGLRAIGIIGLLSFLIGMVMAYQ 192

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
               L+ +GA I  ++L+SI+ LRE+G LLTA+++AGR+GS+  A+IG+M+I EE+DA+R
Sbjct: 193 AGATLATYGANILIVNLVSIITLRELGPLLTAILVAGRTGSSYTAQIGTMRITEEVDALR 252

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            +GL    +L+ P++ AL+I+LPLL + A+   + G  +V    Y +P + + +R     
Sbjct: 253 ALGLSPFEMLVLPKVIALVITLPLLALFADVMGLAGGGVVAAVGYGVPLSEYVARIPQVV 312

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            L  +  GL+KAP  A  I +V   +G  V   + ++G+  T  VVQ+I +VI+ID+ F+
Sbjct: 313 GLKTLVLGLVKAPVFAVVIALVGCMQGLRVAGSAAAVGRATTVSVVQAIFLVIVIDASFS 372

Query: 366 IFYFAI 371
           + Y  +
Sbjct: 373 VLYNLL 378


>gi|89256086|ref|YP_513448.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314562|ref|YP_763285.1| ABC transporter ATP-binding protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156502103|ref|YP_001428168.1| ABC transporter membrane protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167010771|ref|ZP_02275702.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367414|ref|ZP_04983440.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|290954528|ref|ZP_06559149.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295312044|ref|ZP_06802859.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica URFT1]
 gi|89143917|emb|CAJ79136.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129461|gb|ABI82648.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134253230|gb|EBA52324.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|156252706|gb|ABU61212.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
          Length = 366

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 105/365 (28%), Positives = 173/365 (47%), Gaps = 7/365 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              FAG     +I+     +V       +     +D++ I  +DT GA  I+  ++    
Sbjct: 9   TVYFAGLLTLKQINP---KLVEKKVSRSKVKLNRIDITKIQALDTAGAYFILKVLKDLEL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +      H ++  +LI             + S   N      Y +GK     + +  +
Sbjct: 66  TKEDLIFDNHKDK--NLIELVANNFPTRVDKENSHKSNIVFTSIYTLGKNTNNLLQEIKA 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG ++            ++ F   ++   Y   +  + +V+L+S + G V+     
Sbjct: 124 SIGFLGAILLGYLTLIRKP--YRSFFSIVLNIAYDSTIKALSIVMLLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             + Q+  +IF +D++ I   RE   L TA++IAGRS SA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLMMQYSTQIFVVDMLGISSFREFAPLFTAIIIAGRSSSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI ALIISLP+LT++A  + II   I+      I    F  R  S   +
Sbjct: 242 GEDPIQRLVLPRITALIISLPVLTVIAMIANIISGIIIADVIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            + + GL+K PF A  I  +   +G AV   S S+GK  T  VV SI ++I+ID++FA+ 
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLAVRRDSQSVGKATTNSVVYSIFLIIVIDAIFAVA 361

Query: 368 YFAIG 372
              + 
Sbjct: 362 LNGVA 366


>gi|88706598|ref|ZP_01104301.1| conserved hypothetical protein, membrane (DUF140) [Congregibacter
           litoralis KT71]
 gi|88699094|gb|EAQ96210.1| conserved hypothetical protein, membrane (DUF140) [Congregibacter
           litoralis KT71]
          Length = 370

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 95/376 (25%), Positives = 166/376 (44%), Gaps = 17/376 (4%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEID---TIGAEL 57
           +S +G    + +G+W S E+  +       +      DS  VD+S +++ D     G   
Sbjct: 9   LSADGD-QLQISGDWTSAELPALVPLFTTLLE---TRDSPAVDVSEVSDWDPRLEAGLLR 64

Query: 58  IMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
           +    +     I+  G      QL +L +     +         F     +     IG  
Sbjct: 65  LQRLAQAKARDIRYLGAPDSQTQLMNLATAVAPYEAPAASATGFFSTKQLRRSLADIG-- 122

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
                +D       LG V              +      +  +   G   + ++ L S +
Sbjct: 123 -----DDLLDSLEFLGGVGIALWRTLTGRSGMRR--REFVESLAQAGPQAIGIITLTSIL 175

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G ++A  GA QL QFGA +F  DL++I  LRE+G L+TAV++AGR+G+A  A++ +M+ 
Sbjct: 176 VGMILAYLGAAQLQQFGAAVFVADLVAIGMLREMGALMTAVVMAGRTGAAYAAQLSTMQT 235

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEEIDAI T+G+D +  L++PR+ AL + +PLL + A+   +     V+     +    +
Sbjct: 236 NEEIDAISTLGIDPMEFLVAPRVLALFLMMPLLVVYADALGV-LGGAVVAGGMGVTPLQY 294

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            S+  +  T  + F G+ K    A  I     + G   G +S ++G+  T  VV ++  +
Sbjct: 295 ISQLSAAITPTHFFVGIFKGFVFAALIATAGCRAGMNAGRNSEAVGQATTEAVVTAVVYL 354

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D+   I    + I
Sbjct: 355 IVADAGINILCQLLDI 370


>gi|167717852|ref|ZP_02401088.1| ABC transporter, permease protein [Burkholderia pseudomallei DM98]
          Length = 374

 Score =  232 bits (592), Expect = 6e-59,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 167/368 (45%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++    +V   I +  +      DLS +  +D +G + +     + 
Sbjct: 17  GRTVRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR 76

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L         +  +    + S       +     G+ +  F    
Sbjct: 77  ---------LPDGIALTDNQRVVFERIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHL 127

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG +I +                 +   +Y  G   +P+  L++F+ G V++  
Sbjct: 128 YGGIALLGSLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYL 185

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 186 SAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 245

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S  
Sbjct: 246 VMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVV 305

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 306 PIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 365

Query: 366 IFYFAIGI 373
           I +  +G+
Sbjct: 366 ILFQNVGL 373


>gi|294338723|emb|CAZ87055.1| putative ABC-type transport system, permease component [Thiomonas
           sp. 3As]
          Length = 380

 Score =  232 bits (592), Expect = 7e-59,   Method: Composition-based stats.
 Identities = 99/366 (27%), Positives = 184/366 (50%), Gaps = 14/366 (3%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
             V R  G W +  ++   +  +        +    +D SA T +DT GA L++  M ++
Sbjct: 27  RRVCRLQGAWNAQGLAREPNTHL-----PAGTRHVTLDASA-TTLDTPGALLLVRSMAQW 80

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                    S        L+    ++ +                L   IG+  +  +++ 
Sbjct: 81  QSAGATVDASGLSPPQQQLLDLVRQRALALPP------AARRLGLLGDIGRATLIALDEL 134

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +    +G ++          ++ +     +I ++   G+  + ++ L+SF+ G V+A Q
Sbjct: 135 RALLAFVGELVWRGAPLLLQPWRVR--WREVIHEIDAAGLRAIGIIGLLSFLIGMVMAYQ 192

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
               L+ +GA I  ++L+SI+ LRE+G LLTA+++AGR+GS+  A+IG+M+I EE+DA+R
Sbjct: 193 AGATLATYGANILIVNLVSIITLRELGPLLTAILVAGRTGSSYTAQIGTMRITEEVDALR 252

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            +GL    +L+ P++ AL+I+LPLL + A+   + G  +V    Y +P + + +R     
Sbjct: 253 ALGLSPFEMLVLPKVIALVITLPLLALFADVMGLAGGGVVAAVGYGVPLSEYVARIPQVV 312

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            L  +  GL+KAP  A  I +V   +G  V   + ++G+  T  VVQ+I +VI+ID+ F+
Sbjct: 313 GLKTLVLGLVKAPVFAVVIALVGCMQGLRVAGSAAAVGRATTVSVVQAIFLVIVIDASFS 372

Query: 366 IFYFAI 371
           + Y  +
Sbjct: 373 VLYNLL 378


>gi|167627644|ref|YP_001678144.1| ABC-type transport system permease [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|167597645|gb|ABZ87643.1| ABC-type transport system permease protein [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
          Length = 365

 Score =  232 bits (591), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 107/359 (29%), Positives = 177/359 (49%), Gaps = 7/359 (1%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
              F G     +I      ++       + D    DL+ +T +DT GA +I+   +    
Sbjct: 9   TIYFEGILTLKQID---SKLIDKKISRSKDDIKQFDLTKVTLLDTAGAYIIIKTAKNLSL 65

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
             +    +   ++  +L+    +      + + S   N   N  Y +GK     +++  +
Sbjct: 66  SKENIIFANEKDK--NLVDIVFKNFPSTAEEELSSKSNVVFNSIYTLGKNTNNLLSEIKT 123

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LG +             +K F   ++   Y   +  + +VIL+S + G V+     
Sbjct: 124 SISFLGAIFLGYITLIRRP--YKAFFSIVLNICYDSTIRALSIVILLSLIIGLVLTYLPL 181

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
             L Q+G +IF +D++ I   RE   L TA++IAGRSGSA  +EIG MK+NEEIDA++T+
Sbjct: 182 NLLMQYGTQIFVVDMLGISSFREFAPLFTAIIIAGRSGSAFTSEIGIMKVNEEIDALQTI 241

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G D ++ L+ PRI AL+ISLP+LT++A  + I G  I+      I    F  R  S   +
Sbjct: 242 GEDPMQRLVLPRITALVISLPVLTVIAMIANIAGGIIIADLIAGITPLQFIERLFSNVNV 301

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            + + GL+K PF A  I  +   +G +V   S S+GK  TT VV SI ++I++D++FA+
Sbjct: 302 NHFYIGLLKTPFFALVIAGIGCHQGLSVKRDSQSVGKATTTSVVYSIFLIILVDAIFAV 360


>gi|254176752|ref|ZP_04883409.1| putative ABC transporter, permease protein [Burkholderia mallei
           ATCC 10399]
 gi|254202028|ref|ZP_04908392.1| putative ABC transporter, permease protein [Burkholderia mallei
           FMH]
 gi|254207359|ref|ZP_04913710.1| putative ABC transporter, permease protein [Burkholderia mallei
           JHU]
 gi|147747922|gb|EDK54998.1| putative ABC transporter, permease protein [Burkholderia mallei
           FMH]
 gi|147752901|gb|EDK59967.1| putative ABC transporter, permease protein [Burkholderia mallei
           JHU]
 gi|160697793|gb|EDP87763.1| putative ABC transporter, permease protein [Burkholderia mallei
           ATCC 10399]
          Length = 374

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 168/368 (45%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++    +V   I +  +      DLS +  +D +G + +     + 
Sbjct: 17  GRTVRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR 76

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L        ++  +    + S       +     G+ +  F    
Sbjct: 77  ---------LPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHL 127

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG +I +                 +   +Y  G   +P+  L++F+ G V++  
Sbjct: 128 YGGIALLGGLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYL 185

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 186 SAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 245

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S  
Sbjct: 246 VMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVV 305

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 306 PIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 365

Query: 366 IFYFAIGI 373
           I +  +G+
Sbjct: 366 ILFQNVGL 373


>gi|53718041|ref|YP_107027.1| hypothetical protein BPSL0401 [Burkholderia pseudomallei K96243]
 gi|76809874|ref|YP_332026.1| ABC transporter permease [Burkholderia pseudomallei 1710b]
 gi|126441439|ref|YP_001057484.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 668]
 gi|126452246|ref|YP_001064733.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106a]
 gi|134279780|ref|ZP_01766492.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 305]
 gi|167736870|ref|ZP_02409644.1| ABC transporter, permease protein [Burkholderia pseudomallei 14]
 gi|167813976|ref|ZP_02445656.1| ABC transporter, permease protein [Burkholderia pseudomallei 91]
 gi|167822497|ref|ZP_02453968.1| ABC transporter, permease protein [Burkholderia pseudomallei 9]
 gi|167844078|ref|ZP_02469586.1| ABC transporter, permease protein [Burkholderia pseudomallei B7210]
 gi|167892582|ref|ZP_02479984.1| ABC transporter, permease protein [Burkholderia pseudomallei 7894]
 gi|167901079|ref|ZP_02488284.1| ABC transporter, permease protein [Burkholderia pseudomallei NCTC
           13177]
 gi|167909299|ref|ZP_02496390.1| ABC transporter, permease protein [Burkholderia pseudomallei 112]
 gi|167917331|ref|ZP_02504422.1| ABC transporter, permease protein [Burkholderia pseudomallei
           BCC215]
 gi|226193717|ref|ZP_03789320.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237810635|ref|YP_002895086.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei MSHR346]
 gi|242316672|ref|ZP_04815688.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106b]
 gi|254181998|ref|ZP_04888595.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1655]
 gi|254187927|ref|ZP_04894439.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|254196514|ref|ZP_04902938.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei S13]
 gi|254260256|ref|ZP_04951310.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1710a]
 gi|254295953|ref|ZP_04963410.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 406e]
 gi|52208455|emb|CAH34389.1| putative membrane protein [Burkholderia pseudomallei K96243]
 gi|76579327|gb|ABA48802.1| ABC transporter, permease protein [Burkholderia pseudomallei 1710b]
 gi|126220932|gb|ABN84438.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 668]
 gi|126225888|gb|ABN89428.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106a]
 gi|134248980|gb|EBA49062.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 305]
 gi|157805700|gb|EDO82870.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 406e]
 gi|157935607|gb|EDO91277.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pasteur 52237]
 gi|169653257|gb|EDS85950.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei S13]
 gi|184212536|gb|EDU09579.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1655]
 gi|225934295|gb|EEH30279.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei Pakistan 9]
 gi|237504399|gb|ACQ96717.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei MSHR346]
 gi|242139911|gb|EES26313.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1106b]
 gi|254218945|gb|EET08329.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 1710a]
          Length = 374

 Score =  232 bits (591), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 167/368 (45%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++    +V   I +  +      DLS +  +D +G + +     + 
Sbjct: 17  GRTVRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR 76

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L         +  +    + S       +     G+ +  F    
Sbjct: 77  ---------LPDGIALTDNQRVVFERIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHL 127

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG +I +                 +   +Y  G   +P+  L++F+ G V++  
Sbjct: 128 YGGIALLGGLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYL 185

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 186 SAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 245

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S  
Sbjct: 246 VMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVV 305

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 306 PIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 365

Query: 366 IFYFAIGI 373
           I +  +G+
Sbjct: 366 ILFQNVGL 373


>gi|32266623|ref|NP_860655.1| hypothetical protein HH1124 [Helicobacter hepaticus ATCC 51449]
 gi|32262674|gb|AAP77721.1| conserved hypothetical protein [Helicobacter hepaticus ATCC 51449]
          Length = 348

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 95/350 (27%), Positives = 166/350 (47%), Gaps = 4/350 (1%)

Query: 24  ADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFS 83
                      I      +D   +++ D +    I   +       ++ G +T   ++F 
Sbjct: 3   KKQREALSEAIISQHKLTIDFKRVSKADFVFCAFIYGLI--VDKDTQIIGTNTRTNEIFQ 60

Query: 84  LISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFC 143
            +S +  K+ +      +F       +   +GK+I +F     +  +  G+ +       
Sbjct: 61  TLSSSLPKENEENAINNAFSLKISHMVLIPLGKRIEQFFESFLNFLNFCGMCLWYFFLSL 120

Query: 144 ASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLM 203
            S  +FK    S+   M   G   +PV +L +F+    IA QG  QL + G  + S++++
Sbjct: 121 LSPRRFKC--GSIFYHMNEAGFKALPVALLTAFIVSYAIALQGVLQLEKMGVPLMSVEIV 178

Query: 204 SILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWAL 263
           + L LRE+G  + A++IAGRS SA  A++G M + EE DA++TM L     LI PR+ AL
Sbjct: 179 AKLSLRELGPFILAIVIAGRSSSAFSAQLGVMNLTEENDALKTMNLSLFDYLILPRVLAL 238

Query: 264 IISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACA 323
           II +PLL  LA+  ++  A + +     I F  +  RF+    + +   G+IKAPF   A
Sbjct: 239 IIVMPLLVFLADSVSLFAAMLAVKMQTGINFMQYLERFYEYVGINHFLVGMIKAPFFGAA 298

Query: 324 IGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           I +V    G  V   + S+G + T  VV ++  VI+I+++F++    + I
Sbjct: 299 IALVGCFRGLYVKGDTESIGLETTKSVVNALFWVILINAIFSVITTRLDI 348


>gi|237752254|ref|ZP_04582734.1| toluene ABC transporter permease [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229376496|gb|EEO26587.1| toluene ABC transporter permease [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 373

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 96/357 (26%), Positives = 168/357 (47%), Gaps = 12/357 (3%)

Query: 16  KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVS 75
               +  + D +  +  K      A  D      +D  G E+++ ++E       ++   
Sbjct: 28  TLNALYTLLDTLKKSPQKVRIQKDASFD------LDFCGGEVLINWLEHLSECCTIENTL 81

Query: 76  THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLV 135
               +   + +    K    +K        + K+        +  + +        LG +
Sbjct: 82  LEHSKTAEIFAILQSKTTLEKKEFTQDVIQAHKDTLEI----LKVWGSRLVITLSFLGEI 137

Query: 136 ISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGA 195
           +        +   F+    +L  Q+    +  VP++ L  F+ G VIA QG+ QL QFGA
Sbjct: 138 VYLLYHSVLNPRDFRI--RALFFQIQEAVIKAVPIISLACFLIGIVIAYQGSLQLRQFGA 195

Query: 196 EIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRIL 255
            +  +++ ++L LRE+  ++ A+++AGRS SA  AEIG M+  +EIDA+R MG + V  L
Sbjct: 196 SVLIVEMSAMLTLREMAPIIVAIIVAGRSASAFSAEIGMMRATQEIDAMRVMGFNPVTFL 255

Query: 256 ISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLI 315
           I PRI+AL+ +LPL+  +A+   ++G  ++      I    F  RF  T  + + + G++
Sbjct: 256 IFPRIFALLFALPLVVFVADMFGLLGGMLISQLQLGISSEHFIERFLQTVEMRHFWIGML 315

Query: 316 KAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           KAPF    IG++    GFA    + S+G   T  VV+SI  VI  D+L ++ +  IG
Sbjct: 316 KAPFFGLIIGLIGCYHGFATQKDTRSIGVHTTKSVVESIFCVIAFDALCSVLFTQIG 372


>gi|283853770|ref|ZP_06370995.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
 gi|283570832|gb|EFC18867.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
          Length = 385

 Score =  231 bits (589), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 88/353 (24%), Positives = 160/353 (45%), Gaps = 12/353 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDT---IGAELIMY 60
           NGI     +G W+          V  A+  S      +   +A+T  D+        ++ 
Sbjct: 22  NGILTLTLSGVWRLDRPFPPLAPVKDALATSPAPRKLVFAATAVTGWDSRFLADCRAVLV 81

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +   ++++ G+      L  L +    ++   +K   +            +G   + 
Sbjct: 82  LARERGVEVEVSGLPEGAASLLDLAAKVPERQGAARKTSHA-------AFLESMGDLGLG 134

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F     +    LG V            +      +L+  +Y  GV  +P+V LIS + G 
Sbjct: 135 FAQGVVNLLEFLGEVTLACLALLRG--RAVFQRSNLVTLIYQAGVEALPIVSLISLLVGL 192

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++A  GA QLSQFGA+I+   ++ I  +R +G ++T +++AGR+G+A  AE+G+M++NEE
Sbjct: 193 ILAFVGAIQLSQFGAQIYVSTIVGIAMVRVMGAIMTGIIMAGRTGAAYAAELGTMQVNEE 252

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA++T G    + L+ PR+ AL++ LPLL + A+   I+G  IV      I    + + 
Sbjct: 253 IDALKTFGFSPTQFLVLPRMIALVLMLPLLCVYADLMGILGGFIVGVFMLHINPIQYLTH 312

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              +  LAN + GL+ +      + +     G   G  + ++G+  T+ VV  
Sbjct: 313 TWQSVPLANFWIGLVHSTVFGVLVAMAGCYRGMRCGRSALAVGQAATSAVVTG 365


>gi|254480123|ref|ZP_05093371.1| conserved domain protein [marine gamma proteobacterium HTCC2148]
 gi|214039685|gb|EEB80344.1| conserved domain protein [marine gamma proteobacterium HTCC2148]
          Length = 376

 Score =  231 bits (588), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 91/377 (24%), Positives = 173/377 (45%), Gaps = 15/377 (3%)

Query: 1   MSEN-GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           ++E+  + V    G+W   +       +   +   I +   +VD S +   D++    ++
Sbjct: 11  LTEDREVAVLLLTGDWVQGQSHRDFHVLKDDLLG-ITASELVVDGSQLGLWDSVLMAFLL 69

Query: 60  YFMEKYHGK---IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
               +        + + +   IE+L  + +        +   ++ +   S        G 
Sbjct: 70  QSFNQCREDNIVFRTRALPDGIERLLDVATAVPTHVPPSAPNKQWYESFSP-------GS 122

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +++    +      +G +              +          Y  G     ++ L S 
Sbjct: 123 LVLELWESTVESLAFIGELGIALWRLALGKANTR--FSDFRTFCYQAGPDAFAIISLTSV 180

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G ++A  GA QL QFGAE++  DL+ I  LRE+GVL+ A+++AGR+G+A  A++G+M+
Sbjct: 181 LVGMILAYLGAVQLQQFGAEVYVADLVVIGMLREMGVLMAAIVMAGRTGAAYAAQLGTMQ 240

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
            NEEIDAIRTMG+  +  L+ PR+ AL++++PLLT+ AN    I    ++     +   +
Sbjct: 241 ANEEIDAIRTMGISPMEFLVVPRMLALVVAMPLLTLYANLL-GIIGGGIVSGGLGVTPLM 299

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           + S   +   L+++  GLIK+      I +   + G   G  S ++G+  T  VV +I  
Sbjct: 300 YISEGETALQLSHLSVGLIKSVVFGVLIAVAGCRSGINSGRSSAAVGQAATQAVVTAIVY 359

Query: 357 VIIIDSLFAIFYFAIGI 373
           +I+ D+   I +  +GI
Sbjct: 360 LIVADAAINILFQQVGI 376


>gi|303247224|ref|ZP_07333498.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
 gi|302491383|gb|EFL51271.1| protein of unknown function DUF140 [Desulfovibrio fructosovorans
           JJ]
          Length = 368

 Score =  230 bits (587), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 89/354 (25%), Positives = 160/354 (45%), Gaps = 12/354 (3%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAE---LIM 59
            +G+    F+G W+    S     +  A+ KS    +   + + +T+ D+        I+
Sbjct: 4   SDGVLTLTFSGTWRIDRPSPDLSPIRAALGKSPAPKTLAFESAKVTDWDSRFLTQCRAIL 63

Query: 60  YFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIV 119
              + +     L G+    + L  L      ++   +K   + F     ++         
Sbjct: 64  ALAKAHGVTPDLSGLPAGAKSLLELAEKVPERQGAARKEASTPFLTRVADM-------AF 116

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                  +    +G V            +      +L   +Y  GV  +P+V LIS + G
Sbjct: 117 GAWQGVHNLLDFVGDVTLACLALAGG--RAVFQRSNLFALIYQAGVEALPIVSLISLLVG 174

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            ++A  GA QLSQFGA+I+   ++ I  +R +G ++T +++AGR+G+A  AE+G+M++NE
Sbjct: 175 LILAFVGAIQLSQFGAQIYVSTIVGIAMVRVMGAIMTGIIMAGRTGAAYAAELGTMQVNE 234

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           EIDA+RT G    + L+ PR+ AL++ +PLL I A+   I+G  IV      I    + +
Sbjct: 235 EIDALRTFGFSPTQFLVLPRMIALVLMMPLLCIYADIMGILGGFIVGVFMLKINPIQYLT 294

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
               +  LAN + GL+ +      + +     G   G  + ++G+  T  VV S
Sbjct: 295 HTWQSVPLANFWIGLVHSTVFGVLVAMAGCYRGMRCGRSALAVGQATTAAVVTS 348


>gi|224437093|ref|ZP_03658074.1| hypothetical protein HcinC1_03955 [Helicobacter cinaedi CCUG 18818]
 gi|313143563|ref|ZP_07805756.1| ABC transport system permease [Helicobacter cinaedi CCUG 18818]
 gi|313128594|gb|EFR46211.1| ABC transport system permease [Helicobacter cinaedi CCUG 18818]
          Length = 367

 Score =  230 bits (587), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 99/370 (26%), Positives = 176/370 (47%), Gaps = 11/370 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +G  + +F G   + + S               ++   +D   IT++D +    I   +E
Sbjct: 9   SGRMLIKFQG---ACDYSLDKKSKDFLSKLISANERITLDFLEITKVDFVFCAFIYGLLE 65

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                 ++    + ++++F  +  +  K   ++    S FY +  +     GK   +   
Sbjct: 66  --GKDYEILNADSQVKEIFQSMVESLPKLENSKSKSHSMFYGALFDF----GKFCERSYQ 119

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
            S    +  G+        C +   FK  L S++  +   G   +PV +L +F+    IA
Sbjct: 120 SSLDFLNFFGMCSFYFFRSCWNLRHFK--LGSIMYHINESGFKALPVALLTAFIVSYAIA 177

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            QG  QL + G  + S+++++ L LRE+G  + A++IAGRS S+  A+IG M + EE DA
Sbjct: 178 LQGVLQLEKMGVPLMSVEIVAKLSLREMGPFILAIVIAGRSSSSFAAQIGVMNLTEENDA 237

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           ++TM L     +I PRI AL+I +PLL  LA+  ++    + I     + F  +  RF+ 
Sbjct: 238 LKTMNLSLFDYIILPRILALVIIMPLLVFLADAVSLFACFLAINMQTGLDFMQYLERFYE 297

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              + N + G+IKAPF   A+ +V    G  V   + S+G + T  VV +I  VI+I+++
Sbjct: 298 YVGINNFWVGVIKAPFFGAAVALVGCFRGLYVKGDTESVGIETTKSVVNAIFWVILINAI 357

Query: 364 FAIFYFAIGI 373
           F+I    + I
Sbjct: 358 FSIITTGLNI 367


>gi|67642420|ref|ZP_00441177.1| putative ABC transporter, permease protein [Burkholderia mallei GB8
           horse 4]
 gi|121598966|ref|YP_991583.1| putative ABC transporter, permease protein [Burkholderia mallei
           SAVP1]
 gi|126450485|ref|YP_001082718.1| putative ABC transporter, permease protein [Burkholderia mallei
           NCTC 10247]
 gi|251768288|ref|ZP_02270158.2| putative ABC transporter, permease protein [Burkholderia mallei
           PRL-20]
 gi|254357616|ref|ZP_04973890.1| putative ABC transporter, permease protein [Burkholderia mallei
           2002721280]
 gi|121227776|gb|ABM50294.1| putative ABC transporter, permease protein [Burkholderia mallei
           SAVP1]
 gi|126243355|gb|ABO06448.1| putative ABC transporter, permease protein [Burkholderia mallei
           NCTC 10247]
 gi|148026680|gb|EDK84765.1| putative ABC transporter, permease protein [Burkholderia mallei
           2002721280]
 gi|238523569|gb|EEP87007.1| putative ABC transporter, permease protein [Burkholderia mallei GB8
           horse 4]
 gi|243060282|gb|EES42468.1| putative ABC transporter, permease protein [Burkholderia mallei
           PRL-20]
          Length = 366

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 168/368 (45%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++    +V   I +  +      DLS +  +D +G + +     + 
Sbjct: 9   GRTVRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR 68

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L        ++  +    + S       +     G+ +  F    
Sbjct: 69  ---------LPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHL 119

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG +I +                 +   +Y  G   +P+  L++F+ G V++  
Sbjct: 120 YGGIALLGGLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYL 177

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 178 SAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 237

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S  
Sbjct: 238 VMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVV 297

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 298 PIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 357

Query: 366 IFYFAIGI 373
           I +  +G+
Sbjct: 358 ILFQNVGL 365


>gi|217419400|ref|ZP_03450906.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 576]
 gi|217396704|gb|EEC36720.1| putative ABC transporter, permease protein [Burkholderia
           pseudomallei 576]
          Length = 366

 Score =  230 bits (586), Expect = 3e-58,   Method: Composition-based stats.
 Identities = 95/368 (25%), Positives = 167/368 (45%), Gaps = 11/368 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
               R  G W +  ++    +V   I +  +      DLS +  +D +G + +     + 
Sbjct: 9   GRTVRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR 68

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                          L         +  +    + S       +     G+ +  F    
Sbjct: 69  ---------LPDGIALTDNQRVVFERIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHL 119

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                +LG +I +                 +   +Y  G   +P+  L++F+ G V++  
Sbjct: 120 YGGIALLGGLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYL 177

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 178 SAQQLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMR 237

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S  
Sbjct: 238 VMGIPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVV 297

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FA
Sbjct: 298 PIANLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFA 357

Query: 366 IFYFAIGI 373
           I +  +G+
Sbjct: 358 ILFQNVGL 365


>gi|297569477|ref|YP_003690821.1| protein of unknown function DUF140 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925392|gb|ADH86202.1| protein of unknown function DUF140 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 368

 Score =  229 bits (584), Expect = 6e-58,   Method: Composition-based stats.
 Identities = 96/372 (25%), Positives = 176/372 (47%), Gaps = 15/372 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G    + AG+W   E++     +   +  +     A   L  +  +D+ GA L+   
Sbjct: 10  ARDGR---QLAGSWTLGELARHLAAIRPQLQATPAG--ASWSLREVERLDSFGAMLLWQH 64

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +   K          ++L  +I+       +       F   +       +G  +  F
Sbjct: 65  WGRSWPKNLEIN-----DELRGVIAAVAAHSGRPLPRPHRF---TLLEALVLLGSMLFTF 116

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +  +     +LG ++ +         ++   L  L   MY VGV  +PV  L+ F+ G V
Sbjct: 117 LGHARDLVTLLGQLLLDLLFLVRHPRQWP--LRELSANMYKVGVKAMPVAALVGFLIGVV 174

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++   A QL  FG E++ ID++ +  +RE+G +L A+++AGRSGSA+ A++G M++ EEI
Sbjct: 175 LSYLSAMQLEAFGVEVYLIDILGLGIIRELGPVLVAILVAGRSGSAMTAQLGVMRVTEEI 234

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MG+     L+ P++ AL + +PLL +  +  A++G  +       I FA F  + 
Sbjct: 235 DALAAMGISRTIRLVLPKVLALTLVMPLLVLWTSAVALLGGMLSANMQLGISFAFFMEKL 294

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                +AN++ GL K       I +VA   G  +  ++ SL    T  VV +I+ VI++D
Sbjct: 295 PQVVPIANLYIGLGKGAVFGLLIALVACHFGLRIRPNTESLAAHTTASVVTAITTVILVD 354

Query: 362 SLFAIFYFAIGI 373
           ++FA+    +G+
Sbjct: 355 AVFAVMLRNVGV 366


>gi|317401487|gb|EFV82119.1| integral membrane protein [Achromobacter xylosoxidans C54]
          Length = 377

 Score =  229 bits (583), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 96/367 (26%), Positives = 180/367 (49%), Gaps = 11/367 (2%)

Query: 8   VFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
           V    G+W    ++E  + +   A         A  DL  I+ +DTIGA LI     +  
Sbjct: 21  VCHVGGDWSVLALAEPGEVERRRAAMAKATDAGARWDLQGISRLDTIGALLIWQAWGEKL 80

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
              +    S   + +F+ ++     K    +P+ ++           +G  +++   +  
Sbjct: 81  P--ERVRWSAGQQDVFTALATNKGGKQALPRPEPAW------GWLRALGGAVLQAGENGR 132

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +   +LG ++ +     +     +G    +  Q+Y  G   + +  L+ F+ G V++   
Sbjct: 133 ALLTMLGQLVLDLFGMLSRPS--RGPWREISAQVYRTGAQALGITALVGFLIGVVLSYLS 190

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL   GA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  
Sbjct: 191 AQQLQMIGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMLV 250

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG+   + LI PR+ AL +++PLL +  +  AI+G  +       +    F        +
Sbjct: 251 MGISHGQRLILPRVVALAVTMPLLVLWTDAMAILGGMLAAQVQLGVSAQWFLQSLPDAIS 310

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L N + G++K       I ++A   G  +  ++ SLG+  TT VV SI+ VI++D+L+A+
Sbjct: 311 LTNYWIGILKGVTFGILIALIACHFGLRIQPNTESLGRGTTTSVVTSITGVILLDALYAV 370

Query: 367 FYFAIGI 373
            + ++GI
Sbjct: 371 IFSSVGI 377


>gi|192359616|ref|YP_001982090.1| ABC-type transport system, permease [Cellvibrio japonicus Ueda107]
 gi|190685781|gb|ACE83459.1| ABC-type transport system, permease component [Cellvibrio japonicus
           Ueda107]
          Length = 375

 Score =  229 bits (583), Expect = 7e-58,   Method: Composition-based stats.
 Identities = 87/366 (23%), Positives = 168/366 (45%), Gaps = 12/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           +    GNW+     + A      +  S  + +  ++   +   D+  A  ++        
Sbjct: 22  ILCLYGNWQLGSAPDGATLCASLMAASGTTQTLQLNTDQLGTWDSSLAIALLQLARWCDT 81

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                 +    E L  L+                              + +      + +
Sbjct: 82  HQITLDIRAVPEGLQQLLRLATAIPPHQPSQSNDRHPWH---------QSLQDAWQGTRT 132

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               +G       ++     K +   ++    +   G   + +V LI+ + G ++A  G+
Sbjct: 133 TLIFIGDTSLALSQWVRGQAKTRRSDIAFF--IEQAGPRALAIVTLIALLVGMILAYLGS 190

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL Q GA+++  DL+++  +RE+G L+TAV++AGR+G+A  A++G+M++NEEIDA++TM
Sbjct: 191 VQLRQLGAQVYVADLVALGMVREMGALMTAVIMAGRTGAAYAAQLGTMQVNEEIDALKTM 250

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+  +  L+ PR+ AL++ +PLL I AN   ++G ++V     D+ F  +  +       
Sbjct: 251 GISSIEFLVLPRLLALVLVMPLLCIYANVIGMVGGALVATS-MDVNFIQYILQTQGAVGW 309

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            +I TGL+K+ F    I I   + G   G +S+++G   T  VV++I  +++ D+ F I 
Sbjct: 310 VDISTGLVKSVFFGVLIAIAGCQAGIHCGRNSDAVGMAATNAVVRAIVYLVVADAAFNIL 369

Query: 368 YFAIGI 373
           Y  +GI
Sbjct: 370 YDKLGI 375


>gi|139001578|dbj|BAF51698.1| putative innermembrane component of ABC transporter system
           [Sphingobium japonicum]
          Length = 316

 Score =  227 bits (580), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 103/323 (31%), Positives = 174/323 (53%), Gaps = 9/323 (2%)

Query: 50  IDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKN 109
           +DTIGA ++   +++      + G     E+L + +              R      ++ 
Sbjct: 1   MDTIGAWVLHRAIKRLDCG--ITGDKCDAERLIATVGSVDE-----PVNIRPDHEPPWQR 53

Query: 110 LHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVP 169
           +   IG+ +V             G  +  T        +F+    +++++   VGVS + 
Sbjct: 54  VVGQIGEAVVNSGTTLLGLLGFFGGTLVATWNVIRHPGRFRIN--AVVQRFEVVGVSALG 111

Query: 170 VVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIV 229
           ++ L+SF+ G VIAQQG+ QL QFG E+ +I+L+  L  RE+GVL+TA+M+AGRSGSA  
Sbjct: 112 IIGLMSFLIGIVIAQQGSVQLRQFGMEMLTINLVGRLTFRELGVLMTAIMVAGRSGSAFA 171

Query: 230 AEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY 289
           A++G+MK+ EE+DA+RT+G+  +  L+ PR  A+++ +PLL   ++  AIIG   +    
Sbjct: 172 AQLGTMKLTEEVDAMRTIGVSPMEALVLPRTLAVVVMMPLLGFYSSIVAIIGGGFLCAVS 231

Query: 290 YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTC 349
            DIP   F  R      + +++ GLIKAP     I +    +G  V  ++  +G + T  
Sbjct: 232 LDIPPITFVQRLREVVPIHDLWVGLIKAPVFGVIIALAGCFQGMQVKANAEEVGLRTTAA 291

Query: 350 VVQSISIVIIIDSLFAIFYFAIG 372
           VVQ+I +VI+ID+ FA+F+  +G
Sbjct: 292 VVQAIFLVIVIDAFFAVFFTWVG 314


>gi|161523583|ref|YP_001578595.1| hypothetical protein Bmul_0403 [Burkholderia multivorans ATCC
           17616]
 gi|189351647|ref|YP_001947275.1| putative ABC transporter permease [Burkholderia multivorans ATCC
           17616]
 gi|160341012|gb|ABX14098.1| protein of unknown function DUF140 [Burkholderia multivorans ATCC
           17616]
 gi|189335669|dbj|BAG44739.1| putative ABC transport system permease protein [Burkholderia
           multivorans ATCC 17616]
          Length = 374

 Score =  227 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 98/366 (26%), Positives = 166/366 (45%), Gaps = 11/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
             R  G W +  ++     VV           +  DLS I  +D +G + +     +   
Sbjct: 19  TVRLTGQWTALALARNRGAVVRRAESVATGSVSEWDLSGIGRLDHVGGQALWRVWGRKLP 78

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                  +       ++     R   + + P+R         L    G  +  F      
Sbjct: 79  PGIALTATQ-----RTIFERIERLDSQREAPERIVRVGPVTRL----GLMLFAFAEHLHG 129

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              + G VI +                     +Y  G   +P+  L++F+ G V++   A
Sbjct: 130 GIAMFGRVILDALSVLRRPQTMP--WKETSANIYSAGAQALPITALVAFLIGIVLSYLSA 187

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R M
Sbjct: 188 QQLQMFGANRYIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVM 247

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     LI PR+ AL +++PLL +  N  A+ G ++       I    F         +
Sbjct: 248 GIPHGLRLILPRVLALGVAMPLLVMWTNIVALTGGALAAKMVLGIDVNYFVRSLPGVVPI 307

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN++ GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI 
Sbjct: 308 ANLYIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAIL 367

Query: 368 YFAIGI 373
           +  +G+
Sbjct: 368 FQNVGL 373


>gi|53724609|ref|YP_101915.1| ABC transporter permease [Burkholderia mallei ATCC 23344]
 gi|52428032|gb|AAU48625.1| ABC transporter, permease protein [Burkholderia mallei ATCC 23344]
          Length = 355

 Score =  227 bits (580), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 95/365 (26%), Positives = 168/365 (46%), Gaps = 11/365 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G W +  ++    +V   I +  +      DLS +  +D +G + +     +    
Sbjct: 1   MRLCGQWTALALARDRGNVARRIARLAKEAVGEWDLSGVERLDHVGGQALWRVWGRR--- 57

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                       L        ++  +    + S       +     G+ +  F       
Sbjct: 58  ------LPDGIALTDNQRVVFKRIERLDAGRESPEPVVRIDPVTRFGQGLFTFGEHLYGG 111

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             +LG +I +                 +   +Y  G   +P+  L++F+ G V++   A 
Sbjct: 112 IALLGGLIVDLLAVLRRPRTMP--WTEISANVYAAGTKALPITALVAFLIGIVLSYLSAQ 169

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R MG
Sbjct: 170 QLQLFGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVMG 229

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +     +  PR+ AL +++PLL +  N  A+ G ++       I    F     S   +A
Sbjct: 230 IPHGLRITLPRVLALGVAMPLLVMWTNVIALTGGALAAKFVLGIDLNFFVRSLPSVVPIA 289

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           N+F GL K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI +
Sbjct: 290 NLFIGLGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAILF 349

Query: 369 FAIGI 373
             +G+
Sbjct: 350 QNVGL 354


>gi|294506238|ref|YP_003570296.1| ABC transporter permease [Salinibacter ruber M8]
 gi|294342566|emb|CBH23344.1| ABC transporter, permease [Salinibacter ruber M8]
          Length = 371

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 86/364 (23%), Positives = 166/364 (45%), Gaps = 13/364 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM- 62
           +   V    G+W        A  V++    S    +   D S + + D+     +     
Sbjct: 9   DDTLVLAPVGDWTLDRPLPDARAVMVNAAPSSPVAAVAFDTSGLGDWDSSLVTFLFEAAE 68

Query: 63  --EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
               +   +++  + T +E+L +L           +             L   +G   + 
Sbjct: 69  YGRAHDLDVRIDTLPTSLERLVALSQAVPEADTTPEAED--------TALLARLGHWGLA 120

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
             +++ +    LG  + + G       + +    +    +     S +P+V +IS + G 
Sbjct: 121 AYDEAHALVTFLGQAVRSVGAILTGRGRMR--WRTFGVALQESTASALPIVTVISLLVGL 178

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++A  GA  L +FGA+ F   L+S   LRE+G L+TA+++ GR+G+A  AE+GSM++NEE
Sbjct: 179 IVAFLGAVVLQRFGADYFVSYLVSYGMLRELGALMTAIIMTGRTGAAFAAELGSMQVNEE 238

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ T G+  +  L++PRI A++++LP+LT+ A+   I+G   V     D+    F + 
Sbjct: 239 IDALETFGISPIDFLVTPRILAVVLALPMLTLYADALGIVGGMGVAVTMLDLTTTQFLTG 298

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 L++   G+ KA      IG+     G   G  ++++G+  T+ VV  I +++  
Sbjct: 299 LLEPVVLSDALVGIFKAVVYGGIIGLAGCMRGLQAGDDASAVGQATTSAVVTGILLIVFA 358

Query: 361 DSLF 364
           +++ 
Sbjct: 359 NAVI 362


>gi|220904331|ref|YP_002479643.1| protein of unknown function DUF140 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
 gi|219868630|gb|ACL48965.1| protein of unknown function DUF140 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 375

 Score =  227 bits (579), Expect = 2e-57,   Method: Composition-based stats.
 Identities = 79/367 (21%), Positives = 149/367 (40%), Gaps = 7/367 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
                 G+W             +            ++   +   D+     ++  ++  +
Sbjct: 16  LRVSVGGSWNIDRAWPPEARTALESLTDQSIREVRLESDNLGVWDSSLLVFLVQLVQTAN 75

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
            +      S     L   +    +          S       N    +G+  +       
Sbjct: 76  ERKANLHTS-----LPDGLERLLKLAFAVPAKAGSDRKKEELNFVQRVGQVAIDLPPRVT 130

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
              + +G V    G       + +     L+  M   GV  +P++ + S + G ++A  G
Sbjct: 131 DFLNFVGDVTLAVGRLFVGRTQMRPQ--DLLAAMQECGVQALPIISITSMLFGLILAFVG 188

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL+QFGA+I+   L+ I  LR +G ++  V++AGR G+A  A IG+M++NEE+DA+ T
Sbjct: 189 AVQLTQFGAQIYVAGLVGIGMLRVMGAVMVGVVMAGRVGAAYAALIGTMQVNEEVDALAT 248

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +G+  V  L+ PR+ AL   +PLLT+ A+   ++G  IV     +I    + +       
Sbjct: 249 LGIAPVDFLVLPRVVALTAMIPLLTLYADLMGVVGGYIVATTMLNINPMEYINATMQMVP 308

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
             ++F GL         I +    +G   G  + ++G   TT VV +I  +I+  ++  +
Sbjct: 309 YKHVFIGLAYGTVFGVIIAMTGCYQGMRCGRSAQAVGLATTTAVVHAIVGIIVATAVITV 368

Query: 367 FYFAIGI 373
               + I
Sbjct: 369 ICNVLDI 375


>gi|317484538|ref|ZP_07943446.1| hypothetical protein HMPREF0179_00797 [Bilophila wadsworthia 3_1_6]
 gi|316924199|gb|EFV45377.1| hypothetical protein HMPREF0179_00797 [Bilophila wadsworthia 3_1_6]
          Length = 388

 Score =  227 bits (578), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 84/377 (22%), Positives = 162/377 (42%), Gaps = 11/377 (2%)

Query: 2   SENGITVFRFAGNWKSPEISE-----IADDVVMAINKSIQSDSAIVDLSAITEIDTIGAE 56
           S  G+    F+G WK   +         + +        ++ S  +   A+ E D+ G  
Sbjct: 18  SSEGVLRVIFSGEWKRDLLGPNFFTERDEALRETERLLKEARSVELLGEALGEWDS-GVL 76

Query: 57  LIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
           ++     +     K   +     +L   I    +  +       +            +G 
Sbjct: 77  VVT---TRLVTLAKEHNIPLDDARLPEGIRNLTKLALAVPPNTAAQRKAQKTTFLERVGG 133

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             +     +C     +G ++ + G       +      +    +   GV  +P+V LIS 
Sbjct: 134 FTLAVPRMACDIFDFIGELVLSAGRLFRG--RSSCTPGNAWLAVQESGVDALPIVSLISL 191

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G ++A  G  QL  FGAEI+   L+++   R +G ++T +++AGR+G++  A IG+M+
Sbjct: 192 LVGLILAFVGVIQLKMFGAEIYVSSLVAVSMTRIMGAIMTGIILAGRTGASYAAVIGTMQ 251

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           +NEEIDA+ T+G+     LI PR+ AL    PLL + ++F  I+G  IV      +    
Sbjct: 252 VNEEIDALTTLGVAPSDYLIMPRVLALTAMTPLLVLYSDFMGIMGGFIVGVGILGLDPME 311

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +++       + N++ G++        I I    +G   G ++ ++GK  T+ VV SI  
Sbjct: 312 YYTFTQKGFNINNLWVGMVHGAVYGMLIAITGCYQGLRCGRNAEAVGKATTSAVVYSIVG 371

Query: 357 VIIIDSLFAIFYFAIGI 373
           +++  ++  I    + I
Sbjct: 372 IVLSTAVLTILCNILNI 388


>gi|183220168|ref|YP_001838164.1| ABC transporter permease [Leptospira biflexa serovar Patoc strain
           'Patoc 1 (Paris)']
 gi|189910288|ref|YP_001961843.1| ABC transporter membrane protein [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167774964|gb|ABZ93265.1| Membrane protein of an ABC transporter complex [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167778590|gb|ABZ96888.1| ABC-type transport system, permease [Leptospira biflexa serovar
           Patoc strain 'Patoc 1 (Paris)']
          Length = 374

 Score =  226 bits (577), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 92/343 (26%), Positives = 167/343 (48%), Gaps = 8/343 (2%)

Query: 31  INKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR 90
           +       + I+  + + E DT G   +     +   +     +    ++    ++ T+ 
Sbjct: 40  LIGKNSPRNIIIFANQLKETDTSGISFLKLIRTECESRNIHFVLRELNDKFQYRLNITND 99

Query: 91  KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK 150
              K  +        S       IGK  +  + +        G +  +         K +
Sbjct: 100 DSKKYNEQLAVSLRKS-----EQIGKLTIDSLLEFKYLITFTGELTVSFWRSFLHPSKIR 154

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
                  R    +GV+  P++ +I F+ G +++ Q A  + +FGAEIF  +L+ +   RE
Sbjct: 155 --WKDSFRVAESMGVNAFPIIAMIGFLLGLIMSFQSAIPMRRFGAEIFVANLVGLSLFRE 212

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           +G L+TA +++GRSGS+  AE+G+MK++EEIDA+ TMGL  V+ LI PR+ A +I  PLL
Sbjct: 213 LGPLMTAFILSGRSGSSFAAELGTMKVSEEIDALTTMGLPPVQFLIIPRLVASLIVTPLL 272

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
           TI+ N   +IG ++V+  +   P   F ++ +    L++I  GL+K+ F    I  +   
Sbjct: 273 TIVFNLFGLIGGAVVLVSFG-FPLITFVNQVNIAVGLSDILGGLLKSYFFGMIIASIGCY 331

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            G      + ++G+  T+ VV SI +V I+D +F++ +F + I
Sbjct: 332 RGLKTASGAGAVGESTTSAVVGSIILVSILDGIFSVLFFYLRI 374


>gi|154173911|ref|YP_001408228.1| stas domain-containing protein [Campylobacter curvus 525.92]
 gi|112802195|gb|EAT99539.1| stas domain protein [Campylobacter curvus 525.92]
          Length = 368

 Score =  226 bits (577), Expect = 4e-57,   Method: Composition-based stats.
 Identities = 106/372 (28%), Positives = 177/372 (47%), Gaps = 14/372 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G+T F+F G +   +   + + +           S   D   +  +D     +++  
Sbjct: 11  AASGVTSFKFIGKFTYKDAKILQNTLSRIAKAR---GSLRFDFLQLLHVDYA---VLILV 64

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                GK      S    +    +            PQ         N    +G+KI   
Sbjct: 65  KNAIKGKKAEFVTSDTKIKAMISLLDDESIDFSYIPPQNK------LNFFARLGEKICDG 118

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             +       LG  +  T +   +    +  L      +   GV+ V +V L +F+ G V
Sbjct: 119 FKNLLEFGSFLGEFLIKTIKIFVNPMSLR--LREFSNYIKDGGVNAVFIVSLTAFLIGVV 176

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  G+  L+ FGA IF +++M +L LRE+  L+ A+++AGRS S+  A+IG+MK+ EEI
Sbjct: 177 LAYLGSAMLANFGASIFIVEIMGMLTLREVAPLIAAIVVAGRSASSFTAQIGAMKLTEEI 236

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++TMG +    L+ PRI A+++SLP++  +A+  +I+G  ++     DI FA + SRF
Sbjct: 237 DAMKTMGFEPFNFLVLPRIIAMVLSLPIIIFIADAISILGQMLICQGVLDISFADYLSRF 296

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L +   G+IKAPF    I I+    GF V  ++ SLG+  T  VV +I  VI +D
Sbjct: 297 KDMVELRHFAVGMIKAPFFGAIIAIIGCMRGFDVNSNAQSLGEMTTISVVNAIFWVIALD 356

Query: 362 SLFAIFYFAIGI 373
           + FAI +  + I
Sbjct: 357 AFFAIIFMWLKI 368


>gi|83814459|ref|YP_444490.1| ABC transporter, permease [Salinibacter ruber DSM 13855]
 gi|83755853|gb|ABC43966.1| ABC transporter, permease [Salinibacter ruber DSM 13855]
          Length = 371

 Score =  226 bits (576), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 86/364 (23%), Positives = 166/364 (45%), Gaps = 13/364 (3%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM- 62
           +   V    G+W        A  V++    S    +   D S + + D+     +     
Sbjct: 9   DDTLVLAPVGDWTLDRPLPDARAVMVNAAPSSPVAAVAFDTSGLGDWDSSLVTFLFEAAE 68

Query: 63  --EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
               +   +++  + T +E+L +L           +             L   +G   + 
Sbjct: 69  YGRAHDLDVRIDTLPTSLERLVALSQAVPEADTTPEAAD--------TALLARLGHWGLA 120

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
             +++ +    LG  + + G       + +    +    +     S +P+V +IS + G 
Sbjct: 121 AYDEAHALVTFLGQAVRSVGAILTGRGRMR--WRTFGVALQESTASALPIVTVISLLVGL 178

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++A  GA  L +FGA+ F   L+S   LRE+G L+TA+++ GR+G+A  AE+GSM++NEE
Sbjct: 179 IVAFLGAVVLQRFGADYFVSYLVSYGMLRELGALMTAIIMTGRTGAAFAAELGSMQVNEE 238

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ T G+  +  L++PRI A++++LP+LT+ A+   I+G   V     D+    F + 
Sbjct: 239 IDALETFGISPIDFLVTPRILAVVLALPMLTLYADALGIVGGMGVAVTMLDLTTTQFLTG 298

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 L++   G+ KA      IG+     G   G  ++++G+  T+ VV  I +++  
Sbjct: 299 LLEPVVLSDALVGIFKAVVYGGIIGLAGCMRGLQAGDDASAVGQATTSAVVTGILLIVFA 358

Query: 361 DSLF 364
           +++ 
Sbjct: 359 NAII 362


>gi|254000132|ref|YP_003052195.1| hypothetical protein Msip34_2431 [Methylovorus sp. SIP3-4]
 gi|313202095|ref|YP_004040753.1| hypothetical protein MPQ_2372 [Methylovorus sp. MP688]
 gi|253986811|gb|ACT51668.1| protein of unknown function DUF140 [Methylovorus sp. SIP3-4]
 gi|312441411|gb|ADQ85517.1| conserved hypothetical protein [Methylovorus sp. MP688]
          Length = 371

 Score =  226 bits (575), Expect = 6e-57,   Method: Composition-based stats.
 Identities = 91/369 (24%), Positives = 163/369 (44%), Gaps = 11/369 (2%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G    R  G W    +     ++  A+           DL A  ++DT GA +++   E 
Sbjct: 14  GRRRVRLLGQWSLRALDNDFAELKQALQPFFSDPFTQWDLLATEQLDTAGATILLNGWE- 72

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                    V+     LF+ +           +   +F            G+ ++KF   
Sbjct: 73  -GKLDARMQVTEEQRALFTTLQGLRVPARTGSQFDWAFP-------LVATGELVMKFAQH 124

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 ++GL++            F       +  +Y  GV+ +PV  L+ F+ G  ++ 
Sbjct: 125 LTDFVQLIGLLLLEMLYLVRRPSAFP--WREFMANIYKSGVTALPVTGLLGFMIGVAMSY 182

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             + QL  FGA+IF ++++ +  +RE+G +L A+++AGRSGSA+ A+IG M++ EEIDA+
Sbjct: 183 LMSSQLRTFGADIFIVNILGLSMIRELGPILMAILVAGRSGSAMTAQIGVMRVTEEIDAL 242

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG+  +  ++ P++  L    P L +  +F  + G ++       + F  FF      
Sbjct: 243 TTMGVSRILRIVLPKVLGLTFVAPFLVLWTSFWGLAGGALSANTELGLSFRFFFDYLPMV 302

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               N+   L K       + +VA   G  +  ++ SL    T+ VV +I+ VI++D+ F
Sbjct: 303 VEPVNLTLSLFKGLLFGFVVTLVACHFGLRIMPNTESLSASTTSSVVTAITSVILLDAAF 362

Query: 365 AIFYFAIGI 373
           AI    IG+
Sbjct: 363 AILTSGIGV 371


>gi|224418846|ref|ZP_03656852.1| toluene ABC transporter permease [Helicobacter canadensis MIT
           98-5491]
          Length = 375

 Score =  225 bits (574), Expect = 9e-57,   Method: Composition-based stats.
 Identities = 103/370 (27%), Positives = 173/370 (46%), Gaps = 8/370 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +N I + + +G W           ++   +  + +    ++L+   ++D  G E++  ++
Sbjct: 13  DNDIYILKLSGLWD---YKIPKSLLLRLDSIKLTNVKIKIELAENFDLDFCGGEILERWI 69

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                K     V  +  +  S      +     + P +      F  LH+   + I  F 
Sbjct: 70  LALESKNI---VLENALKNHSKSQQIFQILATRKNPLKQDMVQDFIKLHWDSFQIIKGFF 126

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            DS       G ++             +  L + +  +    V  + +V L  F+ G VI
Sbjct: 127 KDSLMAIGFFGEILYAWFSSLLQPKNIR--LKATLYCIQESLVKAIGIVALACFLIGIVI 184

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG+ QL QFGA I  +++ S+L LRE+  ++TA++IAGRS SA  AEIG M+  +EID
Sbjct: 185 AYQGSIQLGQFGASILIVEMSSMLTLREMAPIITAIIIAGRSASAFSAEIGMMRATQEID 244

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG D +  L+ PR+ AL + LPL+  +A+   ++GA +V      I    F  RF 
Sbjct: 245 AMRVMGFDPITFLVLPRMLALCLVLPLVVFIADLFGLLGAMLVCQLQLGIGTEQFVERFL 304

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + + + G+ KAPF    I  V    GF V   + S+G   T  VV+SI +VI  D+
Sbjct: 305 QVVDMRHFWVGIAKAPFFGLIISFVGCFHGFIVAKDTRSIGVHTTKSVVESIFLVIAFDA 364

Query: 363 LFAIFYFAIG 372
           L ++ +  +G
Sbjct: 365 LCSVVFTEMG 374


>gi|311109431|ref|YP_003982284.1| hypothetical protein AXYL_06276 [Achromobacter xylosoxidans A8]
 gi|310764120|gb|ADP19569.1| hypothetical protein AXYL_06276 [Achromobacter xylosoxidans A8]
          Length = 354

 Score =  224 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 96/363 (26%), Positives = 175/363 (48%), Gaps = 11/363 (3%)

Query: 12  AGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIK 70
           AG+W    ++E  +               A  DL  I  +DTIGA LI       H   +
Sbjct: 2   AGDWSVLALAEPGEVQRRREALACATDGGARWDLHGIGRLDTIGALLIWEAWG--HKLPE 59

Query: 71  LQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAH 130
               S   + +F+ ++    +       +  + +         +G+ I + I++  +   
Sbjct: 60  RVRWSAGQQDVFNALAMNKGETPAAAPKRDPWSWPR------AVGEAIFQAIDNGRALLV 113

Query: 131 ILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL 190
           +LG ++ + G          G    +  Q+Y  G   + +  L+ F+ G V++   A QL
Sbjct: 114 MLGQLVLDFGGMLRRPR--LGPWREISAQVYRTGAQALGITALVGFLIGVVLSYLSAQQL 171

Query: 191 SQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
              GA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA+  MG+ 
Sbjct: 172 QMIGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDAMLVMGIS 231

Query: 251 FVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANI 310
             + LI PR+ AL +++PLL +  +  AI+G  +       +    F        +L N 
Sbjct: 232 HGQRLILPRVVALAVTMPLLVLWTDAMAILGGMLAAQMQLGVSAQWFLQSLPDAISLTNY 291

Query: 311 FTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           + G++K       I ++A   G  +  ++ SLG+  TT VV SI+ VI++D+ +A+ + +
Sbjct: 292 WIGILKGVTFGMLIALIACHFGLRIQPNTESLGRGTTTSVVTSITGVILLDAFYAVIFSS 351

Query: 371 IGI 373
           +GI
Sbjct: 352 VGI 354


>gi|300114239|ref|YP_003760814.1| hypothetical protein Nwat_1606 [Nitrosococcus watsonii C-113]
 gi|299540176|gb|ADJ28493.1| protein of unknown function DUF140 [Nitrosococcus watsonii C-113]
          Length = 376

 Score =  224 bits (571), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 116/366 (31%), Positives = 192/366 (52%), Gaps = 6/366 (1%)

Query: 9   FRFAGNWKSPEISEIADDVV--MAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
               G+W     +E+   +    A  +   + +A V+LS +  +DT GA L++  +    
Sbjct: 14  LHVIGDWTLEYYAELQSRIDVFKAQAEKNNTLNATVELSGLNRLDTAGAVLLVELLGAER 73

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
               ++  S       +L+    R       PQR    +    L    G++I  F     
Sbjct: 74  LAAFVKEGSGLTPARRALLDAVVRTMSMPLAPQRQAR-SPLVALLAGTGERIELFWRQQL 132

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                +GL++ +         +++  L +L+ Q+   G++ + +V L++F+ GAV+A  G
Sbjct: 133 LLLGFIGLILGSLTATFWRPNRWR--LTALVAQIQQTGLNAIGIVALLTFLVGAVVAFLG 190

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A  L  FGA I+++DL++   LRE GVLL A+++AGR+ SA  A+IGSMK NEEIDA+RT
Sbjct: 191 ATVLQNFGATIYTVDLIAFSFLREFGVLLAAILLAGRTASAFTAQIGSMKANEEIDALRT 250

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +GL    +L+ PR+ AL++SLP+LT +   S ++G  +V     DI    F +      +
Sbjct: 251 LGLSTAELLVLPRVLALLLSLPILTFIGMLSGMLGGGLVCLVVLDISALQFVTILQG-IS 309

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           L +   GL KAP  A  I  +   EGF V   + S+G+  T+ VVQSI +VI++D++ A+
Sbjct: 310 LKHFLVGLSKAPIFAFFIAAIGCLEGFKVSGSAQSVGEHTTSSVVQSIFMVILLDAIAAL 369

Query: 367 FYFAIG 372
           F+  +G
Sbjct: 370 FFMEMG 375


>gi|253828165|ref|ZP_04871050.1| inner membrane protein yrbE [Helicobacter canadensis MIT 98-5491]
 gi|313142364|ref|ZP_07804557.1| ABC transporter [Helicobacter canadensis MIT 98-5491]
 gi|253511571|gb|EES90230.1| inner membrane protein yrbE [Helicobacter canadensis MIT 98-5491]
 gi|313131395|gb|EFR49012.1| ABC transporter [Helicobacter canadensis MIT 98-5491]
          Length = 371

 Score =  224 bits (570), Expect = 2e-56,   Method: Composition-based stats.
 Identities = 103/370 (27%), Positives = 173/370 (46%), Gaps = 8/370 (2%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           +N I + + +G W           ++   +  + +    ++L+   ++D  G E++  ++
Sbjct: 9   DNDIYILKLSGLWD---YKIPKSLLLRLDSIKLTNVKIKIELAENFDLDFCGGEILERWI 65

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFI 122
                K     V  +  +  S      +     + P +      F  LH+   + I  F 
Sbjct: 66  LALESKNI---VLENALKNHSKSQQIFQILATRKNPLKQDMVQDFIKLHWDSFQIIKGFF 122

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
            DS       G ++             +  L + +  +    V  + +V L  F+ G VI
Sbjct: 123 KDSLMAIGFFGEILYAWFSSLLQPKNIR--LKATLYCIQESLVKAIGIVALACFLIGIVI 180

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           A QG+ QL QFGA I  +++ S+L LRE+  ++TA++IAGRS SA  AEIG M+  +EID
Sbjct: 181 AYQGSIQLGQFGASILIVEMSSMLTLREMAPIITAIIIAGRSASAFSAEIGMMRATQEID 240

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+R MG D +  L+ PR+ AL + LPL+  +A+   ++GA +V      I    F  RF 
Sbjct: 241 AMRVMGFDPITFLVLPRMLALCLVLPLVVFIADLFGLLGAMLVCQLQLGIGTEQFVERFL 300

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
               + + + G+ KAPF    I  V    GF V   + S+G   T  VV+SI +VI  D+
Sbjct: 301 QVVDMRHFWVGIAKAPFFGLIISFVGCFHGFIVAKDTRSIGVHTTKSVVESIFLVIAFDA 360

Query: 363 LFAIFYFAIG 372
           L ++ +  +G
Sbjct: 361 LCSVVFTEMG 370


>gi|254284160|ref|ZP_04959128.1| ABC transporter permease protein [gamma proteobacterium NOR51-B]
 gi|219680363|gb|EED36712.1| ABC transporter permease protein [gamma proteobacterium NOR51-B]
          Length = 377

 Score =  223 bits (569), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 94/373 (25%), Positives = 170/373 (45%), Gaps = 15/373 (4%)

Query: 3   ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFM 62
           ++        G+W+S  +     ++           +  VD   +   D+    L++   
Sbjct: 18  DDCHHSLILKGSWESSAVLP---ELGALFQPDDTVTALRVDALEVARWDSRLISLLLKLH 74

Query: 63  E--KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
              +  G      +     QL +L            +        +       +G ++  
Sbjct: 75  RYCESRGISITTELPEGASQLLALAVAVPPAVESPSQSAGWLHSLNPLPYLERLGARVTD 134

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F+N   S     G V++          + +  +  L+   Y  G + +P++ L S + G 
Sbjct: 135 FLNFVGSLVSSTGRVVTG---------RGRVRVSDLLAFAYQTGPNALPIIGLTSLLVGM 185

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           ++   GA QL QFGA IF  DL++I  LRE+G L+TA++IAGR+G+A  A++G+M++NEE
Sbjct: 186 ILGYLGAVQLQQFGAGIFVADLVTIGVLREMGALMTAIIIAGRTGAAYAAQLGTMRVNEE 245

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DAI  +G+  +  L+ PR+ A+ + +PLL++ A    I+G  IV      I    ++++
Sbjct: 246 VDAIEILGISLMDFLVLPRVLAVTLMVPLLSLYAAIMGIVGGGIVS-ISLGITPLQYWTQ 304

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             ++  L ++  GL KA      IGI   + G   G  S  +GK  TT VV ++  +I+ 
Sbjct: 305 AQTSLGLDHLLVGLSKALLFGALIGIAGCRAGMQSGRSSEGVGKATTTAVVVALVYLILA 364

Query: 361 DSLFAIFYFAIGI 373
           D+   +    +GI
Sbjct: 365 DAAVNLLCQLLGI 377


>gi|223940090|ref|ZP_03631954.1| protein of unknown function DUF140 [bacterium Ellin514]
 gi|223891275|gb|EEF57772.1| protein of unknown function DUF140 [bacterium Ellin514]
          Length = 399

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 89/364 (24%), Positives = 174/364 (47%), Gaps = 8/364 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
               V R +G   +     +   +  A+       +  V+++ +T  D+ G   +    +
Sbjct: 38  ENRFVLRLSGRLDADSTPFLWQRLQSAL-VVPPGATLEVNVAPLTYSDSAGFAFLYLLSK 96

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                     ++    +    +     + ++  + ++    +    L   IG  ++    
Sbjct: 97  GCMTPQSQVSLNGLKPEYQKALQNYSMEDVQAYQGEQPVRQS----LMDEIGMAVIAKTL 152

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +   +   +G VIS  G         +     ++R     G + +P+V LIS + G VIA
Sbjct: 153 EVRQKVIFVGDVISGLGYVLTHPRWMRRN--EIVRIFETAGANALPIVSLISLLLGLVIA 210

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            + A   ++FGA+I+  +L+ ++ +RE+  ++TA+++AGRSGSA  AE+G+MK+NEE++A
Sbjct: 211 FEAAQPFARFGAKIYIANLIGLIMVRELSPVMTAILLAGRSGSAFAAELGTMKVNEELNA 270

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + T+GLD +R L+  RI A ++  PLLTI +  + ++G  +V+      P ++ + +  S
Sbjct: 271 LETIGLDPMRFLVVQRILASLLLTPLLTIYSMATGVLGGVLVM-LGLGFPLSIAWHQLQS 329

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
           +  + +I  G++KA      +   A   G        ++G+  T  VV  I ++II DS+
Sbjct: 330 SVRINDIAFGILKAFVFGGIVAGTACLRGLETKSGPAAVGESTTRSVVSGILLIIIADSV 389

Query: 364 FAIF 367
           FAI 
Sbjct: 390 FAIL 393


>gi|328954039|ref|YP_004371373.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328454363|gb|AEB10192.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 377

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 91/375 (24%), Positives = 168/375 (44%), Gaps = 12/375 (3%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           S         +G+W        AD V   +  S+   + + D   +   DT     +M  
Sbjct: 12  SSADTLKVMISGDWLLGGELPAADRVQQRLEGSLGVRNLVFDTRELAHWDTGLLTFLMSL 71

Query: 62  ME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                + +  +   G+    ++L  L S          + + +       +    +G + 
Sbjct: 72  ATFCSQQNIYLDRDGLPPGAKRLLELASAV-------PEKKDAHKVEERLSFLAFLGNET 124

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           V F   +      +G  +           +++   L LI Q   VGV  +P+V LI F+ 
Sbjct: 125 VNFFQSAGELLEFIGDAVIAVLRLIRGQAQYRRADLGLIMQA--VGVQALPIVSLICFLV 182

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G ++A  GA QL  FGA+I+  DL+ I  +R +  ++T +++AGR+G A  A++G+M++N
Sbjct: 183 GLILAFIGAIQLKLFGAQIYVADLVGIAMVRLMAAIMTGIVMAGRTGGAFAAQLGTMQVN 242

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           +EIDA++T+G+  +  L+ PR+ AL + +PLL + AN   I+G   V      I F  ++
Sbjct: 243 QEIDALKTLGISPMEFLVLPRMLALALMMPLLCLYANVMGILGGMAVGVGMLGIGFIQYY 302

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
           ++  +   L N+  GL         + +     G   G  ++++G   T+ VV +I  +I
Sbjct: 303 NQTAAAVGLWNLGIGLFSGTVFGVIVALAGCMRGMQCGRSASAVGDAATSAVVTAIVGII 362

Query: 359 IIDSLFAIFYFAIGI 373
           +  +   I    +GI
Sbjct: 363 VSTAAITILCNFLGI 377


>gi|145589257|ref|YP_001155854.1| hypothetical protein Pnuc_1074 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|145047663|gb|ABP34290.1| protein of unknown function DUF140 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 393

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 92/367 (25%), Positives = 167/367 (45%), Gaps = 8/367 (2%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
           + V+   G W     ++ A  +  +   +  + S   D++ +  +D  G   I+   E  
Sbjct: 34  VNVYTLGGVWTQVRAAQDA-WLHSSSTVNSAAKSLTCDVTKVETLDGAGIAFIIALQEAQ 92

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                   +    E+   L+            P         +    +IG      I DS
Sbjct: 93  TVAGGNFELIGLAERYQPLLKEFDPISNLFPAP----VAKPQRGFVTNIGMGTANLIKDS 148

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 LG + S+      +    +      +      G++ +P++ L++F+ G +++ Q
Sbjct: 149 KGLITFLGHLGSDLVWSVRNLKHVR--WGDFVNAAVEAGINALPIIGLVAFLIGVILSFQ 206

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A  + QFGA  F   L ++  +RE+G L+TA+++AGRS +A  AEIG+M +N E+DA+ 
Sbjct: 207 AAIGMKQFGAVSFVGPLAALGIVREMGPLITAILLAGRSSAAFAAEIGTMTVNSEVDALV 266

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           + GL  +R L+ PR+ A I+  P+LT+ A+  +I  + +     Y IPF  F++   S  
Sbjct: 267 SGGLSPMRFLVVPRVLAGILVAPILTLFADIVSIFASML-TMLIYGIPFINFYNGMLSAV 325

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + ++ +GLIKA      +  V    G   G  + ++G   T  VV SI +++I+D +FA
Sbjct: 326 DVEDVTSGLIKATLFGVVVSAVGCLRGMQTGNGAAAVGISATRAVVSSIVMIVIVDGIFA 385

Query: 366 IFYFAIG 372
              +  G
Sbjct: 386 FISYKTG 392


>gi|73539807|ref|YP_294327.1| hypothetical protein Reut_A0101 [Ralstonia eutropha JMP134]
 gi|72117220|gb|AAZ59483.1| Protein of unknown function DUF140 [Ralstonia eutropha JMP134]
          Length = 357

 Score =  223 bits (568), Expect = 4e-56,   Method: Composition-based stats.
 Identities = 93/368 (25%), Positives = 160/368 (43%), Gaps = 14/368 (3%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKS---IQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
            +  G+W +  ++       M           D A   L+ + ++D IG +L+       
Sbjct: 1   MQLCGDWTALGLAGCHQARAMRSRLHELCQTPDDAHWSLAGVDKLDHIGGQLLWQAW--- 57

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
                  G                 +                 N     G  ++ F   +
Sbjct: 58  ------DGKLPQRLDASEGQRRVFERIADLHADGWRKHIVERFNPITLFGASVLSFCAQA 111

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +   +LG +  +   F       +G    +   +Y +G   + +  L+ F+ G V++  
Sbjct: 112 ANGVSMLGQLTFDLIRFARMPQ--RGPWREISANIYNIGYKALGITALVGFLIGIVLSYL 169

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            A QL  FGA  F ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+R
Sbjct: 170 SANQLRTFGASTFIVNILGMAVIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELDAMR 229

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+     LI PR+ AL + +PLL    +  A+ G  I       I    F        
Sbjct: 230 VMGISHGFRLIMPRVIALAVCMPLLVAWTDVLALAGGIIAARMQLGISPTFFLRALPDAV 289

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            +AN++ GL K       IG+ A   G  +  ++ SLG+  T  VV SI+IVI+ D++FA
Sbjct: 290 PVANLWLGLGKGVAFGILIGLAACHFGLRIKPNTQSLGEGTTASVVVSITIVIVADAIFA 349

Query: 366 IFYFAIGI 373
           + +  +G+
Sbjct: 350 VMFKDVGL 357


>gi|218961389|ref|YP_001741164.1| transporter, putative (modular protein) [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730046|emb|CAO80958.1| transporter, putative (modular protein) [Candidatus Cloacamonas
           acidaminovorans]
          Length = 358

 Score =  222 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 97/364 (26%), Positives = 170/364 (46%), Gaps = 16/364 (4%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           +    G+  +  + E   +V   +     +    +DLS I  +D+ G   +     +   
Sbjct: 9   ILYLEGSLNAETVPETFIEVNSLLKHQSPN---TIDLSNINVLDSAGVAFLDELNTRLSA 65

Query: 68  KIKL--QGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
           +  L  QG +  I+++    S    K    ++                IG  +V    + 
Sbjct: 66  EGILLFQGATPEIQEVIDSFSSLKIKVPAPERK---------MGFFEKIGDSLVLAGQNF 116

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +   +   V            +      S   Q   +G   +P++ L+SF+ G +++ Q
Sbjct: 117 YNVMLLASEVFY--WAVIGIFSRKGQRKGSFTIQCSLLGSQALPILSLLSFIVGFILSLQ 174

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            + QL+ FGA +F  DLM+   +REI  L+TA+++AGRSGSAI +EI +M++ EEIDA++
Sbjct: 175 ASVQLANFGANVFIADLMAFAMVREIAPLITAIIVAGRSGSAIASEIATMQVTEEIDALK 234

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           TM L  VR ++ P+  A+ + +P+L + +   + IG  ++   Y D+    F  R  +  
Sbjct: 235 TMALSPVRYVVVPKFHAITVVMPILVMFSILVSEIGGGLIAIDYLDLSVYTFVQRSINVL 294

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
           TL ++ T   K+   A  I I+    GF V   +  +GK  T+ VV SI  VII D++F+
Sbjct: 295 TLKDLVTSFGKSVIFAWTIVIIGAYCGFQVKGGAEGVGKATTSSVVASIFAVIIWDAIFS 354

Query: 366 IFYF 369
           + Y 
Sbjct: 355 LLYL 358


>gi|330818440|ref|YP_004362145.1| hypothetical protein bgla_1g35860 [Burkholderia gladioli BSR3]
 gi|327370833|gb|AEA62189.1| hypothetical protein bgla_1g35860 [Burkholderia gladioli BSR3]
          Length = 395

 Score =  222 bits (567), Expect = 5e-56,   Method: Composition-based stats.
 Identities = 99/391 (25%), Positives = 180/391 (46%), Gaps = 32/391 (8%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDS---------------------AIV 42
               + R +G W +  ++     VV  ++K  +  +                     +  
Sbjct: 15  GDGKIVRLSGQWTALALARDRGVVVRRVHKLARGPARAGGRMPALGAGSAAAQGGPVSRW 74

Query: 43  DLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSF 102
           DLSAI  +D +G + +       H   +   ++ +   +F  I      + + +   R  
Sbjct: 75  DLSAIDRLDHVGGQALWRVWG--HRLPEGLTLTDNQRTIFERIQRLDEAREEPEPVIR-- 130

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYY 162
                 +    +G  +++F         + G VI + G               +   +Y 
Sbjct: 131 -----HDPVTRLGLALMQFGEHLFGGIAMFGRVILDLGSIARRPKTMP--WTEISANVYN 183

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
            G   +P+  L++F+ G V++   A QL QFGA  + ++++ +  +RE+G +L A+++AG
Sbjct: 184 AGAKALPITALVAFLIGIVLSYLSAQQLQQFGANRYIVNILGLSVIRELGPVLAAILVAG 243

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           RSGSAI A+IG M++ EE+DA+R MG+     ++ PR+ AL +++PLL +  N  A+ G 
Sbjct: 244 RSGSAITAQIGVMRVTEELDAMRVMGIPHGLRIVLPRVLALGVAMPLLVMWTNIVALSGG 303

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
           ++       I    F         +AN++ GL K       I +V    GF +  +S SL
Sbjct: 304 ALAAKLALGIDVNFFIRSLPGVVPIANLWIGLGKGVVFGMLIALVGCHFGFRIKANSQSL 363

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           G+  TT VV SI++VI+ D++FAI +  +G+
Sbjct: 364 GEGTTTSVVTSITVVILADAVFAILFQNVGL 394


>gi|329851286|ref|ZP_08266043.1| hypothetical protein ABI_41270 [Asticcacaulis biprosthecum C19]
 gi|328840132|gb|EGF89704.1| hypothetical protein ABI_41270 [Asticcacaulis biprosthecum C19]
          Length = 363

 Score =  221 bits (564), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 112/365 (30%), Positives = 182/365 (49%), Gaps = 9/365 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  GNW    I  +++ +  A+          VD S I  +DT GA L+   +     +
Sbjct: 2   LRPKGNWIVTRIEGLSERLRQALKSY---QQITVDGSQIEALDTAGAYLLRTAVGD-RLQ 57

Query: 69  IKLQGVSTHIEQLFSLISFTHRKK---IKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
            ++     +  +L+ ++           +        + + F      +GK   +F    
Sbjct: 58  GEVFAGQDNFARLYGIVGNHAAPISNYAQENPEPPKMWLHPFYFGLVKLGKLAERFKTGF 117

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +QA  +G +I+      A     +    +L+  M   G+  +P+V++ SF  GAV+   
Sbjct: 118 IAQAVFMGHIIAQLMISIAKPGSMR--WAALVNVMQRAGIEAIPIVLMTSFFIGAVLGFI 175

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G  QL+QFG+ IF++D++++  LRE   L+TAV++AGRS SA  AE+G+MK+N+EIDA+R
Sbjct: 176 GVLQLNQFGSGIFAVDMVAMFALREFAPLVTAVLLAGRSASAFAAEVGAMKMNQEIDAMR 235

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            MG+D    LI PR+  L++    +T L+    + G  + IW       +VF  R     
Sbjct: 236 VMGIDPYEALILPRLIGLVLMSTFITFLSTLGMMFGGMLAIWSALGAGPSVFLQRVQDYV 295

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
              N F G+++ PF A  I IV   +G  V     SLG++VTT VVQSI +V ++D+LFA
Sbjct: 296 PFYNFFVGIVRPPFFAATIAIVGCWQGMQVKDDVLSLGRQVTTAVVQSIFLVFMLDALFA 355

Query: 366 IFYFA 370
           I +  
Sbjct: 356 ILFNG 360


>gi|257092687|ref|YP_003166328.1| hypothetical protein CAP2UW1_1065 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
 gi|257045211|gb|ACV34399.1| protein of unknown function DUF140 [Candidatus Accumulibacter
           phosphatis clade IIA str. UW-1]
          Length = 370

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 97/367 (26%), Positives = 172/367 (46%), Gaps = 13/367 (3%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              + AG+W    + +        + + + S  A  DL +I  +D+  A ++     +  
Sbjct: 15  LQVQLAGDWTLATLPQPISRFEARL-RELASREAAWDLLSIARLDSAAAVVLWRSWGRRW 73

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                  +S     L   +             +  +            G+  +  +++  
Sbjct: 74  PASLA--LSGEHRLLLERVEAIPADLPARPSERLGWLLVP--------GRLALAAVDNLA 123

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
               ++G ++ + G  CA               +Y  G   +PV  LI F+ G V++   
Sbjct: 124 GMVALVGQMVLDVGHLCAHPRDIP--WREFSANLYKSGAQALPVTALIGFLIGIVLSYLS 181

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A QL  FGA++F ++L+ I  +RE+G +L AV++AGRSGSA+ A++G M++ EEIDA+ T
Sbjct: 182 ALQLKTFGADVFIVNLLGISIVRELGPVLVAVLVAGRSGSAMTAQLGVMRVTEEIDALAT 241

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG+     L+ P+I AL +++PLL +  + + I+G  I      D+ +  F         
Sbjct: 242 MGVSRSLRLVLPKIIALAVAMPLLVVWCSAAGIVGGMIAARLQMDLSYGFFIDTLPRVVP 301

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           +AN++ G+ K       IG+VA   G  V  ++ SL  + TT VV SI++ I++D++FAI
Sbjct: 302 VANLWIGMSKGLVFGMLIGLVACHFGLRVKPNTESLSSQTTTSVVTSITVAILVDAVFAI 361

Query: 367 FYFAIGI 373
              + GI
Sbjct: 362 MTRSFGI 368


>gi|325527206|gb|EGD04595.1| putative ABC transporter permease [Burkholderia sp. TJI49]
          Length = 351

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 97/361 (26%), Positives = 166/361 (45%), Gaps = 11/361 (3%)

Query: 13  GNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQ 72
           G W +  ++     VV           +  DLS I  +D +G + +     +        
Sbjct: 1   GQWTALALARNRGAVVRRAESVATGRVSEWDLSGIGRLDHVGGQALWRVWGRKLPAGIAL 60

Query: 73  GVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHIL 132
             +       ++     R   + + P+R    +    L    G  +  F         + 
Sbjct: 61  TATQ-----RTIFERIERLDSQREAPERIVRVDPVTRL----GLMLFAFAEHLQGGIAMF 111

Query: 133 GLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQ 192
           G VI +                     +Y  G   +P+  L++F+ G V++   A QL  
Sbjct: 112 GRVILDALSVLRRPQTMP--WKETSANIYSAGTQALPITALVAFLIGIVLSYLSAQQLQM 169

Query: 193 FGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFV 252
           FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+R MG+   
Sbjct: 170 FGANRYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAMRVMGIPHG 229

Query: 253 RILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFT 312
             LI PR+ AL I++PLL +  N  A+ G ++       I    F         +AN++ 
Sbjct: 230 LRLILPRVLALGIAMPLLVMWTNIIALTGGALAAKLVLGIDVNYFVRSLPGVVPIANLYI 289

Query: 313 GLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           G+ K       I +VA   GF +  +S SLG+  TT VV SI++VI+ D++FAI +  +G
Sbjct: 290 GIGKGVVFGMLIALVACHFGFRIKANSQSLGEGTTTSVVTSITVVILADAVFAILFQNVG 349

Query: 373 I 373
           +
Sbjct: 350 L 350


>gi|209521691|ref|ZP_03270381.1| protein of unknown function DUF140 [Burkholderia sp. H160]
 gi|209497882|gb|EDZ98047.1| protein of unknown function DUF140 [Burkholderia sp. H160]
          Length = 388

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 96/369 (26%), Positives = 175/369 (47%), Gaps = 14/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           + R +G W +  ++   +    + +    +        DLS +  +D +G + +     +
Sbjct: 31  IVRLSGQWTALALARDRETGHVIPLLRALTGAQGIGEWDLSGVDRMDHVGGQALWRVWGR 90

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                    ++     +F  I+     +   +         S  +    +G  I  F++ 
Sbjct: 91  KMPPG--TALTDTQRDIFERIALLDTVRESAEPV-------SRIDPFTRLGLGIFSFLDH 141

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 +LG V+ +                 +   +Y  G   +P+  L++F+ G V++ 
Sbjct: 142 MQGGVTMLGRVVLDLLAIARKPKLTP--WTEISANIYNAGARALPITALVAFLIGIVLSY 199

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FGA  F ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+
Sbjct: 200 LSAQQLRIFGANQFIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAM 259

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R MG+     LI PR+ AL +++PLL +  N  ++ G ++       I  + F  +  S 
Sbjct: 260 RVMGIPHGLRLILPRVVALAVAMPLLVMWTNVISLTGGALAAKLVLGIEMSFFARQLPSV 319

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +AN++ GL K       I I     GF +  +S SLG+  TT VV SI+IVI+ D++F
Sbjct: 320 VPIANLWIGLGKGAVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAVF 379

Query: 365 AIFYFAIGI 373
           AI +  +G+
Sbjct: 380 AILFQNVGL 388


>gi|85860995|ref|YP_463197.1| ABC transporter permease [Syntrophus aciditrophicus SB]
 gi|85724086|gb|ABC79029.1| ABC transporter permease protein [Syntrophus aciditrophicus SB]
          Length = 381

 Score =  221 bits (562), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 78/369 (21%), Positives = 160/369 (43%), Gaps = 6/369 (1%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
              V R +G+W +      A+++  A+++ I +   I D+  +   D+     +    + 
Sbjct: 19  DALVLRLSGDWMANGRLPDAEEIRQALSQQIPAPRIIFDVVGLGAWDSGLLIFLAKVFDI 78

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
             G       S     +  L+          ++        S  +    +    + F   
Sbjct: 79  CRGNGISVDSSGLPPGVCRLLELAS----PEKQRSGVTREKSPPSFLVRVADATLDFGRG 134

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  +G    +          F+     LI  +   G   +P+V LIS + G ++A 
Sbjct: 135 FKDMLAFVGDATLSVLRMLRGKPGFRR--SDLILILQETGAQALPIVSLISLLVGMILAF 192

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FG +I+  D++ I  +R +G ++T +++AGR+G+A  A++G M++NEEIDA+
Sbjct: 193 VAAIQLRMFGVQIYVADVVGIAMVRVMGAIMTGIIMAGRTGAAFAAQLGMMQVNEEIDAL 252

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             +G+  V  L+ PR+ AL++ +PLL I ++   ++G  IV     D+    ++    + 
Sbjct: 253 EVLGVSPVDFLVLPRLLALMLMMPLLCIYSDLMGVVGGLIVGVGMLDLGVIEYYHETVNA 312

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +L   + GL  +      + +     G     +++++G   T+ VV  I  +++  ++ 
Sbjct: 313 VSLTYFWIGLFHSFVFGVLVALAGCLRGLQCERNASAVGFAATSAVVTGIVSIVVATAII 372

Query: 365 AIFYFAIGI 373
            +    +GI
Sbjct: 373 TLLCQVLGI 381


>gi|114328116|ref|YP_745273.1| ABC transporter permease [Granulibacter bethesdensis CGDNIH1]
 gi|114316290|gb|ABI62350.1| ABC transporter permease protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 392

 Score =  220 bits (561), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 88/372 (23%), Positives = 166/372 (44%), Gaps = 10/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           SE  +     +G W           +       + ++  ++D+SA+   D+     +   
Sbjct: 31  SEGMVATLSLSGEWTVASGGLNTRPINAF---PVGTERLLIDVSALQRWDSALISFLWSL 87

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            ++ +        ST       L++        +       F          IG   +  
Sbjct: 88  EQRCNTSGITLDNSTLPHSARGLLALLPEHPHPSAPAPAKHFAP-----VQAIGASTLSM 142

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           + +  +   +    +   G      +  +     L+R +   G S + +V +++F+ G++
Sbjct: 143 LTECGTVTELGVETLRGAGATLFGGHGMR--WRDLLRDISDAGPSALLIVGIVNFLMGSI 200

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA QL +F A+I+  +L+ +  +RE+  ++TA+++AGR+G A  A I +M  NEEI
Sbjct: 201 LAFVGAVQLRKFAADIYVANLVGLASVREMSAVMTAIIMAGRTGGAYAARIATMTGNEEI 260

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R  G+   R L+ P I AL++++P+L + A   +++G  IV     D+  A F++  
Sbjct: 261 DALRVFGIPVSRYLLLPSIAALVLTMPILYLYACLISLVGGYIVSQGMLDVTMAGFWNHL 320

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
             +  +     G +K    A  IG+V+ + G   G  +  +G   T  VV  I  VI +D
Sbjct: 321 FGSVHIDQFVFGFVKTITFAMLIGLVSCRIGLKAGRSAADVGVAATRAVVSGIVGVIALD 380

Query: 362 SLFAIFYFAIGI 373
           S+FA+    IGI
Sbjct: 381 SMFAVLATIIGI 392


>gi|78357028|ref|YP_388477.1| ABC transporter permease [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219433|gb|ABB38782.1| ABC transporter permease protein [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 373

 Score =  219 bits (558), Expect = 6e-55,   Method: Composition-based stats.
 Identities = 90/369 (24%), Positives = 164/369 (44%), Gaps = 7/369 (1%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           G  V  F G W   +       + + +    +  +     + +T  D+         +E 
Sbjct: 12  GRCVIVFQGRWTLHDTVPSVGKLALRLESDCRGGAVSFSCAGLTAWDSRFLTFCRSVLET 71

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
             G+      S   + +  L+S   +        +     +    L   +G+ +      
Sbjct: 72  LEGRGIAYDTSGLPDGVLRLLSLAAQV-----PEREGAAVSRKSPLSARMGEALHAAFAG 126

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
           + S    +G V  +    C     F+         + + G   +P+V LIS + G + A 
Sbjct: 127 TISVMEFIGDVTLSVLRMCIGRAVFR--WSDTFALLRFCGAQSLPIVSLISMLAGLIFAF 184

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            GA QL  FGAEI+   L+ I  LR +G ++TA++++GR G+A  AE+G+M++NEEIDA 
Sbjct: 185 VGAVQLKMFGAEIYVASLVGIAMLRVMGAVMTAIIVSGRVGAAFAAELGTMQVNEEIDAF 244

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            T G+  +  L+ PR+ AL++ +PLL + AN   I+G + V W   DI    +F+    T
Sbjct: 245 STFGISPLDFLVLPRMLALVLMMPLLCVYANLMGIVGGAAVGWLMLDINLHQYFNMTWQT 304

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +L +   G+  +      + + +   G   G  ++++GK  T+ VV SI  +++  ++ 
Sbjct: 305 VSLTHFGVGIAHSVVFGFVVAVCSCYMGIHCGRSASAVGKATTSAVVSSIVSIVVATAVI 364

Query: 365 AIFYFAIGI 373
                 +GI
Sbjct: 365 TFLCNILGI 373


>gi|327399071|ref|YP_004339940.1| hypothetical protein Hipma_0911 [Hippea maritima DSM 10411]
 gi|327181700|gb|AEA33881.1| protein of unknown function DUF140 [Hippea maritima DSM 10411]
          Length = 349

 Score =  218 bits (556), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 107/365 (29%), Positives = 184/365 (50%), Gaps = 25/365 (6%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G      +S++   +            AI+D+   +++DT     +     K    
Sbjct: 10  LLVSGELTFNNLSKLITKINE-------CKPAIIDVRGASKLDTSSLVYLASLNIKLLLN 62

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
              Q          SL++   +   + +K + S      +   Y +G   V+ + +    
Sbjct: 63  KNDQ----------SLLNIVLQHIPEKKKKKDS------RGFLYSLGYAFVERLKELYVF 106

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              LG V      F  +  +F+  L S ++ +  +G + +P++  ISF+ GAVIA  G+ 
Sbjct: 107 MSFLGEVFVGFIGFILNPKRFR--LKSTLKDVELMGFNAIPILTTISFLIGAVIAYHGSV 164

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
           +L QFGA IF +DL+SI  LRE+G L+ A+++AGRS S+  A+IG MK+ EE+D I+TMG
Sbjct: 165 RLKQFGANIFVVDLVSISVLRELGPLIVAILLAGRSSSSYTAQIGIMKVTEEVDVIKTMG 224

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           ++   IL+ P+I ++++ +PLL +LA+   ++G  +V     +I    F  R H    + 
Sbjct: 225 VNPYDILVFPKIVSMLVCVPLLIVLADVMGVLGGMVVAHLSLNITVRDFILRLHQAIGIK 284

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
              +G++KAP  A  I  +   +GF    +  S+GK VT  VV SI  VII D++F++ +
Sbjct: 285 TFVSGILKAPAFAFLIATIGAFKGFQTKKNVESIGKSVTVSVVDSIFGVIIADAIFSVLF 344

Query: 369 FAIGI 373
             +GI
Sbjct: 345 RWMGI 349


>gi|293602529|ref|ZP_06684975.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Achromobacter piechaudii ATCC 43553]
 gi|292819291|gb|EFF78326.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Achromobacter piechaudii ATCC 43553]
          Length = 383

 Score =  218 bits (556), Expect = 9e-55,   Method: Composition-based stats.
 Identities = 96/370 (25%), Positives = 176/370 (47%), Gaps = 11/370 (2%)

Query: 5   GITVFRFAGNWKSPEISEIAD-DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
              V   AG+W    +++  + +   A            DL  I+ +DTIGA LI     
Sbjct: 24  DGKVCHVAGDWSVLALAQAGEVERRRAAMAQAAEQGMRWDLHGISRLDTIGALLIWQAWG 83

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +     +    S   + +F+ ++    +         +F           +G  I++   
Sbjct: 84  EKLP--ERVRWSAGQQDVFNALAMNKGEVQTAPPKPETF------GWVRGLGGAILQAAE 135

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
           +  +   +LG ++ + G          G    +  Q+Y  G   + +  L+ F+ G V++
Sbjct: 136 NGRALLIMLGQLMLDLGGMLRRPR--LGPWREISAQVYRTGAQALGITALVGFLIGVVLS 193

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL   GA+ F + L+ +  +RE+G +L A+++AGRSGSAI A+IG M++ +E+DA
Sbjct: 194 YLSAQQLQMIGADRFIVRLLGVSIVRELGPVLAAILVAGRSGSAITAQIGVMRVTQELDA 253

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MG+   + LI PR+ AL +++PLL +  +  AI+G  +       +    F +    
Sbjct: 254 MLVMGISHGQRLILPRVVALAVTMPLLVLWTDAMAILGGMLAAQMQLGVSAQWFLTSLPD 313

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +L N + G+ K       I ++A   G  +  ++ SLG+  TT VV SI+ VI++D+L
Sbjct: 314 AISLTNYWIGIFKGVTFGILIALIACHFGLRIQPNTESLGRGTTTSVVTSITGVILLDAL 373

Query: 364 FAIFYFAIGI 373
           +AI + ++G+
Sbjct: 374 YAIIFSSVGV 383


>gi|91792032|ref|YP_561683.1| hypothetical protein Sden_0670 [Shewanella denitrificans OS217]
 gi|91714034|gb|ABE53960.1| protein of unknown function DUF140 [Shewanella denitrificans OS217]
          Length = 369

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 98/370 (26%), Positives = 173/370 (46%), Gaps = 18/370 (4%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIM---YFME 63
                 G+W+    +  AD +  AI     S S I+D  A+   D+  A  ++    + E
Sbjct: 15  CHIALRGDWQLGH-ALDADSICAAIPSQ--SRSVIIDTQALGLWDSSLAVALLQLSRWCE 71

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +    + L      ++QL  L +       + Q   +       +      G+ +     
Sbjct: 72  QAELPLSLDACPPSLQQLLKLATEVP--SNQTQSQAQLSLKQKLRANLTEQGQGVYD--- 126

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                   LG  +     +     K +     +I  +   G  G+ +V LIS + G ++A
Sbjct: 127 ----SLLFLGNSVLAISHWLRGKAKTRA--SDIIFFIEQAGPQGLAIVTLISLLVGMILA 180

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G+ QL Q GA+++  DL++I  +RE+G L+TAV++AGR+G+A  A++G+M+ NEE+DA
Sbjct: 181 YLGSVQLRQLGAQVYVADLVAIGMVREMGPLMTAVIMAGRTGAAYAAQLGTMQANEEVDA 240

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +  MG+  +  L+ PR+ AL+  +PL+ I ++   IIG  IV      +    +  +   
Sbjct: 241 LSVMGISAMEFLVVPRLVALVFIMPLMCIYSDAIGIIGGGIVANGMG-VSATQYLLQAQV 299

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                +I TGL+K+      I I   + G A G +SN++G   T  VV++I  +++ D+ 
Sbjct: 300 AVDWLDITTGLVKSLIFGILIAIAGCQAGLACGRNSNAVGVATTKAVVKAIVFLVVSDAA 359

Query: 364 FAIFYFAIGI 373
             I Y  +GI
Sbjct: 360 LNILYDKLGI 369


>gi|74316265|ref|YP_314005.1| ABC transporter permease [Thiobacillus denitrificans ATCC 25259]
 gi|74055760|gb|AAZ96200.1| ABC transport system permease protein [Thiobacillus denitrificans
           ATCC 25259]
          Length = 364

 Score =  217 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 92/343 (26%), Positives = 168/343 (48%), Gaps = 7/343 (2%)

Query: 31  INKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHR 90
           +         ++D + +T +DT GA L++   +          +     +  S++    +
Sbjct: 29  LPDLSGKRVRVIDGAGVTHLDTNGAWLLLAAAQP-KADAPAPDLRDFQPRHLSMLRLVAQ 87

Query: 91  KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK 150
            +               + +    G+  +   +        +G +             ++
Sbjct: 88  HRAATPP----LPAPRQEGVLALTGRGALTVWSHLVGLLDFVGRLALELAGLVGQPGLWR 143

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
                L  Q+  V V  +P+V  + F+ G V A     Q  QFGA IF +D + +  LRE
Sbjct: 144 --WRELAAQVRDVFVGAIPIVSGMMFLLGVVFAYLLGDQARQFGANIFVVDGLLLAVLRE 201

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           I  ++ AV++AGR+G+AI A++G+MK+ EEIDAI T+GL  + +L+ PR+ ALI+++PLL
Sbjct: 202 ISPVIVAVLVAGRTGAAITAQLGTMKVAEEIDAIATLGLSPLAVLVIPRVLALIVAMPLL 261

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
             + + + ++G  +V+ +   I   +F  R +    L  +  GL KAP  A  I +++ +
Sbjct: 262 VFIGDIAGLVGGMLVVQQQLAISPPIFLDRLYDVILLKTLMVGLGKAPVFALFIALISCR 321

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            G AV   + S+G   T+ VVQS+  VII++++FA+ +  +GI
Sbjct: 322 MGLAVSRDARSVGVNTTSTVVQSLVAVIILNAVFAVAFVRLGI 364


>gi|119897982|ref|YP_933195.1| hypothetical protein azo1691 [Azoarcus sp. BH72]
 gi|119670395|emb|CAL94308.1| conserved hypothetical membrane protein [Azoarcus sp. BH72]
          Length = 365

 Score =  217 bits (554), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 99/366 (27%), Positives = 168/366 (45%), Gaps = 12/366 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V   +G+W    +S     V  A+        A    + +  +D+ GA L+     +   
Sbjct: 10  VCELSGDWTLRALSPHIAGVRAALAAVPAD--AAWSCAGVLRLDSFGAALLWQAWGRNW- 66

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
                     IE   +L     R     + P       +       +G  +V F      
Sbjct: 67  -------PATIEISAALREVVARVAAAAEHPPAPPRPFTTTEAITLLGAGLVGFRRHLAD 119

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG ++ +         ++      +   +Y V V  +PV  L+ F+ G V++   A
Sbjct: 120 LTVLLGQLVLDVVHLLRHPREWPVL--EISANLYKVAVRAMPVTALVGFLIGVVLSYLSA 177

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA+IF ++++ +  +RE+G +L +V++AGRSGSA+ A++G M++ EEIDA+  M
Sbjct: 178 LQLRAFGADIFIVNILGLGIIRELGPVLVSVLVAGRSGSAMTAQLGVMRVTEEIDALAAM 237

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G+     L+ P++ AL +++PLL +  +  A+ G  +  W    + F  F         L
Sbjct: 238 GISASLRLVLPKVLALTLAMPLLVLWTSAVALFGGMVSAWMELGMSFGFFLETLPRVVPL 297

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           AN+F GL K       I +VA   G  V  ++ SL    T  VV +I++VI++D+LFAI 
Sbjct: 298 ANVFVGLTKGLVFGLLISLVACHFGLRVKPNTESLSANTTASVVTAITVVILVDALFAIA 357

Query: 368 YFAIGI 373
              IG+
Sbjct: 358 TRRIGV 363


>gi|94987489|ref|YP_595422.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Lawsonia intracellularis
           PHE/MN1-00]
 gi|94731738|emb|CAJ55101.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 386

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 86/368 (23%), Positives = 155/368 (42%), Gaps = 7/368 (1%)

Query: 6   ITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
                F+GNW+  +    A      +N         +  +++   D+     I   + K 
Sbjct: 26  TLEISFSGNWQLNQPIPDATRFASQLN-YPVVKELYLKTNSLGIWDSSLIAFIKTLINKA 84

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +            + +LI    +        + +    +  +   +IG   +   +  
Sbjct: 85  QSQQITINDHELPAGIKNLIQLAFQ----TPPNKEAHKKTTQISFLEYIGDITLSLPSTI 140

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 LG +  +T               ++ R M   GV  +P+V LIS + G ++A  
Sbjct: 141 QKILTFLGEMTLSTKRLITGHSD--CSSTNIWRCMQQAGVEALPIVSLISLLVGLILAFV 198

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
           G  QL  FGAEI+   L++I   R +G ++T V+++GR+G++  A IG+M +NEEIDA+ 
Sbjct: 199 GVIQLRMFGAEIYVSSLVAIGMTRIMGAVMTGVILSGRTGASYAATIGTMNVNEEIDALM 258

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T G+     L+ PR+ AL    PLL + ++F  ++G  IV      I    + +      
Sbjct: 259 TFGIRPSDFLVMPRLIALTTMTPLLVVYSDFMGMLGGFIVGVGVLGIEPLEYINFTQKGF 318

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            L N++ G+I        I I    +G   G +++++G   T+ VV SI  ++I  +   
Sbjct: 319 ALKNLWVGIIHGIAFGIIIAITGCYQGLNSGKNASAVGLATTSAVVYSIVGIVIATACLT 378

Query: 366 IFYFAIGI 373
           I +    I
Sbjct: 379 IIFNIFNI 386


>gi|114563133|ref|YP_750646.1| hypothetical protein Sfri_1962 [Shewanella frigidimarina NCIMB 400]
 gi|114334426|gb|ABI71808.1| protein of unknown function DUF140 [Shewanella frigidimarina NCIMB
           400]
          Length = 370

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 88/370 (23%), Positives = 174/370 (47%), Gaps = 11/370 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +   +   AG+W+  + + +  D+   +  + QS + I   + ++  D+  A  ++    
Sbjct: 12  DDNCLLNLAGDWQLGQ-APLGADICAELPSNCQSITLI--TTELSHWDSSLAIALLQLSR 68

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
               + +   + T                +   +P       +   L   + + ++K   
Sbjct: 69  --WCEQQKISLDTQQTPQGLQQLLQLATDVPVYQPTND---GAIGGLWPTLRRSLIKQGL 123

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                   +G      G +     + +     +I  +   G  G+ +V LIS + G ++A
Sbjct: 124 QVHDGLVFVGDCTLVLGRWLGGKARTRR--SDIIFFIEQAGPKGLAIVTLISLLVGMILA 181

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G+ QL Q GA+++  +L++I  +RE+G L+T V++AGR+G+A  A++G+M++NEEIDA
Sbjct: 182 YLGSVQLRQLGAQVYVANLVAIGMVREMGALMTGVIMAGRTGAAYAAQLGTMQVNEEIDA 241

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+  +  L+ PR+ ALI  +PL+ I ++   ++G ++V      + +  +  +   
Sbjct: 242 LRVMGIPTMEFLVLPRLLALIFIMPLMCIYSDVIGMLGGALVANGMG-VSYTQYILQTQV 300

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                +I TGLIK+      I I   + G   G  SN++G   T  VV++I  +++ D+ 
Sbjct: 301 AIDWVDISTGLIKSLIFGFLIAIAGCQAGLLCGRDSNAVGLATTHAVVKAIVFLVVADAA 360

Query: 364 FAIFYFAIGI 373
             I Y  +GI
Sbjct: 361 LNILYDKLGI 370


>gi|148264681|ref|YP_001231387.1| hypothetical protein Gura_2637 [Geobacter uraniireducens Rf4]
 gi|146398181|gb|ABQ26814.1| protein of unknown function DUF140 [Geobacter uraniireducens Rf4]
          Length = 401

 Score =  217 bits (552), Expect = 3e-54,   Method: Composition-based stats.
 Identities = 74/372 (19%), Positives = 158/372 (42%), Gaps = 12/372 (3%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF--- 61
              +   AG+W+        D V+  +  + +      +   +   D+     +      
Sbjct: 39  DGALLTLAGDWRLGSAIPSPDGVIAGLGAAEKGQRLAFETGNLQGWDSGLLVFLAKLFDI 98

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
             +    +   G+   + +L  L S   ++       +         +    +    +  
Sbjct: 99  CRRNGISVDESGLPAGVRKLIDLASPEKQRSGVTHGGEHP-------SFLVWVADTALAQ 151

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +  +      +G       +       F+     LI  +   G   +P+V LIS + G +
Sbjct: 152 VKGAKEVLAFIGEATLAFVKMLRGKADFRRM--DLIVTIQETGAQALPIVTLISLLVGMI 209

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A   + QL  FGA+I+  D++ I  +R +G ++T ++++GR+G+A  A++G+M++NEEI
Sbjct: 210 LAFIASIQLKMFGAQIYVADVVGIGIVRVMGAIMTGIIMSGRTGAAFAAQLGTMQVNEEI 269

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ T+G   V  L+ PR+ AL++ +PLL + ++   ++G  IV     D+ F  +  + 
Sbjct: 270 DALETLGFSPVEFLVLPRMLALMLMMPLLCVYSDLMGVLGGMIVGVGMLDLGFMEYVHQS 329

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
            S   L +   GL  +      + +     G      ++++G   T+ VV  I  +++  
Sbjct: 330 RSALNLTHFLVGLFHSFVFGILVAVAGCLRGLQCERSASAVGYAATSAVVTGIVCIVVAT 389

Query: 362 SLFAIFYFAIGI 373
           ++  +    +GI
Sbjct: 390 AIITLSCQVLGI 401


>gi|189426230|ref|YP_001953407.1| hypothetical protein Glov_3181 [Geobacter lovleyi SZ]
 gi|189422489|gb|ACD96887.1| protein of unknown function DUF140 [Geobacter lovleyi SZ]
          Length = 261

 Score =  216 bits (551), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 71/265 (26%), Positives = 135/265 (50%), Gaps = 7/265 (2%)

Query: 105 NSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVG 164
               N    IG++ +  + +       LG           S  +  G  + +++Q+ ++G
Sbjct: 4   RQMTNFLRAIGRRTIAQVQE-------LGNCGQFLVYALYSILRRPGRPVHILKQVSFIG 56

Query: 165 VSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRS 224
              + V++L +  TG V+  QG + L++FG+E      +++  +RE+G +L+A+M+ GR+
Sbjct: 57  AKSLFVIVLTAAFTGMVLGLQGYYTLTKFGSEGMLGTAVALSLIRELGPVLSALMVTGRA 116

Query: 225 GSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASI 284
           GSAI AEIG M+I+E+IDA+ TM LD  + LISP+  A +IS+PLL  + +   I G  +
Sbjct: 117 GSAITAEIGIMRISEQIDALETMALDPYKYLISPKFIAAMISMPLLCAIFDVVGIYGGWM 176

Query: 285 VIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
           V  K   +    +FS  + +    ++++G +K+      I  +   +G+  G  +  + +
Sbjct: 177 VGVKLLGVNPGAYFSEMYKSVEWKDVYSGFVKSYSFGIIIAWIGCYKGYYAGHGAEGVSR 236

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYF 369
             T  VV +  ++++ D        
Sbjct: 237 ATTESVVLTSVLILVWDYFLTSILL 261


>gi|295675321|ref|YP_003603845.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1002]
 gi|295435164|gb|ADG14334.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1002]
          Length = 389

 Score =  216 bits (549), Expect = 6e-54,   Method: Composition-based stats.
 Identities = 96/369 (26%), Positives = 173/369 (46%), Gaps = 14/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           + R +G W +  ++   D    +    + +        DLS +  +D +G + +     +
Sbjct: 31  IVRLSGQWTALALARDRDTGHVIPQLRSLTGAQGIGGWDLSRVDSMDHVGGQALWRVWGR 90

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                    ++     +F  I+     +   +   R        +    +G  I  F+  
Sbjct: 91  KLPPG--TALTDTQRDIFERIALLDTVRESAEPVTR-------FDPFTRLGLGIFSFVEH 141

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 +LG V+ +                 +   +Y  G   +P+  L++F+ G V++ 
Sbjct: 142 MQGGVAMLGRVVLDLLAILRKPKLTP--WTEISANIYNAGARALPITALVAFLIGIVLSY 199

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FGA  F ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA+
Sbjct: 200 LSAQQLRIFGANQFIVNILGLAVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDAM 259

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R MG+     LI PR+ AL +++PLL +  N  ++ G ++       I  + F  +    
Sbjct: 260 RVMGIPHGLRLILPRVIALAVAMPLLVMWTNVISLTGGALAAKLVLGIDMSFFARQLPVV 319

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +AN++ GL K       I I     GF +  +S SLG+  TT VV SI+IVI+ D++F
Sbjct: 320 VPIANLWIGLGKGAVFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAVF 379

Query: 365 AIFYFAIGI 373
           AI +  +G+
Sbjct: 380 AILFQNVGL 388


>gi|294084216|ref|YP_003550974.1| organic solvents resistance ABC transporter [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663789|gb|ADE38890.1| ABC-type transport system involved in resistance to organic
           solvents [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 258

 Score =  216 bits (549), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 66/254 (25%), Positives = 123/254 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +        +    LG +   T      ++    +   L RQ   +G   +PVV L +  
Sbjct: 5   VRNIGRAVLNFLASLGRITLFTLAAIRWTFFPPYYWQQLWRQTLDIGYYSLPVVGLTTLF 64

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           +G V+A Q     ++F AE     ++ +   RE+G +L  +M+AGR G+++ AEIG+M++
Sbjct: 65  SGMVLALQSYTGFARFSAEDTVATVVVLSVTRELGPVLAGLMVAGRIGASMAAEIGTMRV 124

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            ++IDA+ T+    ++ L++PRI A  + LP L ++ +   + G  IV         +++
Sbjct: 125 TDQIDALDTLSTRPMQYLVAPRIMAGTLCLPFLVLIGDIIGVFGGYIVGVYRLGFNPSIY 184

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            SR      +++I  GL+KA      I ++    G+  G  +  +G+  T  VV S  ++
Sbjct: 185 LSRTLEYLEVSDITLGLVKAAVFGFLIALMGCYHGYHSGRGAEGVGRATTNAVVSSSILI 244

Query: 358 IIIDSLFAIFYFAI 371
           +I + L    YF +
Sbjct: 245 LIANYLVTALYFGV 258


>gi|170691590|ref|ZP_02882755.1| protein of unknown function DUF140 [Burkholderia graminis C4D1M]
 gi|170143795|gb|EDT11958.1| protein of unknown function DUF140 [Burkholderia graminis C4D1M]
          Length = 389

 Score =  215 bits (548), Expect = 8e-54,   Method: Composition-based stats.
 Identities = 95/370 (25%), Positives = 168/370 (45%), Gaps = 16/370 (4%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME- 63
           + R +G W +  ++        +    +          DLS I  +D +G + +      
Sbjct: 31  IVRLSGQWTALALARDRATGHVIPQLRSLEGAEGIGQWDLSRIDRMDHVGGQALWRVWGH 90

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +     +L      I +  +L+           +           +    +G  I  F  
Sbjct: 91  RMPPDTELTDTQRDIFERIALLDTVRETAEPVIRF----------DPFTRLGLAIFSFFE 140

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG V+ +                 +   +Y  G   +P+  L++F+ G V++
Sbjct: 141 HLYGGVAMLGRVVLDLLAIARKPAITP--WTEISANIYNAGTKALPITALVAFLIGIVLS 198

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 199 YLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDA 258

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL +  +  A+ G ++       I  + F      
Sbjct: 259 MRVMGIPHGLRLILPRVIALGVAMPLLVMWTDIIALTGGAVAAKIVLGIDMSYFARALPG 318

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I I     GF +  +S SLG+  TT VV SI+IVI+ D++
Sbjct: 319 VVPVANLWIGLGKGVAFGMLIAIAGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAV 378

Query: 364 FAIFYFAIGI 373
           FAI +  +G+
Sbjct: 379 FAILFQNVGL 388


>gi|205355658|ref|ZP_03222428.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|205346435|gb|EDZ33068.1| putative ABC transport system permease protein [Campylobacter
           jejuni subsp. jejuni CG8421]
          Length = 337

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 100/332 (30%), Positives = 164/332 (49%), Gaps = 13/332 (3%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF---MEK 64
                G W    I ++     +A+   IQS   I D   +  IDT G    +     ++ 
Sbjct: 11  TLFIFGIWDKTSIYKLKIKDFLAL---IQSKEVIFDFKDLKAIDTAGVRFFLALENDLKD 67

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
            + KI  +G+++  + LF L    +++  K +K  ++     F      +GK  ++ +  
Sbjct: 68  KNIKIAKEGLNSRFQTLFELCEKNYQRLSKTKKSHKN-----FSEYFIDLGKLSLELLKI 122

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                +  G   ++      +   F+   ++ +  +       +P+VIL + + G V+A 
Sbjct: 123 LRKFINFTGAFFTSLFLCLKNPKNFR--FIAFLYHIENSAFKALPIVILTALLVGVVLAY 180

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A+QL+QFGA IF +DLM I   RE+  L+ A++IAGRS S+  A+IG MKI +EI A+
Sbjct: 181 QAAYQLAQFGANIFIVDLMGISATRELAPLIAAIVIAGRSASSYTAQIGVMKITDEIAAM 240

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG      +I PR+ AL+I++PL+  +++  +IIG  +V     DI FA F   F   
Sbjct: 241 NTMGFRSFEFIIIPRVMALVIAMPLIVAISDAISIIGGMMVAKLNLDISFAEFLRHFREA 300

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVG 336
             + +IF GL KAP     IG++A   GF V 
Sbjct: 301 VDIKHIFIGLAKAPIFGFLIGLIACFRGFEVK 332


>gi|307728301|ref|YP_003905525.1| hypothetical protein BC1003_0230 [Burkholderia sp. CCGE1003]
 gi|307582836|gb|ADN56234.1| protein of unknown function DUF140 [Burkholderia sp. CCGE1003]
          Length = 389

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 97/370 (26%), Positives = 169/370 (45%), Gaps = 16/370 (4%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME- 63
           + R +G W +  ++        +    +          DLS I  +D +G + +      
Sbjct: 31  IVRLSGQWTALALARDRATGHVIPQLRSLEGAEGIGQWDLSRIDRMDHVGGQALWRVWGH 90

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           +     +L      I +  +L+           +           +    +G  I  F  
Sbjct: 91  RMPPDTELTATQRDIFERIALLDTVRETAEPVVRF----------DPLTRLGLGIFSFFE 140

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG V+ +                 +   +Y  G   +P+  L++F+ G V++
Sbjct: 141 HLYGGVAMLGRVVLDLLAIARKPAITP--WTEISANIYNAGTRALPITALVAFLIGIVLS 198

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 199 YLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDA 258

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I  + F      
Sbjct: 259 MRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIALTGGAVAAKIVLGIDMSYFARALPG 318

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I IV    GF +  +S SLG+  TT VV SI+IVI+ D++
Sbjct: 319 VVPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAV 378

Query: 364 FAIFYFAIGI 373
           FAI +  +G+
Sbjct: 379 FAILFQNVGL 388


>gi|296160361|ref|ZP_06843178.1| protein of unknown function DUF140 [Burkholderia sp. Ch1-1]
 gi|295889342|gb|EFG69143.1| protein of unknown function DUF140 [Burkholderia sp. Ch1-1]
          Length = 377

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/370 (26%), Positives = 170/370 (45%), Gaps = 16/370 (4%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME- 63
           + R +G W +  ++        + + ++          DLS I  +D +G + +      
Sbjct: 19  IVRLSGQWTALALARDRATGHVIPLLLSLVGAEGIGGWDLSRIDRMDHVGGQALWRVWGH 78

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K      L      I +  +L+           K           +    +G  I  F  
Sbjct: 79  KMPADTTLTDTQRDIFERIALLDTVRETAEPVIK----------LDPFTRLGLAIFSFFE 128

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG V+ +                 +   +Y  G   +P+  L++F+ G V++
Sbjct: 129 HLYGGVAMLGRVVLDLLAIARKPKITP--WTEISANVYNAGTQALPITALVAFLIGIVLS 186

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 187 YLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDA 246

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I  + F      
Sbjct: 247 MRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAAKIVLGIDMSYFARALPG 306

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I IV    GF +  +S SLG+  TT VV SI+IVI+ D++
Sbjct: 307 VVPVANLWIGLGKGVVFGMLIAIVGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAV 366

Query: 364 FAIFYFAIGI 373
           FAI +  +G+
Sbjct: 367 FAILFQNVGL 376


>gi|91781621|ref|YP_556827.1| ABC transporter inner membrane protein [Burkholderia xenovorans
           LB400]
 gi|91685575|gb|ABE28775.1| Putative ABC transporter, inner membrane subunit [Burkholderia
           xenovorans LB400]
          Length = 377

 Score =  215 bits (547), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 99/370 (26%), Positives = 170/370 (45%), Gaps = 16/370 (4%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME- 63
           + R +G W +  ++        + + ++          DLS I  +D +G + +      
Sbjct: 19  IVRLSGQWTALALARDRATGHVIPLLLSLVGAEGIGGWDLSRIDRMDHVGGQALWRVWGH 78

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
           K      L      I +  +L+           K           +    +G  I  F  
Sbjct: 79  KMPADTTLTDTQRDIFERIALLDTVRETAEPVIK----------LDPFTRLGLAIFSFFE 128

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                  +LG V+ +                 +   +Y  G   +P+  L++F+ G V++
Sbjct: 129 HLYGGVAMLGRVVLDLLAIVRKPKITP--WTEISANVYNAGTQALPITALVAFLIGIVLS 186

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
              A QL  FGA  + ++++ +  +RE+G +L+A+++AGRSGSAI A+IG M++ EE+DA
Sbjct: 187 YLSAQQLRLFGANQYIVNILGLSVIRELGPVLSAILVAGRSGSAITAQIGVMRVTEELDA 246

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I  + F      
Sbjct: 247 MRVMGIPHGLRLILPRVLALGVAMPLLVMWTNIIALTGGALAARIVLGIDMSYFARALPG 306

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
              +AN++ GL K       I IV    GF +  +S SLG+  TT VV SI+IVI+ D++
Sbjct: 307 VVPVANLWIGLGKGVVFGMLIAIVGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAV 366

Query: 364 FAIFYFAIGI 373
           FAI +  +G+
Sbjct: 367 FAILFQNVGL 376


>gi|237751540|ref|ZP_04582020.1| ABC transport system permease [Helicobacter bilis ATCC 43879]
 gi|229372906|gb|EEO23297.1| ABC transport system permease [Helicobacter bilis ATCC 43879]
          Length = 387

 Score =  214 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 90/276 (32%), Positives = 145/276 (52%), Gaps = 2/276 (0%)

Query: 98  PQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLI 157
           P R    N F +    IG+  V F   + S  + +G+ +      C     F+    SLI
Sbjct: 114 PYRPKRLNIFSSFFSFIGQWCVSFYQTALSFFNFMGMFLHFFMLGCLKPSNFR--FKSLI 171

Query: 158 RQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTA 217
             +Y  G   +PV ++ S + G  I  QGA+QL+  G  I S+D  + L LRE+G  + A
Sbjct: 172 YHIYEQGFKALPVGLMTSLIIGYAITLQGAYQLNSMGVPIMSVDTTAKLALREMGPFILA 231

Query: 218 VMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFS 277
           ++IAGRS S+  A++GSM++ EE+ A++ M L+    LI PRI ALII +PL+   A+  
Sbjct: 232 LVIAGRSASSFTAQLGSMRLTEELSAMKAMNLNIFYFLIIPRILALIIVMPLMVFAADAI 291

Query: 278 AIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV 337
           A+ G  + I    +I F  +  RF+ T ++ + + G++KAP     IGIV    G     
Sbjct: 292 ALFGGMVAIKTSINIGFETYLERFYETVSITHFWIGVVKAPVFGAIIGIVGCFRGLECRG 351

Query: 338 HSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
            + S+GK  T  VV +I  +I+ +++F+  +    +
Sbjct: 352 DTQSIGKMTTMSVVNAIFWIIMANAIFSFIFTRYNL 387


>gi|298530716|ref|ZP_07018118.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298510090|gb|EFI33994.1| protein of unknown function DUF140 [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 256

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 77/249 (30%), Positives = 134/249 (53%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
             + +      LG ++    +  +   +    +    +QM ++GV+ + VV L S  TG 
Sbjct: 8   LGHQTLGFLQELGRIMVLFLQALSWLVRPPFRIRLFFKQMEFIGVNSLFVVALTSLFTGM 67

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q  +  S FGAE      +++   RE+G ++T +M+ GR+GSAI AEIG+M++ E+
Sbjct: 68  VLALQTFYAFSMFGAETLVGATVALSMTRELGPVITGLMVTGRAGSAICAEIGTMRVTEQ 127

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+  M ++ V+ L+ PRI A +I LPLLTI++N   I+G  +V  +  DI   +F ++
Sbjct: 128 VDALTVMAINPVQYLVLPRIVAGVIMLPLLTIISNTMGILGGYLVGVQLLDIHGGMFLNK 187

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                T+A+++ GLIKA      + +V   +GF     +  +G+  T  VV S  ++++ 
Sbjct: 188 IQEHVTMADVYNGLIKASAFGGILTLVGCYKGFYTRGGAEGVGRSTTQAVVMSSVLILVS 247

Query: 361 DSLFAIFYF 369
           D       F
Sbjct: 248 DYFLTALMF 256


>gi|288962766|ref|YP_003453060.1| ABC transport system permease protein [Azospirillum sp. B510]
 gi|288915032|dbj|BAI76516.1| ABC transport system permease protein [Azospirillum sp. B510]
          Length = 258

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 123/253 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +              G +   TG   +   +   +   ++RQM  +G   +PVV L +  
Sbjct: 4   LAATGRAFLIFLEATGRLALFTGSALSHCVRPPLYPRQILRQMIDIGYYSLPVVGLTALF 63

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G+A+ AEIG+M++
Sbjct: 64  TGMVLALQSYSGFSRFQAEGAIATVVVLSITRELGPVLAGLMVAGRIGAAMAAEIGTMRV 123

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  +  + L++PR+ A +  +PLL ++A+   + G  +V     D   A +
Sbjct: 124 TEQIDALSTLSTNPYKYLVAPRLIAGLTMVPLLVVVADIIGVFGGFLVGVYRLDFNAASY 183

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +R        ++ +GL+KA      I ++    G+     +  +G   T  VV +  ++
Sbjct: 184 INRTWEFLQPVDVISGLVKAAIFGFLIALMGCYHGYHSKGGAQGVGAATTNAVVSASIMI 243

Query: 358 IIIDSLFAIFYFA 370
           ++ + L    +F+
Sbjct: 244 LVWNYLITGLFFS 256


>gi|187922498|ref|YP_001894140.1| hypothetical protein Bphyt_0491 [Burkholderia phytofirmans PsJN]
 gi|187713692|gb|ACD14916.1| protein of unknown function DUF140 [Burkholderia phytofirmans PsJN]
          Length = 377

 Score =  214 bits (545), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 98/369 (26%), Positives = 170/369 (46%), Gaps = 14/369 (3%)

Query: 8   VFRFAGNWKSPEISEIADD---VVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
           + R +G W +  ++        + +  +          DLS I  +D +G + +      
Sbjct: 19  IVRLSGQWTALALARDRATGHVIPLLRSLVGAEGIGQWDLSRIDRMDHVGGQALWRVWGH 78

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
                    ++     +F  I+     + K +   R        +    +G  I  F   
Sbjct: 79  KMPPDTT--LTDTQRDIFERIALLDTVREKAEPVIR-------FDPLTRLGLAIFSFFEH 129

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                 +LG V+ +                 +   +Y  G   +P+  L++F+ G V++ 
Sbjct: 130 LYGGVAMLGRVVLDLLAIARKPKITP--WTEISANIYNAGTKALPITALVAFLIGIVLSY 187

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
             A QL  FGA  + ++++ +  +RE+G +L A+++AGRSGSAI A+IG M++ EE+DA+
Sbjct: 188 LSAQQLRLFGANQYIVNILGLSVIRELGPVLAAILVAGRSGSAITAQIGVMRVTEELDAM 247

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
           R MG+     LI PR+ AL +++PLL +  N  A+ G ++       I  + F       
Sbjct: 248 RVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIALTGGALAAKIALGIDMSYFARALPGV 307

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             +AN++ GL K       I IV    GF +  +S SLG+  TT VV SI+IVI+ D++F
Sbjct: 308 VPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKANSQSLGEGTTTSVVTSITIVILADAVF 367

Query: 365 AIFYFAIGI 373
           AI +  +G+
Sbjct: 368 AILFQNVGL 376


>gi|242310202|ref|ZP_04809357.1| ABC transporter [Helicobacter pullorum MIT 98-5489]
 gi|239523499|gb|EEQ63365.1| ABC transporter [Helicobacter pullorum MIT 98-5489]
          Length = 365

 Score =  213 bits (543), Expect = 3e-53,   Method: Composition-based stats.
 Identities = 95/366 (25%), Positives = 162/366 (44%), Gaps = 8/366 (2%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
              R  G W       I   +       + +    + L    ++D  G  +++ F+ +  
Sbjct: 7   ATLRLDGIWDYRISKSILSQLQAI---KLTNVKINIVLGEHFDLDFCGGGVLLEFVTELE 63

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
            + ++     +  Q         +     + P  +    +   +H      I   I    
Sbjct: 64  SQQRIL---ENQLQQNPKSQKIFKILSTKEIPSNTNLTQNIIKIHSDSFIIIKNNIKTLI 120

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
                LG ++        +    +  L +    +    +  V +V L  F+ G VIA QG
Sbjct: 121 LSLGFLGEILYTFLASFINFKSIR--LKATFYFIQESLIKAVGIVALACFLIGIVIAYQG 178

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           + QL QFGA I  +++ S+L LRE+  ++TA++IAGRS SA  AEIG M+  +EIDA+R 
Sbjct: 179 SIQLRQFGASILIVEMSSMLTLREMAPIITAIIIAGRSASAFSAEIGMMRATQEIDAMRV 238

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           MG + +  L+ PR+ AL   LPL+  +A+   ++G+  V     DI    F  RF     
Sbjct: 239 MGFNPMTFLVVPRMLALCCVLPLVVFIADLFGLVGSMFVCQIQLDISTEQFLERFLQMVD 298

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           + + + G+ KAPF    I  +    GF+V   + S+G   T  VV+SI  VI  D++ ++
Sbjct: 299 MRHFWVGIAKAPFFGLIISFIGCFHGFSVAKDTRSIGVHTTKSVVESIFFVIAFDAICSV 358

Query: 367 FYFAIG 372
            +  +G
Sbjct: 359 IFTEMG 364


>gi|227822231|ref|YP_002826202.1| toulene ABC transporter, permease protein, putative [Sinorhizobium
           fredii NGR234]
 gi|227341231|gb|ACP25449.1| toulene ABC transporter, permease protein, putative [Sinorhizobium
           fredii NGR234]
          Length = 321

 Score =  213 bits (542), Expect = 4e-53,   Method: Composition-based stats.
 Identities = 143/324 (44%), Positives = 198/324 (61%), Gaps = 5/324 (1%)

Query: 50  IDTIGAELIMYFMEKYH-GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFK 108
           +DT GA +I  FM             +   ++   L+     +    Q  +       F+
Sbjct: 1   MDTAGAWIIRRFMNGIGSEAGGEIHFAHGGDRYVELVRALPGEL--RQPERSKRKDPLFQ 58

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGV 168
            L   IG+  V    D+ +  +ILG  +                  +++ Q+  +GV   
Sbjct: 59  RLFAPIGEVTVSIWTDTVAAMYILGSAVRGAQMKLGRHAGVSP--AAIVHQIDRMGVMAT 116

Query: 169 PVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAI 228
           P++ L+SF+ GA+IAQQGAFQL  FGAEIF +DL+ ILQLREIGVLLTA+MIAGRSGSAI
Sbjct: 117 PIITLMSFLIGAIIAQQGAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAI 176

Query: 229 VAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWK 288
            AEIGSMK+ EE+DA++ MGL  V +L+ PR+ AL I+LPLLTI+ANF+A++GA++V W 
Sbjct: 177 TAEIGSMKMREEVDALKVMGLSPVGVLVFPRLVALTIALPLLTIIANFAALVGAALVAWT 236

Query: 289 YYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTT 348
           Y  I  A F +R       +++  G+IKAPFMA  IG+VA  EG  VG  + SLG++VT+
Sbjct: 237 YSGITVATFVARLQEAVDFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTS 296

Query: 349 CVVQSISIVIIIDSLFAIFYFAIG 372
            VV+SI +VI+ID LFA+FY AI 
Sbjct: 297 SVVKSIFVVILIDGLFAMFYAAID 320


>gi|302328064|gb|ADL27265.1| putative ABC transporter, permease protein [Fibrobacter
           succinogenes subsp. succinogenes S85]
          Length = 364

 Score =  213 bits (542), Expect = 5e-53,   Method: Composition-based stats.
 Identities = 75/352 (21%), Positives = 147/352 (41%), Gaps = 14/352 (3%)

Query: 21  SEIADDVVMAINKSIQSDSAIVDLSAITEIDT---IGAELIMYFMEKYHGKIKLQGVSTH 77
           +  +  ++ +   ++      +D S++  +D        L+    EK   K+ L+     
Sbjct: 24  AANSKKLLSSCKSALTKGELHLDGSSLASMDYSADAFFALLAELSEKTGNKLVLEHFPPE 83

Query: 78  IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVIS 137
           I+Q    +      +   ++           N+   +G      + +      +L   I 
Sbjct: 84  IKQHLQNLRKMVPPEKPQRETN---------NILEMMGGAGFSLLKEVFEVLVLLFTAIY 134

Query: 138 NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEI 197
                     K K     + +QM+  G   + +  L   +    +A Q +  L+  G   
Sbjct: 135 --WTIVGPFDKGKIHFGGITKQMFKSGSEAMGICFLFVGLICLTMALQSSVMLNAVGGGS 192

Query: 198 FSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILIS 257
           +    +  L   EIG LLT +++AGRSGSA+ AEI +M + EE+ A+++M +  V+ L+ 
Sbjct: 193 YLASGLGFLIFAEIGPLLTTIILAGRSGSAMAAEIANMSVCEEVKALKSMAIPPVQYLVV 252

Query: 258 PRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKA 317
           PR  AL I+ P+L+  A+        ++ + + DI F+ +                 IKA
Sbjct: 253 PRFIALSITTPILSFSASIVGSFAGFLIAYFFCDISFSNYMMGLRDGIDPMTFLKSTIKA 312

Query: 318 PFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
                 + ++A  +G      + ++GK  T+ VV +I  ++I D+LFA  ++
Sbjct: 313 LVFGWIVTLIACNKGLNAHGGAEAVGKATTSSVVAAICTIVISDTLFAFIFY 364


>gi|27363501|ref|NP_759029.1| putative ABC transport system permease [Vibrio vulnificus CMCP6]
 gi|27359617|gb|AAO08556.1| Putative ABC transport system permease protein [Vibrio vulnificus
           CMCP6]
          Length = 357

 Score =  212 bits (539), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 94/354 (26%), Positives = 160/354 (45%), Gaps = 11/354 (3%)

Query: 16  KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVS 75
            S  +  + +     ++    S + +V+   +T ID  G   +     ++        + 
Sbjct: 15  TSEIVGNLWEKANRILDTHPNS-AIVVNAHNLTFIDISGIAFLSDLQTRFRAPGAEISIV 73

Query: 76  THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLV 135
                L  L+                      +     +G+   + + D  S A  +   
Sbjct: 74  GLKPSLAELV-------PPAPVENNPSIVGRERGFFERVGRATKEMLIDVGSVARFVKDC 126

Query: 136 ISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGA 195
                     S +      ++       G   VP+++LI F+ G +IA +      QFGA
Sbjct: 127 AVVF--KIGISRRKNVNWATVSDIASRAGADAVPIIMLIGFLMGVIIAFEIGLVAEQFGA 184

Query: 196 EIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRIL 255
            +F  D + I  LRE+G L+TA++ AGR+G+A  AEIG+ K+NEEI+A+RT G+  V  L
Sbjct: 185 VLFVADGIGISMLRELGPLMTAIVFAGRTGAAFAAEIGTQKVNEEINALRTFGISPVEFL 244

Query: 256 ISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLI 315
           + PRI+A I+ LPLLT+ A+   + G ++V    +DI F  ++ +  S  ++ +   GLI
Sbjct: 245 VIPRIYASILVLPLLTVFADIIGVFGGALV-LLKFDISFVQYYHQLLSALSIWDFGFGLI 303

Query: 316 KAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           KA      I ++  + G A G  S S+G   T+ VV SI  +++ID  F +   
Sbjct: 304 KATTFGFIIAVIGCERGLATGQGSTSVGLAATSAVVSSIIWIVVIDGFFTVLLT 357


>gi|313672871|ref|YP_004050982.1| hypothetical protein Calni_0908 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939627|gb|ADR18819.1| protein of unknown function DUF140 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 256

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 74/248 (29%), Positives = 131/248 (52%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                + A   G +     +     ++       LI+QM ++G + + V+IL    TG V
Sbjct: 9   GAPILNLALESGRIFLLLIDSILWIFRPPFRWKLLIKQMEFIGANSISVIILTGTFTGMV 68

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
            A Q      +FGAE     ++ +   RE+G +L+A+M+A R+GSAI AEIG+MK+ E+I
Sbjct: 69  FAFQSYIGFHKFGAEYMVGTVVGLGMARELGPVLSAIMVAARAGSAITAEIGTMKVTEQI 128

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ ++ +D V+ L++PRI A ++ +PLL  +A F  ++G   V  K  DI   ++    
Sbjct: 129 DALHSLAVDPVQYLVTPRILAGLLVMPLLNSIAVFCGVLGGYFVGVKILDINRTLYLQYM 188

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           +    L++++ G+IK+      + +V   +G AV   +  +G+  T  VV S  ++++ D
Sbjct: 189 YQYVDLSDLYNGMIKSVVFGLILTLVGCYKGMAVSGGAEGVGRATTESVVLSCILILVFD 248

Query: 362 SLFAIFYF 369
            +   F F
Sbjct: 249 YILTAFMF 256


>gi|320353203|ref|YP_004194542.1| hypothetical protein Despr_1079 [Desulfobulbus propionicus DSM
           2032]
 gi|320121705|gb|ADW17251.1| protein of unknown function DUF140 [Desulfobulbus propionicus DSM
           2032]
          Length = 371

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 95/371 (25%), Positives = 169/371 (45%), Gaps = 15/371 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY- 60
           S+         G W          ++V A++ SI   +     + + E DT     +   
Sbjct: 12  SQPSRLTVHLQGAWTLRTDPPPPTELVGALDSSI--RTLAFLSTDLAEWDTRLLVFLKAT 69

Query: 61  --FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
                     + L+G+   + +L +L              + ++  N  + L   IG+  
Sbjct: 70  TAAARNGGIAVDLEGLPPGVRRLLALSEAV--------PEKVTYGKNVRELLVTRIGRLT 121

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +     +   A   G +I       A    FK         +   GV  +P+V LI+ + 
Sbjct: 122 LALSGQAREAAAFTGEIILACMALAAGKKPFK--WRDFFYFIQSCGVESLPIVSLIAVLV 179

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G +++  GA QL  FGA+I+  +L+ +  + E+G L++ V+IAGR G+A  A++G+M++N
Sbjct: 180 GVILSFVGAVQLQMFGAQIYVANLVGLGMVLEMGALMSGVIIAGRIGAAYAAQLGTMQVN 239

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA+RTMG+  V  L+ PR+ AL++ LPLL + A+   I+G S++     D+    + 
Sbjct: 240 EEIDALRTMGISPVGFLVLPRMLALMLMLPLLCVYADIMGILGGSVIGVTMLDLSLIEYL 299

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
            +   T  L     G++KA      IG      G   G  + ++G+  T+ VV SI +++
Sbjct: 300 EQTRKTLRLGQCGQGILKASIFGVLIGYAGCLRGMQCGRSALAVGEATTSAVVTSIVLIV 359

Query: 359 IIDSLFAIFYF 369
           + DS+     +
Sbjct: 360 VSDSIITFLLY 370


>gi|56710306|dbj|BAD81021.1| permease component of ABC-type transport system [uncultured
           bacterium]
          Length = 405

 Score =  211 bits (538), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 94/378 (24%), Positives = 166/378 (43%), Gaps = 17/378 (4%)

Query: 3   ENGITVFRFAGNWKS----PEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELI 58
           +    V   +G W+     P  + +A+  + A   + Q+    VD +A+   D+     +
Sbjct: 38  QGDSLVVALSGAWQLGRPAPRFAPLAESALSAGTGATQTARVTVDAAALGSWDSSLLIFL 97

Query: 59  MY---FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIG 115
                F E +        +   I  L +L      + +  + P           L   +G
Sbjct: 98  RQGQEFCEAHKLDFVTDALPDRITSLLALARAVPERAVDAEVPALP--------LRARVG 149

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
              V   + S +    LG V+           + +         +   G   +P+V LI+
Sbjct: 150 LAGVSAWDASMAAVTFLGEVLQRGALLLRGRVRMR--WREFWVVVQSNGSGALPIVTLIA 207

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
            + G +IA  G   L +FGA  ++  L+    LRE+G L+T ++IAGR+G+A  AE+GSM
Sbjct: 208 LLVGVIIAFLGVVVLKRFGAGYYASYLVGFGMLREMGALMTGIIIAGRTGAAFAAELGSM 267

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           KI EEIDA+ T+G+  V  L+ PR+  L + +PLL + A+   I+G   V     D+   
Sbjct: 268 KITEEIDALTTLGISPVDHLVLPRVLGLFVMMPLLVVYADLVGIVGGMGVAVAMLDVTPT 327

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            F +   +   L++   G+ K       IG+    +G   G  + ++G+  T+ VV SI+
Sbjct: 328 QFMNGLLTAVVLSDALLGVFKGLIFGAIIGLAGCMKGLQAGSDAGAVGRAATSAVVISIT 387

Query: 356 IVIIIDSLFAIFYFAIGI 373
           +VI+ +++       + I
Sbjct: 388 LVILANAVVDWLAALLLI 405


>gi|148263112|ref|YP_001229818.1| hypothetical protein Gura_1039 [Geobacter uraniireducens Rf4]
 gi|146396612|gb|ABQ25245.1| protein of unknown function DUF140 [Geobacter uraniireducens Rf4]
          Length = 256

 Score =  211 bits (537), Expect = 1e-52,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 131/252 (51%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           + K  + + S    +G +++          +  G  + +++Q+ ++G     V+ L +  
Sbjct: 5   VEKLGSLTLSILQEMGRMVNFIIYAFYLIIRSPGKPVHILKQIRFIGAKSFFVIFLTASF 64

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+  QG + L++FG+E      +++  +RE+G +LTA+M+ GR+GSAI AEIG M+I
Sbjct: 65  TGMVLGLQGYYTLAKFGSEGMLGSAVALSLIRELGPVLTALMVTGRAGSAISAEIGIMRI 124

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ TM L+  + L+SP++ A IISLPLL  + +   I G  +V  K   +    +
Sbjct: 125 TEQIDALETMALEPCKYLVSPKLLAAIISLPLLCAIFDVVGIYGGYLVGVKLLGVNPGAY 184

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           F     +    ++++G+IK+      I  +   +G+  G  +  + +  T  VV S  +V
Sbjct: 185 FHEMEKSVEWKDVYSGIIKSVSFGVIIAWICCYKGYFAGHGAEGVSRATTAAVVMSSVMV 244

Query: 358 IIIDSLFAIFYF 369
           +I D        
Sbjct: 245 LIWDYFLTSVLL 256


>gi|261416607|ref|YP_003250290.1| protein of unknown function DUF140 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373063|gb|ACX75808.1| protein of unknown function DUF140 [Fibrobacter succinogenes subsp.
           succinogenes S85]
          Length = 354

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 75/352 (21%), Positives = 147/352 (41%), Gaps = 14/352 (3%)

Query: 21  SEIADDVVMAINKSIQSDSAIVDLSAITEIDT---IGAELIMYFMEKYHGKIKLQGVSTH 77
           +  +  ++ +   ++      +D S++  +D        L+    EK   K+ L+     
Sbjct: 14  AANSKKLLSSCKSALTKGELHLDGSSLASMDYSADAFFALLAELSEKTGNKLVLEHFPPE 73

Query: 78  IEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVIS 137
           I+Q    +      +   ++           N+   +G      + +      +L   I 
Sbjct: 74  IKQHLQNLRKMVPPEKPQRETN---------NILEMMGGAGFSLLKEVFEVLVLLFTAIY 124

Query: 138 NTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEI 197
                     K K     + +QM+  G   + +  L   +    +A Q +  L+  G   
Sbjct: 125 --WTIVGPFDKGKIHFGGITKQMFKSGSEAMGICFLFVGLICLTMALQSSVMLNAVGGGS 182

Query: 198 FSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILIS 257
           +    +  L   EIG LLT +++AGRSGSA+ AEI +M + EE+ A+++M +  V+ L+ 
Sbjct: 183 YLASGLGFLIFAEIGPLLTTIILAGRSGSAMAAEIANMSVCEEVKALKSMAIPPVQYLVV 242

Query: 258 PRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKA 317
           PR  AL I+ P+L+  A+        ++ + + DI F+ +                 IKA
Sbjct: 243 PRFIALSITTPILSFSASIVGSFAGFLIAYFFCDISFSNYMMGLRDGIDPMTFLKSTIKA 302

Query: 318 PFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
                 + ++A  +G      + ++GK  T+ VV +I  ++I D+LFA  ++
Sbjct: 303 LVFGWIVTLIACNKGLNAHGGAEAVGKATTSSVVAAICTIVISDTLFAFIFY 354


>gi|197120798|ref|YP_002132749.1| hypothetical protein AnaeK_0378 [Anaeromyxobacter sp. K]
 gi|196170647|gb|ACG71620.1| protein of unknown function DUF140 [Anaeromyxobacter sp. K]
          Length = 370

 Score =  211 bits (537), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 88/365 (24%), Positives = 155/365 (42%), Gaps = 10/365 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
              +G W    ++ +   +        +  + ++D S +  +DT GA L+          
Sbjct: 16  VHCSGAWTVHLVAGLDRALRRL--AWPEHVAVVIDASGVAAMDTAGAWLLRRAARDLERG 73

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
            +   ++   E             + +                  +G+            
Sbjct: 74  GRPVTLTLRPEH------EALLALVTSSGEVAPRRARERARFLSELGRSAWSSALAIGGV 127

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
             ++G +        A   + +      +  +   G   +P   L+SF  G V+A QGA 
Sbjct: 128 LTLVGELAGRVARARAGPLRVRA--RQAVLHVQSAGFEALPTTALLSFFVGVVLASQGAT 185

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L  FGA I   DL+ +  LRE+  L+TA+++AGRSGSA  A+IG+MK+  EI+++R  G
Sbjct: 186 LLRPFGAGILIADLVGLAMLRELSPLVTAIVVAGRSGSAYAAQIGAMKMAGEIESLRAGG 245

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +  V  L+ PRI AL + +PLLT+ A+   + GA++V      +    F  R       +
Sbjct: 246 VSPVDALVVPRIAALALVVPLLTVAADVLGLAGATLVARAELGMHAPEFLGRVAREVHAS 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +   G+ KAP     +  V   +G      + S+G++ T  VVQS+ +V++ D L  +  
Sbjct: 306 SYLLGVAKAPVFGVIVAAVGCHQGLRASDDAGSVGRRTTGAVVQSMFLVVLADGLVLVVS 365

Query: 369 FAIGI 373
             +GI
Sbjct: 366 RQLGI 370


>gi|15603974|ref|NP_220489.1| hypothetical protein RP096 [Rickettsia prowazekii str. Madrid E]
 gi|81554918|sp|Q9ZE51|Y096_RICPR RecName: Full=Probable ABC transporter permease protein RP096
 gi|3860665|emb|CAA14566.1| unknown [Rickettsia prowazekii]
 gi|292571688|gb|ADE29603.1| ABC transporter permease protein [Rickettsia prowazekii Rp22]
          Length = 259

 Score =  210 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 68/251 (27%), Positives = 131/251 (52%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
               +   A  +G+    +    +S  K   +L  +IRQ+ ++G   +PVV + +F +GA
Sbjct: 9   VGKHTIKFAQSVGIFSLFSFIAISSIIKPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSGA 68

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q     S+F AE     ++ +   RE+G +L  +++AGR G++I AEI +M++ E+
Sbjct: 69  VLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMRVTEQ 128

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+ T+  D ++ L+ PR+ A II++P L ++ +   ++G  +V     D     + + 
Sbjct: 129 VDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDIIGVMGGYLVGIYKLDFNSTAYLTS 188

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                   ++ +GLIKA      I I++   G+  G  +  +G+  T+ VV S  +++I 
Sbjct: 189 TFQYLEPIDVISGLIKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILIS 248

Query: 361 DSLFAIFYFAI 371
           + L    +F +
Sbjct: 249 NYLITELFFKV 259


>gi|144899037|emb|CAM75901.1| ABC transporter permease protein [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 257

 Score =  210 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 60/253 (23%), Positives = 119/253 (47%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +        +    +G + +  G   +   +   +    +R M  +G   +PVV L +  
Sbjct: 4   VAAIGRIFLAFLSHVGRLSAFAGTALSHVVRPPFYPRLTLRAMVEIGYYSLPVVGLTAVF 63

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A Q     S+F AE     ++ +   RE+  +L  +M+AGR G+++ AEIG+M++
Sbjct: 64  TGMVLALQSYSGFSRFAAESAVATVVVLSVTRELAPVLAGLMVAGRIGASMAAEIGTMRV 123

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  +  + L++PR+ A ++ +P L ++A+   + G  IV         + +
Sbjct: 124 TEQIDALTTLSTNPFKYLVAPRLLAGLLMVPCLVLVADIIGVFGGYIVGVYKLGFNPSTY 183

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +R        ++ +GL KA      I ++    G+     +  +G   T  VV +  ++
Sbjct: 184 LARTWEFLEPLDVISGLTKAAVFGFIISLMGCYHGYYSRGGAQGVGAATTNSVVSAAIMI 243

Query: 358 IIIDSLFAIFYFA 370
           +I + +    YF 
Sbjct: 244 LIFNYVITALYFG 256


>gi|83591748|ref|YP_425500.1| hypothetical protein Rru_A0408 [Rhodospirillum rubrum ATCC 11170]
 gi|83574662|gb|ABC21213.1| Protein of unknown function DUF140 [Rhodospirillum rubrum ATCC
           11170]
          Length = 257

 Score =  210 bits (536), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 119/249 (47%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                +    +G +   TG   +   +   F   + RQ+  +G   +PVV L +  TG V
Sbjct: 8   GRVFLTFLRHVGRLSVFTGTALSHCVRPPFFPRLIGRQLVEIGYYSLPVVGLTAIFTGMV 67

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           ++ Q     ++F AE  +  ++ +   RE+G +L  +M+AGR G+A+ AEIG+MK+ E+I
Sbjct: 68  LSLQSHSGFARFSAEGATATVVVLSMTRELGPVLAGLMVAGRIGAAMAAEIGTMKVTEQI 127

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ T+  +  + L+ PR+ A +  LP+L + A+   + G  ++         + + +  
Sbjct: 128 DALTTLATNPYKYLVVPRLIAGVTMLPILVLTADIIGVFGGYLIGVYKLGFNPSNYIAST 187

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                  ++ +GL+KA      I ++    G      +  +G   T  VV +  ++++ +
Sbjct: 188 WEFLEPMDVISGLVKASVFGFIIALMGCYHGSQSKGGAQGVGAATTNAVVSASILILVCN 247

Query: 362 SLFAIFYFA 370
            +    +FA
Sbjct: 248 YMITELFFA 256


>gi|67458472|ref|YP_246096.1| ABC transporter permease protein [Rickettsia felis URRWXCal2]
 gi|75537058|sp|Q4UNC7|Y080_RICFE RecName: Full=Probable ABC transporter permease protein RF_0080
 gi|67004005|gb|AAY60931.1| ABC transporter permease protein [Rickettsia felis URRWXCal2]
          Length = 259

 Score =  209 bits (533), Expect = 5e-52,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 130/252 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +    +S  +   +L  +IRQ+ ++G   +PVV + +F +G
Sbjct: 8   SVGKRTIKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 68  AVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ PR+ A II++P L ++ +   ++G  +V     D     + +
Sbjct: 128 QVDALYTLSTDPIKYLVFPRVIAAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSTAYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 188 STFHYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 247

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 248 SNYLITELFFKV 259


>gi|114777488|ref|ZP_01452485.1| ABC-type transport system involved in resistance to organic
           solvents [Mariprofundus ferrooxydans PV-1]
 gi|114552270|gb|EAU54772.1| ABC-type transport system involved in resistance to organic
           solvents [Mariprofundus ferrooxydans PV-1]
          Length = 257

 Score =  209 bits (532), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 81/255 (31%), Positives = 128/255 (50%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           K +      +      +GL  S               L  L++Q   VGV  +PVV+L +
Sbjct: 3   KLLTATGKLTEGLCIHIGLYASTFAGTVRRMSSRPWHLRMLLQQAEEVGVQSLPVVMLTA 62

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG V+A Q      +F AE  +  ++S+  +RE+G +L  +M+AGR G+A  AE+G+M
Sbjct: 63  LFTGMVLALQSYIVFHRFAAESLTGLVVSMSLVRELGPVLVGLMVAGRVGAAFAAELGTM 122

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E+IDA+ T+  D VR LI PR+ A+ + +PLL ++A+F  I G   +     D   +
Sbjct: 123 RVTEQIDALWTLSTDPVRYLIMPRLIAVTLMMPLLVVVADFIGIYGGYAISIYLLDQNPS 182

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
           V+         L++ +TGL+KA F    IGI+   EGF     +  +G   T  VV S  
Sbjct: 183 VYIENTTQYMELSDFYTGLVKAGFFGILIGIIGCTEGFNCKGGAAGVGTATTRAVVISCM 242

Query: 356 IVIIIDSLFAIFYFA 370
            ++I D     + FA
Sbjct: 243 SILISDYFLTAWMFA 257


>gi|91206155|ref|YP_538510.1| ABC transporter permease protein [Rickettsia bellii RML369-C]
 gi|157826543|ref|YP_001495607.1| ABC transporter permease protein [Rickettsia bellii OSU 85-389]
 gi|122425169|sp|Q1RGU3|Y1340_RICBR RecName: Full=Probable ABC transporter permease protein RBE_1340
 gi|91069699|gb|ABE05421.1| ABC transporter permease protein [Rickettsia bellii RML369-C]
 gi|157801847|gb|ABV78570.1| ABC transporter permease protein [Rickettsia bellii OSU 85-389]
          Length = 259

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 130/252 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +     S  +   +   +I+Q+ ++G   +PVV + +F +G
Sbjct: 8   SIGKRTIRLAQSIGKFSIFSLAAITSIIRPPLYFSLIIKQLLFIGFYSLPVVAMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEIG+M++ E
Sbjct: 68  AVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIGTMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ P++ A II++P L ++ +   ++G  +V     D   + + +
Sbjct: 128 QVDALYTLSTDSIKYLVFPKVIAAIITMPCLVLIGDVIGVMGGYLVGVYKLDFNSSTYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 188 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 247

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 248 SNYLITELFFKV 259


>gi|85858832|ref|YP_461034.1| organic solvents resistance ABC transporter permease [Syntrophus
           aciditrophicus SB]
 gi|85721923|gb|ABC76866.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Syntrophus aciditrophicus
           SB]
          Length = 259

 Score =  209 bits (531), Expect = 7e-52,   Method: Composition-based stats.
 Identities = 74/250 (29%), Positives = 124/250 (49%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                       +G +I       A +++    L  + +QM +VGV  + VV+L    TG
Sbjct: 10  SLGRRILHGVEEMGRIILLFLSVVAWTFRPPLRLRLIFKQMEFVGVKSIFVVVLTGAFTG 69

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A QG      F AE      +++   RE+G +LT++M+  R+GSA+ AE+G+M++ E
Sbjct: 70  MVMALQGYHGFKMFSAESLVGATVALGMTRELGPVLTSLMVTARAGSAMAAELGTMRVTE 129

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+  M  + ++ LI PR+ A I+ LPLLT++++F  I+G   V     +I   VF  
Sbjct: 130 QIDALYVMAANPIQHLIVPRMIASILMLPLLTVVSDFVGILGGYFVGVSVLNINEGVFVK 189

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                  L +I+ GLIKA      + ++   +GF     +  +G+  T  VV S   +++
Sbjct: 190 NITRIVELGDIYNGLIKAACFGLILSLIGCYKGFHARGGAEGVGRATTEAVVLSSISILV 249

Query: 360 IDSLFAIFYF 369
            D       F
Sbjct: 250 GDYFLTAIMF 259


>gi|157964160|ref|YP_001498984.1| ABC transporter permease protein [Rickettsia massiliae MTU5]
 gi|157843936|gb|ABV84437.1| ABC transporter permease protein [Rickettsia massiliae MTU5]
          Length = 264

 Score =  208 bits (530), Expect = 9e-52,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 129/252 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +    +S  +   +L  +IRQ+  +G   +PVV + +F +G
Sbjct: 13  SVGKRTIKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLLIGFHSLPVVAMTTFFSG 72

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 73  AVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTE 132

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V     D   A + +
Sbjct: 133 QVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSAAYLT 192

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 193 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 252

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 253 SNYLITELFFKV 264


>gi|157803278|ref|YP_001491827.1| ABC transporter permease protein [Rickettsia canadensis str.
           McKiel]
 gi|157784541|gb|ABV73042.1| ABC transporter permease protein [Rickettsia canadensis str.
           McKiel]
          Length = 259

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 62/252 (24%), Positives = 127/252 (50%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +    +S  +   +   +IRQ+ ++G   +PVV + +F +G
Sbjct: 8   AVGKRTIKFAQNIGSFSLFSFAAVSSIIRPPLYFSLIIRQLLFIGFYSLPVVTMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 68  AVLALQSYNGFSRFSAESSIATVVVLSLTRELGPVLVGLMVAGRVGASIAAEIATMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ PR+   ++++P L ++ +   ++G  +V           + +
Sbjct: 128 QVDALYTLSTDPIKYLVFPRVITAMLTMPCLVLIGDVIGVMGGYLVGVYKLGFNSTAYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 188 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 247

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 248 SNYLITELFFKV 259


>gi|258543490|ref|YP_003188923.1| ABC transporter permease [Acetobacter pasteurianus IFO 3283-01]
 gi|256634568|dbj|BAI00544.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-01]
 gi|256637626|dbj|BAI03595.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-03]
 gi|256640678|dbj|BAI06640.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-07]
 gi|256643735|dbj|BAI09690.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-22]
 gi|256646790|dbj|BAI12738.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-26]
 gi|256649843|dbj|BAI15784.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-32]
 gi|256652831|dbj|BAI18765.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256655887|dbj|BAI21814.1| ABC transporter permease protein [Acetobacter pasteurianus IFO
           3283-12]
          Length = 385

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 80/372 (21%), Positives = 152/372 (40%), Gaps = 10/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G+      G W        A              +  +D + +   D+     +   
Sbjct: 24  TADGVC-LNVEGAWTVQAGG--ATPFPQDKLPVEPGHTLHIDTTGLKGWDSAFVAFLWDV 80

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
            +                    L++       +  +P R+      + +   +G   +K 
Sbjct: 81  KQAASKAQLHFDEQNLPAPAQRLLALLPDAPAEPAQPPRNT-----EGIFARVGDATLKG 135

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           + ++ + + +         +        +     L+  ++  G   + +V +++F+ GA+
Sbjct: 136 LTETGTVSELALETAKGATQAVRGKSAMRM--KDLLLDIWNAGPDALLIVGIVNFLVGAI 193

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  G  +L +F AEI+  DL+ I   REI  ++TA+++AGR+G A  A I +M  NEEI
Sbjct: 194 LAFVGLVELRKFAAEIYVTDLVGIACAREISAIMTAIIMAGRTGGAYAARISTMLGNEEI 253

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++  G+     ++ P I +L + +PLL +     AI G   V     D+    ++   
Sbjct: 254 DALQVFGIPISSYILLPSIVSLALMMPLLYLYGTIVAIFGGFAVSMSMMDVSPIGYWIST 313

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L     G IK+ F A  I + A + G   G  +  +G   T  VV  I  +I +D
Sbjct: 314 FDGVELKEFIFGFIKSFFFASFIALAACRVGLKAGRSAADVGVAATRAVVIGIVGIIAMD 373

Query: 362 SLFAIFYFAIGI 373
           ++FA+   A+GI
Sbjct: 374 AIFAVIANALGI 385


>gi|28898136|ref|NP_797741.1| putative ABC transport system permease [Vibrio parahaemolyticus
           RIMD 2210633]
 gi|153836560|ref|ZP_01989227.1| ABC-type transport system, permease component [Vibrio
           parahaemolyticus AQ3810]
 gi|260366435|ref|ZP_05778874.1| ABC transporter, permease protein [Vibrio parahaemolyticus K5030]
 gi|260878481|ref|ZP_05890836.1| ABC-type transport system, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|260897062|ref|ZP_05905558.1| ABC transporter, permease protein [Vibrio parahaemolyticus
           Peru-466]
 gi|260901858|ref|ZP_05910253.1| ABC transporter, permease protein [Vibrio parahaemolyticus AQ4037]
 gi|28806350|dbj|BAC59625.1| putative ABC transport system permease protein [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|149750158|gb|EDM60903.1| ABC-type transport system, permease component [Vibrio
           parahaemolyticus AQ3810]
 gi|308087695|gb|EFO37390.1| ABC transporter, permease protein [Vibrio parahaemolyticus
           Peru-466]
 gi|308091102|gb|EFO40797.1| ABC-type transport system, permease protein [Vibrio
           parahaemolyticus AN-5034]
 gi|308108149|gb|EFO45689.1| ABC transporter, permease protein [Vibrio parahaemolyticus AQ4037]
 gi|308113110|gb|EFO50650.1| ABC transporter, permease protein [Vibrio parahaemolyticus K5030]
          Length = 357

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 89/354 (25%), Positives = 162/354 (45%), Gaps = 11/354 (3%)

Query: 16  KSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVS 75
            S  + ++ +     +     S   +V+ S +T +D  G   +     ++        + 
Sbjct: 15  TSAMVGDLWEKANDILESYPDSP-IVVNASNLTFVDISGVAFLSDLQTRFRPPGAEISII 73

Query: 76  THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLV 135
                L  L+  ++ +                      +G    + +    S    +   
Sbjct: 74  GLSASLAELVPPSNIENAPQIPRGED-------GFFERVGNATREMLVYVGSVVRFIKEC 126

Query: 136 ISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGA 195
           +         + +      ++       G   VP+++LI F+ G +IA +      QFGA
Sbjct: 127 VLVF--KLGINRRKNVNWTTVSNIATRAGADAVPIILLIGFLMGVIIAFEIGLVAQQFGA 184

Query: 196 EIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRIL 255
            +F  D + I   RE+G L+TA++ AGR+G+A  AEIG+ K+NEEI+A+ T G+  V  L
Sbjct: 185 VLFVADGIGISMFRELGPLMTAIVFAGRTGAAFAAEIGTQKVNEEINALHTFGICPVEFL 244

Query: 256 ISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLI 315
           + PRI+A ++ LPLLT+LA+   ++G ++V    +DI F  ++ +  +  ++ ++F GLI
Sbjct: 245 VIPRIYASVLVLPLLTVLADIIGVLGGALV-LLKFDISFVQYYHQLLNALSVWDLFFGLI 303

Query: 316 KAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
           KA      I ++  + G A G  S S+G   T+ VV SI  +++ID  F +   
Sbjct: 304 KATTFGFIIAVIGCERGLATGQGSTSVGLAATSAVVSSIIWIVVIDGFFTVLLT 357


>gi|15892052|ref|NP_359766.1| ABC transporter permease protein [Rickettsia conorii str. Malish 7]
 gi|34580917|ref|ZP_00142397.1| ABC transporter permease protein [Rickettsia sibirica 246]
 gi|229586334|ref|YP_002844835.1| ABC transporter permease protein [Rickettsia africae ESF-5]
 gi|81528535|sp|Q92JD8|Y129_RICCN RecName: Full=Probable ABC transporter permease protein RC0129
 gi|15619171|gb|AAL02667.1| ABC transporter permease protein [Rickettsia conorii str. Malish 7]
 gi|28262302|gb|EAA25806.1| ABC transporter permease protein [Rickettsia sibirica 246]
 gi|228021384|gb|ACP53092.1| ABC transporter permease protein [Rickettsia africae ESF-5]
          Length = 259

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 68/252 (26%), Positives = 130/252 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +    +S  +   +L  +IRQ+ ++G   +PVV + +F +G
Sbjct: 8   SVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 68  AVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V     D   A + +
Sbjct: 128 QIDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSAAYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 188 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 247

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 248 SNYLITELFFKV 259


>gi|212702437|ref|ZP_03310565.1| hypothetical protein DESPIG_00454 [Desulfovibrio piger ATCC 29098]
 gi|212674098|gb|EEB34581.1| hypothetical protein DESPIG_00454 [Desulfovibrio piger ATCC 29098]
          Length = 375

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 78/370 (21%), Positives = 152/370 (41%), Gaps = 7/370 (1%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
                   +G+W             +   +        +  +++   D+     ++   +
Sbjct: 13  GERLQVTVSGSWAINTPWPPQCADALQQLQGPGIRQLHLAAASLDAWDSSLLVFLVQLHK 72

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
                          + L + ++              +   +  + L   +G  ++    
Sbjct: 73  AASAARIEI-----SQDLPAGLARLLHLAFAIPAQAGAARSDHRQGLFARVGGAVMSLPP 127

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                   LG V  +           +      +  MY  GV  +P++ + S + G ++A
Sbjct: 128 RCADFLEFLGDVTLSIWRLILGRAGMRMQ--DFVEAMYECGVRALPIISITSLLFGLILA 185

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             GA QL+QFGA+I+   L+ I  LR +G ++  V+++GR G+A  A IG+M++NEE+DA
Sbjct: 186 FVGAVQLTQFGAQIYVAGLVGIGMLRVMGAVMVGVVMSGRVGAAYAAMIGTMQVNEEVDA 245

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           + T+G+  +  L+ PR+ AL+  +PLLT+ A+   I+G  +V      +  A + +    
Sbjct: 246 LTTLGISPIDFLVLPRMLALMFMVPLLTVYADLMGILGGYVVGVSMLGLSSAEYLNATMQ 305

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
             +  +   G+         I +    +G   G  + ++G   TT VVQSI  +II  ++
Sbjct: 306 MVSFVHGLIGIAYGTVFGVIIALAGCYQGIRCGRSAQAVGLATTTAVVQSIVGIIIATAI 365

Query: 364 FAIFYFAIGI 373
             I    +GI
Sbjct: 366 ITIICNVLGI 375


>gi|157825268|ref|YP_001492988.1| ABC transporter permease protein [Rickettsia akari str. Hartford]
 gi|157799226|gb|ABV74480.1| ABC transporter permease protein [Rickettsia akari str. Hartford]
          Length = 259

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 66/251 (26%), Positives = 131/251 (52%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
               +   A  +G     +    +S+ +   +L  +IRQ+ ++G   +PVV + +F +GA
Sbjct: 9   VGKRTIKCAQSVGSFSLFSFAAVSSTIRPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSGA 68

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q     S+F AE     ++ +   RE+G +L  +M++GR G++I AEI +M++ E+
Sbjct: 69  VLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLMVSGRVGASIAAEIATMRVTEQ 128

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+ T+  D ++ L+ PR+ A I+++P L ++ +   ++G  +V     D     + + 
Sbjct: 129 VDALYTLSTDPIKYLVFPRVIATIVTMPCLVLIGDIIGVMGGYLVGVYKLDFNSTAYLTS 188

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                   ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  I++I 
Sbjct: 189 TLHYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSIIILIS 248

Query: 361 DSLFAIFYFAI 371
           + L    +F +
Sbjct: 249 NYLITELFFKV 259


>gi|157828003|ref|YP_001494245.1| ABC transporter permease protein [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165932699|ref|YP_001649488.1| ABC transporter permease [Rickettsia rickettsii str. Iowa]
 gi|157800484|gb|ABV75737.1| ABC transporter permease protein [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|165907786|gb|ABY72082.1| ABC transporter permease protein [Rickettsia rickettsii str. Iowa]
          Length = 259

 Score =  208 bits (529), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 67/252 (26%), Positives = 130/252 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +    +S  +   +L  +IRQ+ ++G   +PVV + +F +G
Sbjct: 8   SVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 68  AVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V     D   A + +
Sbjct: 128 QVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSAAYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 188 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 247

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 248 SNYLITELFFKV 259


>gi|258404804|ref|YP_003197546.1| hypothetical protein Dret_0676 [Desulfohalobium retbaense DSM 5692]
 gi|257797031|gb|ACV67968.1| protein of unknown function DUF140 [Desulfohalobium retbaense DSM
           5692]
          Length = 256

 Score =  207 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 72/250 (28%), Positives = 130/250 (52%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +      +G +    G  C    +    +    +QM +VGV    VVIL    TG
Sbjct: 7   ALGAGTMRGLQQMGQMALLLGSACGWLLRRPFRIRLFFKQMEFVGVHSGFVVILTGLFTG 66

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q  +    F AE      +++   RE+G ++TA+M+ GR+GSA+ AEIG+M++ E
Sbjct: 67  MVLALQTYYAFRMFSAESLVGATVALSMTRELGPVITALMVTGRAGSAMAAEIGTMRVTE 126

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+  M ++ V+ L++PR+ A ++ LPLLT++++F  I G  +V  K   I  ++F +
Sbjct: 127 QVDALEVMAINPVQYLVTPRLLAGMVMLPLLTVISDFVGIAGGYLVGVKMLGINSSMFMN 186

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           + +    L++I+ GL KA      + +V   +GF     +  +G+  T  VV +  ++++
Sbjct: 187 KIYDLLELSDIYNGLTKAVVFGLILTLVGCYKGFYTSGGAEGVGRSTTQAVVLASVLILM 246

Query: 360 IDSLFAIFYF 369
            D +     F
Sbjct: 247 SDYILTALMF 256


>gi|281356267|ref|ZP_06242760.1| protein of unknown function DUF140 [Victivallis vadensis ATCC
           BAA-548]
 gi|281317636|gb|EFB01657.1| protein of unknown function DUF140 [Victivallis vadensis ATCC
           BAA-548]
          Length = 272

 Score =  207 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 68/269 (25%), Positives = 136/269 (50%), Gaps = 2/269 (0%)

Query: 100 RSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQ 159
            +    S K L   +    +   +D C        +   T +      K + +   +   
Sbjct: 2   NARSPRSLKQLCIEVADSAIALRDDLCLFCTFSRQLGKATLDAIRHPRKIRRY--DVYYY 59

Query: 160 MYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVM 219
           M   G   +P++ L+ F+ G ++A Q   QL +FG E + ++L+  + + E+  L+TAV+
Sbjct: 60  MDNCGSDAMPIIALLGFLIGVILAFQAIVQLRRFGVESYVVNLVGTVIVTELAPLVTAVV 119

Query: 220 IAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAI 279
           +AGR+GS+  AE+G+MK +EEIDA+ TMG D  R L+ P++ AL++ +P LTI+++   I
Sbjct: 120 LAGRTGSSFAAELGTMKADEEIDAMVTMGFDPGRFLLFPKMLALLLIMPGLTIISDVCGI 179

Query: 280 IGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHS 339
            G  +++     +    + ++        ++  GL+K+   A  +  +   +G     ++
Sbjct: 180 AGGMVIVCSMLQVSTGEYLTKTFEIIQPIDLAQGLVKSFVFAVIVAGIGCMKGLNAERNA 239

Query: 340 NSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
             +G+  T+ VV SI ++++ D++    +
Sbjct: 240 QGVGRSATSAVVTSIFLIVVTDAILTSCF 268


>gi|148261999|ref|YP_001236126.1| hypothetical protein Acry_3017 [Acidiphilium cryptum JF-5]
 gi|146403680|gb|ABQ32207.1| protein of unknown function DUF140 [Acidiphilium cryptum JF-5]
          Length = 362

 Score =  207 bits (528), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 94/368 (25%), Positives = 169/368 (45%), Gaps = 19/368 (5%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
              V    G   +  ++E     +     +       +DLS    IDT GA L++     
Sbjct: 13  DGPVIALTGPLTAAALTEAWPRAIAVARAA--QGVMTLDLSRAARIDTSGAALLLALERG 70

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           + G+ + QG++   E L + +     +      P R+                    +  
Sbjct: 71  HDGETRWQGLTPAAEGLIARLRAALPETGAPPPPPRTVRGPGP--------------LRT 116

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
              +    G  I  T    A     +G   +  R     G   +P+VI++ F+ G ++A 
Sbjct: 117 LGVRIAFFGETILATTGLPARRRFLRG--GNFFRIAERAGAQALPLVIMLGFLIGMILAF 174

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A  + QFGA+I+   L+S+   RE+G LL AV++AGR+GSA  AE+G+M +NEE+ A+
Sbjct: 175 QSAIPMRQFGADIYVAALVSLSLFRELGPLLAAVILAGRTGSAFAAELGTMMVNEEVAAL 234

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG+D   +L+ PR+ A ++ +P L +  + S ++G   V+      P +   ++    
Sbjct: 235 TTMGIDPGTMLVIPRMAAAMLVMPALALGIDVSGVLGMGFVM-GILGFPPSAIVAQMQMA 293

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +  ++  GL+K+     A+G++  + G   G    ++G+  T+ VV  I   I++D LF
Sbjct: 294 TSPHDVLLGLMKSVVFGAAVGLIGCRAGLTAGGGPRAVGEAATSAVVGGIVATILLDGLF 353

Query: 365 AIFYFAIG 372
           A+  + +G
Sbjct: 354 AVILYRLG 361


>gi|218679258|ref|ZP_03527155.1| putative transmembrane component of ABC transporter [Rhizobium etli
           CIAT 894]
          Length = 281

 Score =  207 bits (527), Expect = 2e-51,   Method: Composition-based stats.
 Identities = 135/282 (47%), Positives = 189/282 (67%), Gaps = 2/282 (0%)

Query: 91  KKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFK 150
           ++    +P++    +    +   +GK      ++  +  +ILG  +              
Sbjct: 1   EEPAKPEPEQQEKVSLVARIFAPVGKMTYDLWDNFAASMYILGSAVRGAQMKFGRGSGVS 60

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLRE 210
               S++ Q+ ++GV  VP+++L+SF+ GA+IAQQGAFQL  FGAE+F +DL+ ILQLRE
Sbjct: 61  P--ASIVNQIDHMGVRAVPIILLMSFLIGAIIAQQGAFQLRYFGAEVFVVDLVGILQLRE 118

Query: 211 IGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLL 270
           IGVLLT++MIAGRSGSAI AEIGSMK+ EEIDA++ MGL+ + +LI PR+ AL I+LPLL
Sbjct: 119 IGVLLTSIMIAGRSGSAITAEIGSMKMREEIDALKVMGLNPIGVLIFPRLVALTIALPLL 178

Query: 271 TILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMK 330
           T+LANF+++ GA+ V W Y  I FA F SR H   TL+ + +G+IKAPFMA  IGIVA  
Sbjct: 179 TVLANFASLAGAAAVAWGYSGITFANFLSRLHEAVTLSTVLSGMIKAPFMALVIGIVAAV 238

Query: 331 EGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           EG  VG  + SLG+ VT  VV++I +VI++D LFA+FY AI 
Sbjct: 239 EGLKVGGSAESLGQHVTASVVKAIFVVILMDGLFAMFYAAID 280


>gi|283779915|ref|YP_003370670.1| hypothetical protein Psta_2136 [Pirellula staleyi DSM 6068]
 gi|283438368|gb|ADB16810.1| protein of unknown function DUF140 [Pirellula staleyi DSM 6068]
          Length = 289

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 65/267 (24%), Positives = 121/267 (45%)

Query: 105 NSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVG 164
                +   +  ++  +          +G +        +          +L+   Y VG
Sbjct: 11  QPPAGILQSLADQVTDWGAVVVDGLITIGDLTIFAMRTISWMLFKLPRRETLLPNFYQVG 70

Query: 165 VSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRS 224
           V  +PV+ L     G V+A Q  F     G E     ++++  +RE+G +L A M+AGR 
Sbjct: 71  VLSLPVIALTGTFIGMVLAVQSYFTFRDLGLETRMGAVINMTLVRELGPVLAATMLAGRV 130

Query: 225 GSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASI 284
           G A+ AE+G+M++ E+IDA+ +MG D +  L+ PR  A +  +P LTI+A+F  ++G   
Sbjct: 131 GCAMAAELGTMRVTEQIDALESMGADPIYYLVVPRFLACLFLIPTLTIMADFMGVVGGYF 190

Query: 285 VIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
                  I    ++          ++F+G++K+ F   AI +V+   GF     +  +G+
Sbjct: 191 YSTVVLSIDKHHYWYNSEQFVGNFDLFSGILKSLFFGAAIAVVSCYRGFHCTPGAEGVGR 250

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYFAI 371
             T   V S  ++++ID       + +
Sbjct: 251 AATAAFVHSFVLILVIDLFLGKMLYTL 277


>gi|303256383|ref|ZP_07342397.1| ABC transporter, permease protein [Burkholderiales bacterium
           1_1_47]
 gi|331001491|ref|ZP_08325109.1| hypothetical protein HMPREF9439_02780 [Parasutterella
           excrementihominis YIT 11859]
 gi|302859874|gb|EFL82951.1| ABC transporter, permease protein [Burkholderiales bacterium
           1_1_47]
 gi|329568220|gb|EGG50037.1| hypothetical protein HMPREF9439_02780 [Parasutterella
           excrementihominis YIT 11859]
          Length = 354

 Score =  207 bits (526), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 94/348 (27%), Positives = 162/348 (46%), Gaps = 13/348 (3%)

Query: 26  DVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLI 85
            +   +  +  S   I D S +T  D  G  L+     +     KL  VS  IE L++ +
Sbjct: 20  KIWEQVLGAESSGQTIFDASDLTFCDESGLTLLYELRSR-PDAFKLINVSASIETLYNTM 78

Query: 86  SFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCAS 145
                 K   +K            +   +GK +    + +      LG       +    
Sbjct: 79  LKNFSPKPVEKKS---------LGVVSSLGKWLYDAASSTKQSIIFLGSACCALTDVLLH 129

Query: 146 SYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSI 205
             + +     ++      G   V ++ LI F+ G +IA + A     FGA IF ++ + I
Sbjct: 130 PSQIR--FGEILSVSDEAGSRAVGIICLIGFLMGVIIAFETALVAQIFGAVIFVVNGIGI 187

Query: 206 LQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALII 265
              RE+G L+TA++ AGRSGSA  A++G+ K+NEE++A+ T GL  +  L+ PR+ A  +
Sbjct: 188 AMTRELGPLMTAILFAGRSGSAFAAQLGTQKVNEELNALTTFGLSPMYFLVVPRLIASSL 247

Query: 266 SLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIG 325
            +PLL++ A    I+G  +V+   YDI +  F+ +   + T+ +I  GL+KA      I 
Sbjct: 248 VVPLLSVFATILGILGGGLVM-AMYDITYTQFYVQLLKSVTVTDIVFGLVKAVIFGFVIA 306

Query: 326 IVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           ++  + G   G  + ++G   T  VV+SI  +++ID   A+    +GI
Sbjct: 307 LIGCQCGMNTGAGAAAVGSSTTKSVVKSIIWIVVIDGAAALLTNRLGI 354


>gi|149200416|ref|ZP_01877432.1| ABC-type transport system, permease component [Lentisphaera
           araneosa HTCC2155]
 gi|149136485|gb|EDM24922.1| ABC-type transport system, permease component [Lentisphaera
           araneosa HTCC2155]
          Length = 265

 Score =  206 bits (525), Expect = 3e-51,   Method: Composition-based stats.
 Identities = 78/265 (29%), Positives = 135/265 (50%), Gaps = 2/265 (0%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
            KNL    G+  V F  +S +    +G V         + +K K    S +  M   G  
Sbjct: 1   MKNLVSSFGRNFVGFFQESKNILAFIGEVTEELIFGIRNPHKIK--WKSTLYYMDGCGRE 58

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
              +V LI F+ G ++  Q A Q+ QFG +I+  +L+ +  ++E+G L+ A++  GR+GS
Sbjct: 59  ATGIVALICFLMGLILGFQSAVQMKQFGTDIYVANLVGLSIVKELGPLMVAMIATGRAGS 118

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A  AE+G+M++NEEIDA+ TMG    R LI P++ A+++ +P+LT++ +   I+G   V 
Sbjct: 119 AFAAELGTMRVNEEIDALTTMGFVPPRFLIIPKLIAMMVVMPILTLIGDLLGILGGFFVG 178

Query: 287 WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
                +PF  + ++        ++   + KA   A  I +V    G      +  +GK  
Sbjct: 179 VVQLKLPFIAYLNQTIKAIHYLDVMESMAKAFAFAIIISMVGCYRGMNSSSDAQGVGKAA 238

Query: 347 TTCVVQSISIVIIIDSLFAIFYFAI 371
           T+ VV  I ++I+ D+L  I +  +
Sbjct: 239 TSSVVSGIFLIIVADTLMTIIFTQL 263


>gi|239947145|ref|ZP_04698898.1| membrane protein [Rickettsia endosymbiont of Ixodes scapularis]
 gi|239921421|gb|EER21445.1| membrane protein [Rickettsia endosymbiont of Ixodes scapularis]
          Length = 261

 Score =  206 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 68/254 (26%), Positives = 130/254 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G          +S  +   +L  +IRQ+ ++G   + VV + +F +G
Sbjct: 8   SVGKRTIKFAQSVGSFSLFIFAAVSSIIRPPLYLSLIIRQLLFIGFHSLSVVAMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 68  AVLALQSYTGFSRFSAESSIATVVILSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ PR+ A II++P L ++ +   ++G  +V     D   A + +
Sbjct: 128 QVDALYTLSTDPIKYLVFPRVIAAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSAAYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I
Sbjct: 188 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILI 247

Query: 360 IDSLFAIFYFAIGI 373
            + L    +F + I
Sbjct: 248 SNYLITELFFKVQI 261


>gi|238650558|ref|YP_002916410.1| ABC transporter permease protein [Rickettsia peacockii str. Rustic]
 gi|238624656|gb|ACR47362.1| ABC transporter permease protein [Rickettsia peacockii str. Rustic]
          Length = 259

 Score =  206 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 66/252 (26%), Positives = 130/252 (51%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +   A  +G     +    +S  +   +L  +IRQ+ ++G   +PVV + +F +G
Sbjct: 8   SVGKRTVKFAQSVGSFSLFSFAAVSSIIRPPLYLSLIIRQLLFIGFHSLPVVAMTTFFSG 67

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
           AV+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G++I AEI +M++ E
Sbjct: 68  AVLALQSYIGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEIATMRVTE 127

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           ++DA+ T+  D ++ L+ PR+   II++P L ++ +   ++G  +V     D   A + +
Sbjct: 128 QVDALYTLSTDPIKYLVFPRVITAIITMPCLVLIGDIIGVMGGYLVGVYKLDFNSAAYLT 187

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV +  +++I
Sbjct: 188 STFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNASILILI 247

Query: 360 IDSLFAIFYFAI 371
            + L    +F +
Sbjct: 248 SNYLITELFFKV 259


>gi|226939556|ref|YP_002794629.1| ABC transport system permease protein [Laribacter hongkongensis
           HLHK9]
 gi|226714482|gb|ACO73620.1| putative ABC transport system permease protein [Laribacter
           hongkongensis HLHK9]
          Length = 371

 Score =  206 bits (525), Expect = 4e-51,   Method: Composition-based stats.
 Identities = 91/360 (25%), Positives = 167/360 (46%), Gaps = 10/360 (2%)

Query: 9   FRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGK 68
            R  G   +  +  I  + + A+    Q+    +D SA+T++D+ G  L+   +      
Sbjct: 16  LRLEGPLTTHSVGSIWAEALAALAAQPQTP-LTLDASAVTQLDSAGLVLLHRLLHDPRPA 74

Query: 69  IKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQ 128
                +S    +   L+       +               +    IG   +  ++     
Sbjct: 75  SAPVALSGLAAEYQPLLERIRTASL------TPPASPPPLSPVERIGAATLSGLHTGRDS 128

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
               G   S          + +G    ++  M   G   +P+V+LI F+ G ++A Q   
Sbjct: 129 VVWTGASASALWRALCRPARLEG--ARVLDIMASAGTQALPIVLLIGFLMGTILAFQMGL 186

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
               FGA +  ++ + I  LRE+G L+TA++ AGRSG+A  AE+G+ K+NEEI A+ T G
Sbjct: 187 VAQGFGAGLLVVNGIGIAMLRELGPLMTAIVFAGRSGAAFAAELGTQKVNEEIYALHTFG 246

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
           +D V  L+ PR+ A ++ LPLLT+LA+   ++G ++V+  +  +    F+ +  +T +L 
Sbjct: 247 IDPVAFLVLPRLVAAVLVLPLLTVLADVIGLLGGALVMQAF-SVTPMQFYHQTLATVSLT 305

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           +++ GL K+      I  +  ++G + G    ++G   T  VV S+  +++ID LFA   
Sbjct: 306 DLYFGLGKSMVFGLFIAQIGCRQGLSAGQGPTAVGVAATRAVVSSLIWIVVIDGLFAALL 365


>gi|51473253|ref|YP_067010.1| ABC transporter permease protein [Rickettsia typhi str. Wilmington]
 gi|81390296|sp|Q68XW4|Y041_RICTY RecName: Full=Probable ABC transporter permease protein RT0041
 gi|51459565|gb|AAU03528.1| ABC transporter permease protein [Rickettsia typhi str. Wilmington]
          Length = 259

 Score =  205 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 67/251 (26%), Positives = 131/251 (52%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
               +   A  +G+    +    +S  K   +L  ++RQ+ ++G   +PVV + +F +GA
Sbjct: 9   VGKHTIKFAQSVGIFALFSFIAISSIIKPPLYLSLIMRQLLFIGFHSLPVVAMTTFFSGA 68

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q     S+F AE     ++ +   RE+G +L  +++AGR G++I AEI +MK+ E+
Sbjct: 69  VLALQSYTGFSRFSAENSIATVVVLSLTRELGPVLAGLIVAGRVGASIAAEIATMKVTEQ 128

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+ T+  D ++ L+ PR+ A II++P L ++ +   ++G  +V     +     + + 
Sbjct: 129 VDALYTLSTDPIKYLVCPRVIAAIITMPCLVLIGDVIGVMGGYLVGIYKLNFNSTAYLTS 188

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                 L ++ +GL+KA      I I++   G+  G  +  +G+  T+ VV S  +++I 
Sbjct: 189 TFQYLELIDVISGLVKATVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVNSSILILIS 248

Query: 361 DSLFAIFYFAI 371
           + L     F +
Sbjct: 249 NYLITELLFKV 259


>gi|329113573|ref|ZP_08242353.1| Putative ABC transporter permease protein [Acetobacter pomorum
           DM001]
 gi|326697095|gb|EGE48756.1| Putative ABC transporter permease protein [Acetobacter pomorum
           DM001]
          Length = 385

 Score =  205 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 79/375 (21%), Positives = 155/375 (41%), Gaps = 16/375 (4%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           + +G+      G W        A              +  ++ +++   D+     +   
Sbjct: 24  TADGVC-LNVEGAWTVQAGG--ATPFPQDKLPIEPGHTLHINTTSLKNWDSAFVAFLWDV 80

Query: 62  ME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKI 118
            +   K       Q +    ++L +L+     +  +  +            +   +G   
Sbjct: 81  KQAASKAQLHFDEQNLPAPAQRLLALLPDAPAEPAQPPRNNE--------GIFARVGDMT 132

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +  + ++ + + +         +        +     L+  ++  G   + +V +++F+ 
Sbjct: 133 LNGLTETGTVSELALDTAKGAAQAVRGKSAMRM--KDLLLDIWNAGPDALLIVGIVNFLV 190

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           GA++A  G  +L +F AEI+  DL+ I   REI  ++TA+++AGR+G A  A I +M  N
Sbjct: 191 GAILAFVGLVELRKFAAEIYVTDLVGIACAREISAIMTAIIMAGRTGGAYAARISTMLGN 250

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           EEIDA++  G+     ++ P I +L + +PLL +     AI G   V     D+    ++
Sbjct: 251 EEIDALQVFGIPISSYILLPSIVSLALMMPLLYLYGTIVAIFGGFAVSMSMMDVSPIGYW 310

Query: 299 SRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVI 358
                   L     G IK+ F A  I + A + G   G  +  +G   T  VV  I  +I
Sbjct: 311 ISTFDGVELKEFIFGFIKSFFFASFIALAACRVGLKAGRSAADVGIAATRAVVIGIVGII 370

Query: 359 IIDSLFAIFYFAIGI 373
            +D++FA+   A+GI
Sbjct: 371 AMDAIFAVIANALGI 385


>gi|326405508|ref|YP_004285590.1| putative ABC transporter permease [Acidiphilium multivorum AIU301]
 gi|325052370|dbj|BAJ82708.1| putative ABC transporter permease protein [Acidiphilium multivorum
           AIU301]
          Length = 362

 Score =  205 bits (523), Expect = 6e-51,   Method: Composition-based stats.
 Identities = 96/368 (26%), Positives = 170/368 (46%), Gaps = 19/368 (5%)

Query: 5   GITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEK 64
              V    G   +  ++E     +     +       +DLS    IDT GA L++     
Sbjct: 13  DGPVIALTGPLTAAALTEAWPRAIAVARAA--QGVMTLDLSRAARIDTSGAALLLALERG 70

Query: 65  YHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIND 124
           + G+ + QG++   E L + +     +      P R+                    +  
Sbjct: 71  HDGETRWQGLTPAAEGLIARLRAALPETGAPPPPPRTVRGPGP--------------LRT 116

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
              +    G  I  T    A     +G   +  R     G   +P+VI++ F+ G ++A 
Sbjct: 117 LGVRIAFFGETILATTGLPARRRFLRG--GNFFRIAERAGAQALPLVIMLGFLIGMILAF 174

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q A  + QFGA+I+   L+S+   RE+G LL AV++AGR+GSA  AE+G+M +NEE+ A+
Sbjct: 175 QSAIPMRQFGADIYVAALVSLSLFRELGPLLAAVILAGRTGSAFAAELGTMMVNEEVAAL 234

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMG+D   +L+ PR+ A ++ +P L +  + S ++G   V+      P +   ++    
Sbjct: 235 TTMGIDPGTMLVIPRMAAAMLVMPALALGIDVSGVLGMGFVM-GILGFPPSAIVAQMQMA 293

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
           A+  ++  GL+K+     A+G++  + G   G    ++G+  T+ VV  I   I+ID LF
Sbjct: 294 ASPHDVLLGLMKSVVFGAAVGLIGCRAGLTAGGGPRAVGEAATSAVVGGIVATILIDGLF 353

Query: 365 AIFYFAIG 372
           A+  + +G
Sbjct: 354 AVVLYRLG 361


>gi|163797504|ref|ZP_02191455.1| hypothetical protein BAL199_23507 [alpha proteobacterium BAL199]
 gi|159177253|gb|EDP61812.1| hypothetical protein BAL199_23507 [alpha proteobacterium BAL199]
          Length = 282

 Score =  205 bits (523), Expect = 7e-51,   Method: Composition-based stats.
 Identities = 59/249 (23%), Positives = 114/249 (45%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            +   S    LG +    G       +   +   + RQ   +G   +PVV L +  +G V
Sbjct: 33  GSTFLSFLTALGRLALFAGSAVGHCVRPPIYPRLIGRQFLEIGYYSLPVVGLTTLFSGMV 92

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q     ++F AE     ++ +   RE+  +L  +M+AGR G+A+ AEIG+M++ E+I
Sbjct: 93  LALQSYSGFARFSAESAVATVVVLSITRELAPVLAGLMVAGRVGAAMAAEIGTMRVTEQI 152

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ T+  +  + LI+PR+ A  +SLP+L ++ +   + G  +V           +    
Sbjct: 153 DALTTLSTNPFKYLIAPRLIAATLSLPILVLIGDVIGVFGGYVVGVYKLGFNAGNYIQST 212

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                  ++ +GL+KA      + ++    G+     +  +G   T  VV +  +++I +
Sbjct: 213 VQFLEQIDVISGLVKAGVFGFIVALMGCYHGYHSRGGAQGVGAATTNAVVTASIMILIAN 272

Query: 362 SLFAIFYFA 370
                 +F 
Sbjct: 273 YAITELFFG 281


>gi|209964880|ref|YP_002297795.1| ABC transporter permease protein, putative [Rhodospirillum centenum
           SW]
 gi|209958346|gb|ACI98982.1| ABC transporter permease protein, putative [Rhodospirillum centenum
           SW]
          Length = 256

 Score =  205 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 63/253 (24%), Positives = 123/253 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +       G +   T    +   +   +L  + RQM  +G   +PVV L +  
Sbjct: 4   IAGIGRATLVFMEATGRLALFTAIALSHCLRPPFYLRHIGRQMIDIGYYSLPVVGLTALF 63

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A Q     S+F AE     ++ +   RE+G +L  +M+AGR G+A+ AE+G+M++
Sbjct: 64  TGMVLALQSYSGFSRFEAESAIATVVVLSITRELGPVLAGLMVAGRIGAAMAAELGTMRV 123

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E++DA+ T+  +  + L+ PR+ A  + LPLL ++A+   + G  +V     +     +
Sbjct: 124 TEQVDALTTLSTNPFKYLVVPRLLAGTLMLPLLVLVADIIGVFGGFLVGVYRLNFNAGGY 183

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            +       + ++ +GL+KA     AI ++    G+     +  +G   T  VV +  ++
Sbjct: 184 ITSTWKYLEVMDVVSGLVKAGAFGFAISLMGCYHGYHSRGGAQGVGAATTNAVVSASILI 243

Query: 358 IIIDSLFAIFYFA 370
           ++++ L    +F+
Sbjct: 244 LVLNYLLTGIFFS 256


>gi|302036233|ref|YP_003796555.1| putative toluene efflux ABC transporter ATP-binding protein
           [Candidatus Nitrospira defluvii]
 gi|300604297|emb|CBK40629.1| ABC transporter, membrane component, putative ATP-dependent toluene
           efflux transporter [Candidatus Nitrospira defluvii]
          Length = 255

 Score =  205 bits (522), Expect = 8e-51,   Method: Composition-based stats.
 Identities = 67/254 (26%), Positives = 127/254 (50%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + I +    +      +G ++       A   +    +  +++Q+ ++G     VV+L +
Sbjct: 2   EGIARIGRYTIDLTEQMGRMMLFVLSSFAWLTRPPFRVYQIVKQLNFIGYKSTFVVVLTA 61

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG V+A QG + L +FG+E      +++  +RE+G +L A+M+  R+GSA+ AEIG M
Sbjct: 62  VFTGMVLALQGHYTLRKFGSEAVLGSAVALSIIRELGPVLAALMVTARAGSAMTAEIGIM 121

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           +I E+IDA+ TM ++ ++ LI P++ A +I++PLL  L +   I G  +V  +  +    
Sbjct: 122 RITEQIDALDTMAINPLQYLIGPKLVASLIAVPLLVALFDVVGIYGGYVVGVQLLNGNEG 181

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            ++S   S     +++ G++K+      I  V   +GF     +  LG   T  VV S  
Sbjct: 182 AYWSSIESAVEWKDVYGGILKSISFGLLISWVCCYKGFHTKHSAEGLGTATTEAVVLSAV 241

Query: 356 IVIIIDSLFAIFYF 369
           ++++ D        
Sbjct: 242 LILVWDYFLTSVLL 255


>gi|258593363|emb|CBE69702.1| toluene transporter subunit: membrane component of ABC superfamily
           [NC10 bacterium 'Dutch sediment']
          Length = 247

 Score =  205 bits (522), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 81/244 (33%), Positives = 136/244 (55%)

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
              +LG +   T +    +         LIRQ+ ++GV  + +  + +  TG V+A Q A
Sbjct: 1   MLELLGGLSQLTYDTVCCACTPPFNPRELIRQVDHIGVKSISIAGVAAAFTGLVLALQTA 60

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
           + LS+FGA+ +   ++S+  +RE+G +LTA+++ GR GS I AE+GSMK+ E+IDA+R M
Sbjct: 61  YGLSRFGAKAYVGIIVSLSMVRELGPVLTALLVGGRVGSGITAELGSMKVTEQIDAMRAM 120

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           G + V+ L+ PR+ + ++ LPLLT++A+   I+G  ++    + + +  +++      TL
Sbjct: 121 GANPVKKLVVPRVLSTMLVLPLLTVMADILGILGGMVISKYEFQVDYHFYYNTVTRNLTL 180

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
           A+I +GL K       I IV   +G A    +  LGK  T  VV S   VII D     F
Sbjct: 181 ADIVSGLGKTVVFGFIIAIVGCYKGLATVGGTEGLGKATTATVVTSAIAVIISDFFLTKF 240

Query: 368 YFAI 371
           ++ +
Sbjct: 241 FWWL 244


>gi|325294995|ref|YP_004281509.1| hypothetical protein Dester_0809 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065443|gb|ADY73450.1| protein of unknown function DUF140 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 260

 Score =  205 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 70/258 (27%), Positives = 130/258 (50%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           K +      + +     G  +  + +    +++        + Q+  +G   +PV+ + S
Sbjct: 3   KLLEAIGRVTINFLEFWGSWLIISVKAIVLAFRKPIRFKHYLYQLASIGTGSLPVIAITS 62

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG VIA +      +F AE     +++I   RE+G +LTA++I  RSGSA+ AEIG+M
Sbjct: 63  LFTGGVIALETYEAFHRFNAEYMIGGVVAISMARELGPVLTALLITARSGSAMAAEIGTM 122

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           K+ E+IDA+R M ++ ++ LI+PR++  +I++ LLTI+++    IG  IV    ++I   
Sbjct: 123 KVTEQIDALRMMAVNPIKYLITPRVYTSVIAVTLLTIISDIVGYIGGYIVSVVVFNINKT 182

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
           ++     + A + +++ GLIKA      I  ++   G+     +  +G+  T  VV S  
Sbjct: 183 LYIRYTQNLAEMNDVYHGLIKAAIFGFLIATISCLYGYFTKGGAKGVGESTTKAVVVSSI 242

Query: 356 IVIIIDSLFAIFYFAIGI 373
            ++I D L         +
Sbjct: 243 SILIFDYLITFILRFFDL 260


>gi|114769304|ref|ZP_01446930.1| ABC transporter, inner membrane subunit [alpha proteobacterium
           HTCC2255]
 gi|114550221|gb|EAU53102.1| ABC transporter, inner membrane subunit [alpha proteobacterium
           HTCC2255]
          Length = 259

 Score =  205 bits (522), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 120/254 (47%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           K +    +   +    +G ++           +   +   ++ Q+  +G   +PVV L +
Sbjct: 6   KLLRSIGSSVLAFCSSVGRIVIFALNAILHLVRPPFYGREVLSQLMQIGFYSLPVVGLTA 65

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TGA +A Q      +F AE     +++I  +RE+G +L  +M+AGR  S+I AE+G+M
Sbjct: 66  LFTGAALALQIYSGGVRFSAESVVPSIVAIGMVRELGPVLGGLMVAGRVSSSIAAELGTM 125

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E++DA+ T+  D ++ L++PR+ A  I++P+L  + +   I+G  +V          
Sbjct: 126 RVTEQLDALVTLSTDPMKYLVAPRVLAATIAMPILVAVGDTIGILGGYLVGTGRLGFNSN 185

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            +         L +I +GL KA      I ++    G+  G  +  +GK     VV +  
Sbjct: 186 NYLQNTVDFMELEDITSGLAKAAVFGFIIALMGCYHGYNSGRGAQGVGKATINAVVSASV 245

Query: 356 IVIIIDSLFAIFYF 369
           +++  + +    +F
Sbjct: 246 MILAANYVLTEAFF 259


>gi|118579001|ref|YP_900251.1| hypothetical protein Ppro_0562 [Pelobacter propionicus DSM 2379]
 gi|118501711|gb|ABK98193.1| protein of unknown function DUF140 [Pelobacter propionicus DSM
           2379]
          Length = 256

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 69/252 (27%), Positives = 128/252 (50%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I    + +      LG +         +  +  G  + +++Q+ ++G   + V+ L +  
Sbjct: 5   IQAIGHSTIGSIRALGRMGWFLVHSFITMVRTPGNPVHVLKQLSFIGAKSLFVIFLTAAF 64

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+  QG + L++FG+E      +++  +RE+G +LTA+M+ GR+GSAI AEIG M+I
Sbjct: 65  TGMVLGLQGYYTLTKFGSEGMLGTAVALSLIRELGPVLTALMVTGRAGSAIAAEIGIMRI 124

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ TM LD  + LI+P++ A +I+LPLL  + +   I G  +V  K   +    +
Sbjct: 125 TEQIDALETMALDPFKYLITPKLIAAMIALPLLCAIFDTIGIYGGWLVGVKLLGVNPGAY 184

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           FS    +    ++++G  K+      I  +   +G+  G  +  + K  T  VV +  ++
Sbjct: 185 FSEMEKSVVWRDVYSGFAKSFSFGVIIAWIGCYKGYFAGHGAEGVSKATTEAVVLTSVLI 244

Query: 358 IIIDSLFAIFYF 369
           ++ D        
Sbjct: 245 LVWDYFLTSVLL 256


>gi|83311193|ref|YP_421457.1| ABC-type transport system involved in resistance to organic
           solvents [Magnetospirillum magneticum AMB-1]
 gi|82946034|dbj|BAE50898.1| ABC-type transport system involved in resistance to organic
           solvents [Magnetospirillum magneticum AMB-1]
          Length = 258

 Score =  205 bits (521), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 60/250 (24%), Positives = 119/250 (47%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
                 +    +G + + T    + + +   +   ++R+   +G   +PVV L +  TG 
Sbjct: 8   VGRVFLAFLAHVGRLSAFTAMAVSHTVRPPFYPRLILREFIEIGYFSLPVVGLTAVFTGM 67

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q     S+F AE     ++ +   RE+  +L  +M+AGR G+++ AEIG+M++ E+
Sbjct: 68  VLALQSYSGFSRFAAEGAVATVVVLSVTRELAPVLAGLMVAGRIGASMAAEIGTMRVTEQ 127

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ T+  +  + L++PRI A  + LP L ++A+   + G  IV         A + +R
Sbjct: 128 IDALTTLSTNPFKYLVAPRILAGTLMLPFLVLIADIIGVFGGYIVGVYKLGFNSATYIAR 187

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
                   ++ +GL KA      I ++    G+     +  +G   T  VV +  ++++ 
Sbjct: 188 TWEFLEPLDVISGLTKAAVFGFLITLMGCYNGYYSKGGAQGVGAATTNAVVSAAIMILVF 247

Query: 361 DSLFAIFYFA 370
           + +    +F 
Sbjct: 248 NYVITAMFFG 257


>gi|328953206|ref|YP_004370540.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328453530|gb|AEB09359.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 256

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 69/263 (26%), Positives = 137/263 (52%), Gaps = 7/263 (2%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
            K+L   +G+  + FI ++       G +     +     +       +L++Q+Y +GV 
Sbjct: 1   MKDLLRTLGRATIDFIQEA-------GRMQLFLFQTLGLFFLPPYKPFNLVKQVYVIGVR 53

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
              +++L +  TG V+  QG + L +FGAE      +++  +RE+G +LTA+M+ GR+GS
Sbjct: 54  SSSIILLTAMFTGMVLGLQGYYTLRKFGAESALGSAVALSLIRELGPVLTALMVTGRAGS 113

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           AI AEIG M+I E++DA+ TM ++ ++ ++ P++ A +I++PLLT   +F  I+G  +V 
Sbjct: 114 AITAEIGIMRITEQLDALDTMAINPMQYVVMPKVIAGLIAVPLLTAFFDFVGIVGGYLVG 173

Query: 287 WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
                +    +FS    +    ++  G +K+      + +VA  +G+     +  + +  
Sbjct: 174 VVMLGVSSGSYFSGMIQSVETLDVNGGFVKSIVFGLTVTLVACYKGYFTSHGAEGVSQST 233

Query: 347 TTCVVQSISIVIIIDSLFAIFYF 369
           T  VV +  +++  D +   F+ 
Sbjct: 234 TEAVVLAAILILGWDYVLTSFFM 256


>gi|108762257|ref|YP_631903.1| putative ABC transporter permease [Myxococcus xanthus DK 1622]
 gi|108466137|gb|ABF91322.1| putative ABC transporter, permease protein [Myxococcus xanthus DK
           1622]
          Length = 271

 Score =  204 bits (519), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 69/254 (27%), Positives = 125/254 (49%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + + +F          LG +I+   +    S +    L++L  Q+ +VGV  + +V L  
Sbjct: 18  QAVTRFGQGLIDIVSTLGGIITMGLDVFRWSVRRPFRLVNLFAQLDFVGVGSIFIVSLTG 77

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG V A Q +     F AE      +++   RE+  + +A+M+  R+GSA+  E+G+M
Sbjct: 78  TFTGMVFALQTSTAFQLFDAESLVGPTVALTLTRELAAVFSALMVTMRAGSAMCTELGTM 137

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E++DA+ TM ++ V+ L+ PR+ A +  +P LT+L N   + GA +V      I   
Sbjct: 138 RVTEQVDALETMAVNPVQYLLVPRVLAGLFMVPALTMLFNTMGMGGAYVVAVGGLGISPG 197

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            F SR        +IF GL+K      ++ ++   +GF     +  +G+  T  +V S  
Sbjct: 198 TFLSRTQQWLAPEDIFQGLLKGAVFGLSVSLICCFKGFNASGGAKGVGQATTEAMVASAL 257

Query: 356 IVIIIDSLFAIFYF 369
            + I+D +  I +F
Sbjct: 258 SIFILDFILGILFF 271


>gi|15223672|ref|NP_173410.1| TGD1 (TRIGALACTOSYLDIACYLGLYCEROL 1); lipid transporter
           [Arabidopsis thaliana]
 gi|42571555|ref|NP_973868.1| TGD1 (TRIGALACTOSYLDIACYLGLYCEROL 1); lipid transporter
           [Arabidopsis thaliana]
 gi|42571557|ref|NP_973869.1| TGD1 (TRIGALACTOSYLDIACYLGLYCEROL 1); lipid transporter
           [Arabidopsis thaliana]
 gi|75153743|sp|Q8L4R0|TGD1_ARATH RecName: Full=Protein TRIGALACTOSYLDIACYLGLYCEROL 1, chloroplastic;
           AltName: Full=ABC transporter I family member 14;
           Short=ABC transporter ABCI.14; Short=AtABCI14; Flags:
           Precursor
 gi|20465620|gb|AAM20141.1| unknown protein [Arabidopsis thaliana]
 gi|21281062|gb|AAM45069.1| unknown protein [Arabidopsis thaliana]
 gi|45680900|gb|AAS75319.1| permease-like protein [Arabidopsis thaliana]
 gi|222424205|dbj|BAH20061.1| AT1G19800 [Arabidopsis thaliana]
 gi|332191778|gb|AEE29899.1| trigalactosyldiacylglycerol 1 [Arabidopsis thaliana]
 gi|332191779|gb|AEE29900.1| trigalactosyldiacylglycerol 1 [Arabidopsis thaliana]
 gi|332191780|gb|AEE29901.1| trigalactosyldiacylglycerol 1 [Arabidopsis thaliana]
          Length = 350

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 55/232 (23%), Positives = 113/232 (48%)

Query: 139 TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIF 198
            G+      K K    + ++Q+   G   + V +L S   G     Q   + ++ G    
Sbjct: 109 AGQVVLRILKGKIHWRNTLQQLERTGPKSLGVCLLTSTFVGMAFTIQFVREFTRLGLNRS 168

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISP 258
              ++++   RE+  ++T++++AGR GSA  AE+G+M+++E+ D +R +G D +  LI+P
Sbjct: 169 IGGVLALAFSRELSPVITSIVVAGRMGSAFAAELGTMQVSEQTDTLRVLGADPIDYLITP 228

Query: 259 RIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAP 318
           R+ A  ++LP LT++     +  ++++    Y I   +     H      +I + +IK+ 
Sbjct: 229 RVIASCLALPFLTLMCFTVGMASSALLSDAVYGISINIIMDSAHRALRPWDIVSAMIKSQ 288

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
                I +++   G      +  +G+  T+ VV S+  + I D + + F+F 
Sbjct: 289 VFGAIISVISCSWGVTTTGGAKGVGESTTSAVVMSLVGIFIADFVLSSFFFQ 340


>gi|115379773|ref|ZP_01466845.1| ABC-type transport system involved in resistance to organic
           solvents [Stigmatella aurantiaca DW4/3-1]
 gi|310821468|ref|YP_003953826.1| ABC transporter permease [Stigmatella aurantiaca DW4/3-1]
 gi|115363220|gb|EAU62383.1| ABC-type transport system involved in resistance to organic
           solvents [Stigmatella aurantiaca DW4/3-1]
 gi|309394540|gb|ADO71999.1| ABC transporter, permease protein [Stigmatella aurantiaca DW4/3-1]
          Length = 272

 Score =  204 bits (518), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 60/252 (23%), Positives = 120/252 (47%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + I  F   + +    +G V     +    ++K          Q+ +VGV  + +V L  
Sbjct: 18  QAIENFGKGTIAVVSDVGGVAYLGFQVLRWAFKRPFRPQIFFSQLDFVGVGSIFIVALTG 77

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG V AQQ +   + F AE      +++   RE+  + +A+M+  R+GS++  E+G+M
Sbjct: 78  LFTGMVFAQQVSTAFALFDAESLVGPTVALTLSRELAPVFSALMVTMRAGSSMCTELGTM 137

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E++DA+ TM ++ V+ L+ PR+ + +I  P+LT+L   S + GA ++     +    
Sbjct: 138 RVTEQVDALETMAVNPVQYLLVPRVLSGLIMGPVLTMLFFTSGMSGAYMISVFVQNTSAG 197

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            F SR        +++ G +K       I ++   +G+     +  +G+  T  +V S  
Sbjct: 198 TFISRTQQWMEPLDLYEGTLKGAVFGLTITLICCYKGYNASGGAKGVGQATTEAMVSSAL 257

Query: 356 IVIIIDSLFAIF 367
            + I+D +  + 
Sbjct: 258 AIFILDFIIGVL 269


>gi|291532196|emb|CBL05309.1| conserved hypothetical integral membrane protein [Megamonas
           hypermegale ART12/1]
          Length = 256

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 70/263 (26%), Positives = 126/263 (47%), Gaps = 9/263 (3%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
                  IG+ ++  +        ++G  I+          ++   +  + +QM ++GV 
Sbjct: 2   IIRFFEKIGRFVIGHLETLGQFTILIGNTIAQL--------RYPPRMRHVFQQMSHLGVD 53

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
            +P++ L    TG VI  Q A +  + GA+     +++I   RE+G +L  V+ AGR G+
Sbjct: 54  TLPIITLTMLFTGMVITLQTATEFIRLGAQSTVGGIVTIAVGRELGPVLAGVVTAGRVGA 113

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           AI AEI +MK+ E+IDA++ M  + +  L+ PR+ A +  LP+L +  +    IG  +V 
Sbjct: 114 AITAEISTMKVTEQIDALKVMATNPIGYLVVPRLIACMFMLPILVVFGDVIGSIGGWMVA 173

Query: 287 WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
             YYDI   ++     +   + +I  GL+K+      I IV    G      +  +GK  
Sbjct: 174 E-YYDINIYMYLHSIDTFVDVHDITGGLLKSIVFGAIIAIVGCYYGLNAQNGAEGVGKAT 232

Query: 347 TTCVVQSISIVIIIDSLFAIFYF 369
           T  VV SI ++   + L ++  +
Sbjct: 233 TRSVVISIIVIFFSNCLLSMLLY 255


>gi|283853085|ref|ZP_06370341.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
 gi|283571552|gb|EFC19556.1| protein of unknown function DUF140 [Desulfovibrio sp. FW1012B]
          Length = 274

 Score =  203 bits (517), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 79/273 (28%), Positives = 134/273 (49%), Gaps = 5/273 (1%)

Query: 102 FFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMY 161
              N+       +   I        S    LG +    G+              +++Q+Y
Sbjct: 2   PRPNTMTQALALLLSPIAALGRAVLSLVAELGGLCIFMGKGLWRIVFPSPAWRKIVQQVY 61

Query: 162 YVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIA 221
           ++GV  V V++LI   TG V+  QG + L +FG+E      +++  +RE+G +LTA+MI 
Sbjct: 62  FIGVKSVFVIVLIGLFTGMVLGLQGYYTLVKFGSEGLLGAAVALSIIRELGPVLTAIMIT 121

Query: 222 GRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIG 281
           GR+GS++ AEIG M+I+E+IDA+ TMG++ +R LI+PR+ A ++  PLLT + +   I G
Sbjct: 122 GRAGSSMAAEIGIMRISEQIDALSTMGINPLRFLIAPRLAASLVCFPLLTAIFDVVGIGG 181

Query: 282 ASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV-----G 336
             +       I   V+F R  ST  L ++  G +K+   A  +  +   EG+       G
Sbjct: 182 GYLTGVVLLGINPGVYFDRIDSTVELGDVTGGFVKSLVFALLVAAICCFEGYFTHTRREG 241

Query: 337 VHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYF 369
             +  +    T+ VV S   +++ D +   F  
Sbjct: 242 FGAKGVSLATTSAVVLSCITILVADYVLTSFLL 274


>gi|126663828|ref|ZP_01734823.1| ABC transporter, permease [Flavobacteria bacterium BAL38]
 gi|126624092|gb|EAZ94785.1| ABC transporter, permease [Flavobacteria bacterium BAL38]
          Length = 261

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 126/255 (49%), Gaps = 3/255 (1%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
             I    +    +G +    G F    +K        +RQ Y++G   + +V +  F+ G
Sbjct: 7   NIIKVIKAFLIEIGEISYFAGRFFKEFWKPPYEFKEFLRQCYFIGNRSLFLVGVTGFIIG 66

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V   Q    L +FGA  +   ++S+  +REIG ++TA++ AGR GS I AE+GSMK+ E
Sbjct: 67  LVFTLQSRPTLQEFGAVSWMASMVSVSIIREIGPIITALICAGRIGSGIGAELGSMKVTE 126

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+   G +  + L+  RI A  + LPLL I  +  AI G+ +V     ++ F ++F+
Sbjct: 127 QIDAMEVSGTNPFKYLVITRILATSLMLPLLVIFGDVLAIYGSYLVENVKDNVSFQLYFN 186

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
           +  +    +++    +K  F   AIG++   +G+     +  +GK     VV +  ++ +
Sbjct: 187 QVFNILEFSDLIPATLKTFFFGFAIGLIGCYKGYYCKKGTAGVGKAANEAVVYTSMLLFV 246

Query: 360 IDSL---FAIFYFAI 371
           ID +       ++ +
Sbjct: 247 IDFIAVFVTNIFYDM 261


>gi|23014157|ref|ZP_00053989.1| COG0767: ABC-type transport system involved in resistance to
           organic solvents, permease component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 258

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 119/249 (47%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                +    +G + + T    + + +   +   ++R+   +G   +PVV L +  TG V
Sbjct: 9   GRVFLAFLAHVGRLSAFTAMAVSHTVRPPFYPRLILREFVEIGYFSLPVVGLTAVFTGMV 68

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q     S+F AE     ++ +   RE+  +L  +M+AGR G+++ AEIG+M++ E+I
Sbjct: 69  LALQSYSGFSRFAAEGAVATVVVLSVTRELAPVLAGLMVAGRIGASMAAEIGTMRVTEQI 128

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ T+  +  + L++PRI A  + LP L ++A+   + G  IV         A + +R 
Sbjct: 129 DALTTLSTNPFKYLVAPRILAGTLMLPFLVLIADIIGVFGGYIVGVYKLGFNSATYIART 188

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                  ++ +GL KA      I ++    G+     +  +G   T  VV +  ++++ +
Sbjct: 189 WEFLEPLDVISGLTKAAVFGFLITLMGCYNGYYSKGGAQGVGAATTNAVVSAAIMILVFN 248

Query: 362 SLFAIFYFA 370
            +    +F 
Sbjct: 249 YIITAMFFG 257


>gi|291287315|ref|YP_003504131.1| hypothetical protein Dacet_1405 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290884475|gb|ADD68175.1| protein of unknown function DUF140 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 256

 Score =  203 bits (516), Expect = 5e-50,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 128/249 (51%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           F N      +  G +     +     +     L  LI+Q+ ++G + + V+IL    TG 
Sbjct: 8   FGNPLVRLINATGSMSLMFFDTIRLIFVPPFRLRLLIKQIEFIGANSLSVIILTGSFTGM 67

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V A Q      +FGAE     ++++   RE+G +L+A+M+A R+GSAI AEIG+MK+ E+
Sbjct: 68  VFAFQSYIGFHKFGAEQIVGTVVALGMARELGPVLSAIMVAARAGSAITAEIGTMKVTEQ 127

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           +DA+  + +D V+ L  PRI A +I +P+L  +A F  ++G  +V      I   ++ + 
Sbjct: 128 VDALNALAVDPVQYLFVPRILAGLIVMPMLNAIAVFCGMVGGFLVSITVLGINKTLYLNY 187

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
            +     ++ F+G++KA      + +V   +G+     +  +GK  T  VV +  ++++ 
Sbjct: 188 MYQYIEFSDFFSGMVKAFVFGGIVTLVGCYKGYMTTGGAEGVGKSTTESVVLACILILVF 247

Query: 361 DSLFAIFYF 369
           D +   F F
Sbjct: 248 DYILTAFMF 256


>gi|162456584|ref|YP_001618951.1| putative ABC transport system permease protein [Sorangium
           cellulosum 'So ce 56']
 gi|161167166|emb|CAN98471.1| putative ABC transport system permease protein [Sorangium
           cellulosum 'So ce 56']
          Length = 266

 Score =  202 bits (515), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 66/252 (26%), Positives = 121/252 (48%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           + +    +    +G +++ T +      +        +  M ++G   V +V L    +G
Sbjct: 15  RALEPVLAFLDNIGNIVTLTFQTIVWLVRPPFRPAQFLAAMDFMGAQSVFIVGLTGVFSG 74

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+  Q ++ L  F AE     L+++   RE+  + +A+M+  R+GSA+ AE+G+M++ E
Sbjct: 75  MVVTLQTSYALRAFSAEGRVGGLVAVSLARELAPVFSAIMVTARAGSAMAAELGNMRVTE 134

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDAI TMG+  V+ L+SPR++A  + LPLL IL     + G+ +V   +       FF 
Sbjct: 135 QIDAIATMGVSPVQYLLSPRLFAATVMLPLLCILYTSVGMCGSYLVAVLWLGGDEGAFFQ 194

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                A   +I  GLIKA      +  ++ + GF     +  +G   T  VV+S   V++
Sbjct: 195 SIRDFALPKDISMGLIKACVFGFIVSSISCRHGFYASGGARGVGVATTRAVVESCVTVLV 254

Query: 360 IDSLFAIFYFAI 371
            + +       +
Sbjct: 255 TNYILTQLLLDM 266


>gi|319789984|ref|YP_004151617.1| protein of unknown function DUF140 [Thermovibrio ammonificans HB-1]
 gi|317114486|gb|ADU96976.1| protein of unknown function DUF140 [Thermovibrio ammonificans HB-1]
          Length = 260

 Score =  202 bits (514), Expect = 6e-50,   Method: Composition-based stats.
 Identities = 70/262 (26%), Positives = 127/262 (48%), Gaps = 7/262 (2%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
              L   +G+ ++ F           G     + +    ++K    L   I  +  +G  
Sbjct: 1   MVKLLEAVGRWVIAF-------LEFWGRWFLLSAKAVTLAFKPPLRLKRFIYYLATIGSD 53

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
            +PV+ + S  TG VIA +      +F AE     +++I   RE+  +L+A+++  RSGS
Sbjct: 54  SIPVIAVTSLFTGGVIALETYNAFHRFNAEFMIGAVVAISMARELSPVLSALLVTARSGS 113

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A+ AEIG+M++ E+IDA+  M ++ ++ LI+PRI+A  ISL  LT++A+    IG  +V 
Sbjct: 114 AMAAEIGTMRVTEQIDALEMMAVNPIKFLITPRIYATTISLVFLTVIADIIGYIGGYLVS 173

Query: 287 WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
              + +   ++     + A + ++F GLIKA      +  ++   G+     +  +G+  
Sbjct: 174 VHIFGVNKTLYLRYTQNFAHMEDVFHGLIKAAVFGFLLSTISCLYGYYTRGGAKGVGEST 233

Query: 347 TTCVVQSISIVIIIDSLFAIFY 368
           T  VV S   ++I D L     
Sbjct: 234 TKAVVSSSIAILIFDYLITYLL 255


>gi|312898371|ref|ZP_07757761.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
 gi|310620290|gb|EFQ03860.1| conserved hypothetical protein [Megasphaera micronuciformis F0359]
          Length = 264

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 73/263 (27%), Positives = 119/263 (45%), Gaps = 9/263 (3%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
            ++L   IG+  +    +    + + G  I             +      I QM ++GV 
Sbjct: 11  LQHLLERIGRFTLHIFEEVGVISVLFGQTIKQM---------PRIRRDLTINQMAHLGVD 61

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
             P+V L     G V+  Q    L ++GA+     +MS+   RE+G +LT V++AGR G+
Sbjct: 62  SFPIVALTMLFAGMVMTLQIVDILMRYGAQSTLGGIMSVAMGRELGPILTGVVVAGRVGA 121

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A+ AEIG+MK+ E+IDA+R M  D V  L+ PR  A +  +PLLT         G   V 
Sbjct: 122 AMTAEIGTMKVTEQIDALRCMATDPVAYLVVPRFVACVFMVPLLTFFGYLIGTGGGYCVA 181

Query: 287 WKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKV 346
                +    +         ++++  GLIKA      I +VA  EG      +  +G+  
Sbjct: 182 VFSAGLTDYTYMHSIEFFTEISDVLFGLIKAGVFGGIIALVACFEGMHAKSGAEGVGQAT 241

Query: 347 TTCVVQSISIVIIIDSLFAIFYF 369
           T  VV SI  + I + + ++  +
Sbjct: 242 TKSVVTSIIFIFITNYILSVILY 264


>gi|154253915|ref|YP_001414739.1| hypothetical protein Plav_3483 [Parvibaculum lavamentivorans DS-1]
 gi|154157865|gb|ABS65082.1| protein of unknown function DUF140 [Parvibaculum lavamentivorans
           DS-1]
          Length = 257

 Score =  202 bits (514), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 120/249 (48%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                +    +G +        +   +   F     +QM  +G   +PVV L +F TG  
Sbjct: 8   GRVVLALLGEIGRLSLFVWLSVSHILRPPFFWRLTAQQMLRIGYFSLPVVALTAFFTGGA 67

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q  +  + F +E     ++++   RE+G +L  +M+AGR  +AI AE+G+M++ E+I
Sbjct: 68  LALQIYYGGNSFNSESIVATIVALGITRELGPVLGGLMVAGRVSAAIAAELGTMRVTEQI 127

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+ T+  +  + L+ PR+ A +I+LPLL ++A+   I+G  +V     D    V+    
Sbjct: 128 DALTTLSTNPHKYLVVPRVVAAVITLPLLVLVADIIGIMGGYVVGTASLDFNGGVYIKNT 187

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L ++ +GLIKA      I ++    GF     +  +G+  T  VV +  +++  +
Sbjct: 188 ADFLKLDDVTSGLIKAAVFGFIIAVMGCFHGFNSKGGAQGVGRATTNAVVTASILILAAN 247

Query: 362 SLFAIFYFA 370
            +     FA
Sbjct: 248 YVMTSLLFA 256


>gi|32474659|ref|NP_867653.1| ABC transporter permease [Rhodopirellula baltica SH 1]
 gi|32445198|emb|CAD75200.1| probable permease of ABC transporter [Rhodopirellula baltica SH 1]
          Length = 296

 Score =  202 bits (514), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 119/256 (46%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + I+++          +G +   T +     +       +++   Y VGV  +PVV L  
Sbjct: 29  RWIMQWGTAVVGGVTAVGDLAMFTWQMFVWMFTRMPRRDTVLVNFYQVGVLSLPVVALTG 88

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
              G V+A Q  +Q    G E     +++   +RE+G +L A M+AGR G A+ A +G+M
Sbjct: 89  SFIGMVLAVQSYYQFHTIGLETHLGVVINTSLVRELGPVLAATMLAGRVGGAMAAVLGTM 148

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E+IDA+ TMG D +  L+ PR  A ++ +P LTI+A+F  I+G          I  A
Sbjct: 149 RVTEQIDALTTMGADPIHYLVVPRFMACLLLIPALTIVADFMGIVGGYFYSVIILGIDRA 208

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            +           ++F G+ K+ F    I I++   GF     +  +GK  T   V S  
Sbjct: 209 AYLHHSREGVVAFDLFNGIFKSIFFGGVIAIISCYRGFNCQPGAEGVGKAATEAFVYSFV 268

Query: 356 IVIIIDSLFAIFYFAI 371
           +++ ID    I    +
Sbjct: 269 MILAIDLFLNIVLDWV 284


>gi|83593780|ref|YP_427532.1| hypothetical protein Rru_A2445 [Rhodospirillum rubrum ATCC 11170]
 gi|83576694|gb|ABC23245.1| Protein of unknown function DUF140 [Rhodospirillum rubrum ATCC
           11170]
          Length = 389

 Score =  202 bits (513), Expect = 8e-50,   Method: Composition-based stats.
 Identities = 82/372 (22%), Positives = 161/372 (43%), Gaps = 4/372 (1%)

Query: 3   ENGITVFRFAGNWKSPEIS-EIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           E   +V   +G+W + +     A ++   +       S   D+S +   D+         
Sbjct: 21  EGADSVVVLSGDWLASQTGLRSAVEITRLLGDGAVKGSLRYDVSGLGRWDSALVAF-ARM 79

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
           M    G+   +  +     L        +    N+    +    +  ++   +G   + F
Sbjct: 80  MRAAAGEGANKRFTLDESTLPEAALRLLKLAETNEPLPSASGDKAAASVVARVGHGTLGF 139

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
             +  + A ++G  +             +     ++  M   G + + +V +++ + GA+
Sbjct: 140 GAELGAIATLVGESVFGVARGLGGRAFTRSV--DILHLMREAGANALVIVAIVNGLIGAI 197

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA QL +FGA IF  DL+ I  +RE+  ++TA+++AGR+G A  A + +M+ NEEI
Sbjct: 198 LAFVGAVQLQRFGAGIFVADLVGIAMVREMAAVMTAIVMAGRTGGAYAAHLATMQGNEEI 257

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA++ +G+     L+ PR+ AL+  +PLL +      ++G  +V     D+    F  + 
Sbjct: 258 DALKVLGIPAYDFLVLPRVVALVTMMPLLYLYGCAIGLLGGFVVSLAILDMSATTFLDQI 317

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                      GL+K+      + +     G   G  +  +G+  T+ VV  I  VI +D
Sbjct: 318 QGAIAGRQFAIGLVKSVAFGFLVALAGCHIGLRAGRSAADVGRAATSAVVVGIVGVIALD 377

Query: 362 SLFAIFYFAIGI 373
           ++FA+    +GI
Sbjct: 378 AVFAVCADRLGI 389


>gi|195952743|ref|YP_002121033.1| protein of unknown function DUF140 [Hydrogenobaculum sp. Y04AAS1]
 gi|195932355|gb|ACG57055.1| protein of unknown function DUF140 [Hydrogenobaculum sp. Y04AAS1]
          Length = 246

 Score =  202 bits (513), Expect = 9e-50,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 123/243 (50%)

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                + LG             +K +  +   + ++ Y+G   VPVV+  S  TG V+A 
Sbjct: 1   MVEFINALGEAFYIFLTALLHIFKDRPKIRHFVDRVIYIGADTVPVVVTTSLFTGGVLAL 60

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q    L +F +E     L+++   RE+G +LT++M+  R GSAI A IG+MK+ E+IDA+
Sbjct: 61  QTYSTLHKFNSEYLIGALVALSMGRELGPVLTSLMVVARVGSAITASIGTMKVTEQIDAL 120

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            T+ ++    + SP ++A ++ LPLLTIL++ S IIG  +V    + +   +++ +    
Sbjct: 121 ETLAINPYAYITSPILFACMVDLPLLTILSDISGIIGGYLVSTIIFHVNGHMYWDKTKEI 180

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               +I+ GL KA      I  V+   GF     +  +G+  T+ VV S  +++I+D   
Sbjct: 181 VDFYDIYGGLYKAFVYGIVIATVSNYFGFKTSGGNQGVGRATTSSVVISSMLILILDYFL 240

Query: 365 AIF 367
              
Sbjct: 241 TAI 243


>gi|327540665|gb|EGF27237.1| ABC transporter permease protein [Rhodopirellula baltica WH47]
          Length = 296

 Score =  202 bits (513), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 70/256 (27%), Positives = 119/256 (46%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + I+++          +G +   T +     +       +++   Y VGV  +PVV L  
Sbjct: 29  RWIMQWGTAVVGGVTAVGDLAMFTWQMFVWMFTRMPRRDTVLVNFYQVGVLSLPVVALTG 88

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
              G V+A Q  +Q    G E     +++   +RE+G +L A M+AGR G A+ A +G+M
Sbjct: 89  SFIGMVLAVQSYYQFHTIGLETHLGVVINTSLVRELGPVLAATMLAGRVGGAMAAVLGTM 148

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E+IDA+ TMG D +  L+ PR  A ++ +P LTI+A+F  I+G          I  A
Sbjct: 149 RVTEQIDALTTMGADPIHYLVVPRFMACLLLIPALTIVADFMGIVGGYFYSVIILGIDRA 208

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            +           ++F G+ K+ F    I I++   GF     +  +GK  T   V S  
Sbjct: 209 AYLHHSREGVVAFDLFNGIFKSIFFGGVIAIISCYRGFNCQPGAEGVGKAATEAFVYSFV 268

Query: 356 IVIIIDSLFAIFYFAI 371
           +++ ID    I    +
Sbjct: 269 MILAIDLFLNIVLDWV 284


>gi|46579657|ref|YP_010465.1| hypothetical protein DVU1246 [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46449072|gb|AAS95724.1| membrane protein, putative [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|311233455|gb|ADP86309.1| protein of unknown function DUF140 [Desulfovibrio vulgaris RCH1]
          Length = 267

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 129/257 (50%), Gaps = 5/257 (1%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +             LG +     +     +     L  ++ Q+Y +G   + V++LI   
Sbjct: 11  VTALGRSFLRLLGELGAMFIFMLDGFRHIFASTKQLPKIVNQVYVIGYKSLFVILLIGIF 70

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+  QG + L +FG+E      +++  +RE+G +LTA+M+ GR+GS++ AEIG M+I
Sbjct: 71  TGMVLGLQGYYTLVKFGSEGLLGAAVALTLIRELGPVLTAIMVTGRAGSSMAAEIGVMRI 130

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            ++IDA+  M ++ +  L+SPRI A +++ PLLT L +   IIG  +       I   V+
Sbjct: 131 TDQIDALDVMDINPMGYLVSPRIAASLVAFPLLTALFDVIGIIGGYVTGVMLLGINEGVY 190

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV-----GVHSNSLGKKVTTCVVQ 352
           F R  ++  LA++  G +K+   A  +  V+  +G+       G+    +    T+ VV 
Sbjct: 191 FHRIATSVELADVTGGFMKSLLFALIVSTVSCYQGYFTHMRRDGMGPEGVSNSTTSAVVM 250

Query: 353 SISIVIIIDSLFAIFYF 369
           S  +V++ D +   F  
Sbjct: 251 SCVLVLVADYVLTSFLL 267


>gi|149907972|ref|ZP_01896640.1| membrane protein, putative [Moritella sp. PE36]
 gi|149808978|gb|EDM68909.1| membrane protein, putative [Moritella sp. PE36]
          Length = 262

 Score =  201 bits (512), Expect = 1e-49,   Method: Composition-based stats.
 Identities = 78/254 (30%), Positives = 130/254 (51%), Gaps = 5/254 (1%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
               + +     G             +        +I Q+Y++G   + V+ +    TG 
Sbjct: 9   LGRATLALLQGFGKATLFLIHSVVHMFSRPWQWRRVIEQLYFIGAKSIIVICVTGLFTGM 68

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+  QG + LS+FG+       +++  +RE+G +LTA+MI GR+GSA+ AEIG M+I+E+
Sbjct: 69  VLGLQGYYTLSKFGSTGLLGSAVALTLIRELGPVLTAIMIIGRAGSAMTAEIGIMRISEQ 128

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA++TM +D +R L+SPRI A +IS PLLT + +   I G  +   +   I  A +F R
Sbjct: 129 IDALKTMTIDPIRFLVSPRIIAALISFPLLTAIFDTVGIFGGYLTGSQLLGINPATYFYR 188

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG-----VHSNSLGKKVTTCVVQSIS 355
             S+  +A++  G IK+ F +  +  V    G+          +  +G   TT VVQ+  
Sbjct: 189 VESSVIMADVAGGFIKSIFFSITVITVCCYHGYYTHIRRDNFGAKGVGLSTTTAVVQASI 248

Query: 356 IVIIIDSLFAIFYF 369
           +V++ID +   F  
Sbjct: 249 LVLVIDYILTTFLL 262


>gi|87311113|ref|ZP_01093237.1| probable permease of ABC transporter [Blastopirellula marina DSM
           3645]
 gi|87286204|gb|EAQ78114.1| probable permease of ABC transporter [Blastopirellula marina DSM
           3645]
          Length = 280

 Score =  201 bits (511), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 115/255 (45%)

Query: 112 YHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVV 171
                 I  +          +G +           +       +L+   Y VGV  +PVV
Sbjct: 6   EAFFNWIADWGTLGIEFTIAVGDMSLFALRTMQWLFNRLPKRETLVPNFYQVGVMSLPVV 65

Query: 172 ILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAE 231
            L     G V+A Q  FQ  Q G E     ++++  +RE+G +L A M+AGR GSA+ AE
Sbjct: 66  ALTGTFIGMVLAVQSYFQFRQLGLETRLGAVINMTLVRELGPVLAATMLAGRVGSAMAAE 125

Query: 232 IGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYD 291
           +G+M++ E+IDA+ +MG + +  L+ PR  A +I +P LT++A+F   +G          
Sbjct: 126 LGTMRVTEQIDALDSMGTNPIHYLVVPRFLACVILIPALTVMADFMGFVGGYFYSVNILG 185

Query: 292 IPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVV 351
           I    +           +IF GLIK+ F    I IV+   GF     +  +G+  T   V
Sbjct: 186 IDQHYYMYNSEQFVQSWDIFYGLIKSVFFGGTIAIVSCHRGFHCEAGAEGVGRAATAAFV 245

Query: 352 QSISIVIIIDSLFAI 366
            S   ++ ID    I
Sbjct: 246 YSFVFILAIDLALGI 260


>gi|302341646|ref|YP_003806175.1| hypothetical protein Deba_0204 [Desulfarculus baarsii DSM 2075]
 gi|301638259|gb|ADK83581.1| protein of unknown function DUF140 [Desulfarculus baarsii DSM 2075]
          Length = 244

 Score =  200 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 71/244 (29%), Positives = 122/244 (50%)

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                  G ++    +      +    +  +++QM +VG   + VV+L    TG V A Q
Sbjct: 1   MGGLSEAGEIVLLLAQAALWLLRPPWRMRLVLKQMEFVGNKSINVVMLTGAFTGGVFALQ 60

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
             +  S FGAE      +++   RE+G +LT++M+ GR+GSA+ AEIG+M++ E+IDA+ 
Sbjct: 61  SYYGFSLFGAESLVGSTVALALTRELGPVLTSLMVTGRAGSAMAAEIGTMRVTEQIDALY 120

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            M ++ V+ L+ PR+ A +I LP LTI+ANF  I+G   V      I   VF ++     
Sbjct: 121 VMAVNPVQYLVLPRVLAAVIMLPALTIVANFIGILGGYAVGVGMLGINEGVFVAKIIEYV 180

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
              +I  GL+K+      + ++   +GF     +  +G+  T  VV +  +++  D    
Sbjct: 181 EFDDIGMGLVKSAIFGLILSLIGCYKGFYTSGGAEGVGRATTEAVVLASVLILAADYALT 240

Query: 366 IFYF 369
              F
Sbjct: 241 AIMF 244


>gi|42520801|ref|NP_966716.1| hypothetical protein WD0989 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410541|gb|AAS14650.1| membrane protein, putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 260

 Score =  200 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 114/251 (45%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +        +    LG       +          +  ++ RQ+  +G   +P+V L   
Sbjct: 8   SVRIIGRYFINFLLRLGSAFIFFIQSLYHCLVPPYYFSNIARQIIEIGFFSLPIVGLTGV 67

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
             GA I  Q +        E     L++I  ++E+G +L ++++ G+ GS++ AEIG+M+
Sbjct: 68  FIGAAIVLQSSLSDPSINQEQIIPKLVTITIIKELGPVLISLIMVGKVGSSVAAEIGTMR 127

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           I E+IDA+ T+ ++  + LI+PRI A II  P+LT+ A+   I G  I     ++    +
Sbjct: 128 ITEQIDALTTLNINPFKYLIAPRILASIIVFPILTVCADLIGIFGGCITAVFEFNHNLNI 187

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +           +  TGLIKA      I + +   G+     +  +G   T+ VV S  +
Sbjct: 188 YIKHTAQFFNTYDFITGLIKATAFGAIISVSSCYYGYHCKEGARGVGVATTSTVVLSSIL 247

Query: 357 VIIIDSLFAIF 367
           +I+ + +  + 
Sbjct: 248 IILANYMITLI 258


>gi|149194581|ref|ZP_01871677.1| abc transporter, permease protein [Caminibacter mediatlanticus
           TB-2]
 gi|149135325|gb|EDM23805.1| abc transporter, permease protein [Caminibacter mediatlanticus
           TB-2]
          Length = 259

 Score =  200 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 66/255 (25%), Positives = 111/255 (43%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           K +      + +     G             +     +  L  Q+Y++G   + V+ L S
Sbjct: 4   KLLDNIGTFTLNLIKGFGDFTLFQFNILKLIFTPPYRIKELFNQIYFMGYGSLGVIFLTS 63

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
           F TG V A Q      +FG E F    + I  ++E+G +  ++M+  R  SA  AE+GSM
Sbjct: 64  FFTGLVEAVQLYNGFHKFGVEDFMGYTIFISIVKELGPVFASLMVISRGISAYAAELGSM 123

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           K+ E+IDA+  M ++  + LI PRI A IISLPLL +  +  + IGA ++      +   
Sbjct: 124 KVTEQIDALEVMAVNSKQYLIVPRILATIISLPLLILFFDAVSNIGAYLISTYSLGVNGF 183

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            +         + +I  G+IK       I  +    G+     +  +G+  T  VV S  
Sbjct: 184 AYLDHIRQFGEIRDIIEGVIKGAVFGYIISAIGTYIGYNTRGGAKGVGQSTTKAVVYSSV 243

Query: 356 IVIIIDSLFAIFYFA 370
            V + D + +  +  
Sbjct: 244 AVFVADYVLSAIFLV 258


>gi|297844946|ref|XP_002890354.1| hypothetical protein ARALYDRAFT_472206 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297336196|gb|EFH66613.1| hypothetical protein ARALYDRAFT_472206 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 350

 Score =  200 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 55/232 (23%), Positives = 113/232 (48%)

Query: 139 TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIF 198
            G+      K K    + ++Q+   G   + V +L S   G     Q   + ++ G    
Sbjct: 109 AGQVVLRILKGKIHWRNTLQQLERTGPKSLGVCLLTSTFVGMAFTIQFVREFTRLGLNRS 168

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISP 258
              ++++   RE+  ++T++++AGR GSA  AE+G+M+++E+ D +R +G D +  LI+P
Sbjct: 169 IGGVLALAFSRELSPVITSIVVAGRMGSAFAAELGTMQVSEQTDTLRVLGADPIDYLITP 228

Query: 259 RIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAP 318
           R+ A  ++LP LT++     +  ++++    Y I   +     H      +I + +IK+ 
Sbjct: 229 RVIASCLALPFLTLMCFTVGMASSALLSDAVYGISINIIMDSAHRALRPWDIVSAMIKSQ 288

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
                I +++   G      +  +G+  T+ VV S+  + I D + + F+F 
Sbjct: 289 VFGAIISVISCSWGVTTTGGAKGVGESTTSAVVMSLVGIFIADFVLSSFFFQ 340


>gi|225433662|ref|XP_002265320.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 474

 Score =  200 bits (510), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 57/236 (24%), Positives = 111/236 (47%)

Query: 135 VISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFG 194
           V    G+        K   ++ ++Q+  VG   V V IL +   G     Q   + ++ G
Sbjct: 229 VFIMAGQVIIRILTGKVHWVNTLQQLERVGPRSVGVCILTAAFVGMAFTIQFVREFTRLG 288

Query: 195 AEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRI 254
                  ++++   RE+  ++T++++AGR GSA  AE+G+M+++E+ D +R +G + V  
Sbjct: 289 LNRSVGGVLALAFSRELSPVVTSIVVAGRIGSAFAAELGTMQVSEQTDTLRVLGTNPVDY 348

Query: 255 LISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGL 314
           L++PR+ A  I+LP LT+L     +  ++++    Y I   +            +I + +
Sbjct: 349 LVTPRVIASCIALPFLTLLCFTVGMASSALLADSVYGISINIILDSAQRALNSWDIISAM 408

Query: 315 IKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           IK+      I  V+   G      +  +G+  T+ VV S+  + I D   +  +F 
Sbjct: 409 IKSVAFGGIISTVSCAWGVTTMGGAKGVGESTTSAVVISLVGIFIADFALSYCFFQ 464


>gi|58697152|ref|ZP_00372577.1| ABC transporter permease protein RC0129 [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58698663|ref|ZP_00373555.1| ABC transporter permease protein RC0129 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58699132|ref|ZP_00373959.1| ABC transporter permease protein RC0129 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|225630652|ref|YP_002727443.1| hypothetical protein WRi_009360 [Wolbachia sp. wRi]
 gi|58534353|gb|EAL58525.1| ABC transporter permease protein RC0129 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534816|gb|EAL58923.1| ABC transporter permease protein RC0129 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58536541|gb|EAL59904.1| ABC transporter permease protein RC0129 [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|225592633|gb|ACN95652.1| hypothetical protein WRi_009360 [Wolbachia sp. wRi]
          Length = 260

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 61/251 (24%), Positives = 114/251 (45%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +        +    LG       +          +  ++ RQ+  +G   +P+V L   
Sbjct: 8   SVRIIGRYFINFLLRLGSAFIFFIQSLYHCLVPPYYFSNVARQIIEIGFFSLPIVGLTGV 67

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
             GA I  Q +        E     L++I  ++E+G +L ++++ G+ GS++ AEIG+M+
Sbjct: 68  FIGAAIVLQSSLSDPLINQEQIIPKLVTITIIKELGPVLISLIMVGKVGSSVAAEIGTMR 127

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           I E+IDA+ T+ ++  + LI+PRI A II  P+LT+ A+   I G  I     ++    +
Sbjct: 128 ITEQIDALTTLNINPFKYLIAPRILASIIVFPILTVCADLIGIFGGCITAVFEFNHNLNI 187

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +           +  TGLIKA      I + +   G+     +  +G   T+ VV S  +
Sbjct: 188 YIKHTAQFFNTYDFITGLIKATVFGAIISVSSCYYGYHCKEGARGVGVATTSTVVLSSIL 247

Query: 357 VIIIDSLFAIF 367
           +I+ + +  + 
Sbjct: 248 IILANYMITLI 258


>gi|116619717|ref|YP_821873.1| hypothetical protein Acid_0582 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116222879|gb|ABJ81588.1| protein of unknown function DUF140 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 265

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 74/239 (30%), Positives = 132/239 (55%)

Query: 134 LVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQF 193
                 G+   + ++   +   +I QM  +GV  +P+V+L  F +GAV+A Q +  L+Q+
Sbjct: 25  EFFVLAGKAFQNIFRRPHYGDDIILQMDTIGVGSLPIVVLTGFFSGAVMALQMSRALAQY 84

Query: 194 GAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVR 253
           G    +  ++S+   RE+G +LTA+M+AGR+ S I +E+GSMK+ E+IDA+R +G D V+
Sbjct: 85  GQVGKTGTVVSVTLARELGPVLTALMVAGRNASGIASELGSMKVTEQIDAMRALGTDPVQ 144

Query: 254 ILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTG 313
            L++PR+ A  + LPLLTI+A+F  + G  I+   + ++P   +++         ++  G
Sbjct: 145 KLVTPRLIATGVMLPLLTIIADFVGMFGGFIIAKFFLNLPPRQYWTSVWRALEWNDVTQG 204

Query: 314 LIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           L+K    A  I +V    G      +  +G+  T  VV +  +V ++D L    + + G
Sbjct: 205 LLKPLIFAIVISLVGCFYGLRTTGGTQGVGRSTTQAVVLATVLVFVLDLLITKIFVSQG 263


>gi|223940418|ref|ZP_03632271.1| protein of unknown function DUF140 [bacterium Ellin514]
 gi|223890913|gb|EEF57421.1| protein of unknown function DUF140 [bacterium Ellin514]
          Length = 259

 Score =  200 bits (509), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 72/249 (28%), Positives = 124/249 (49%)

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                    LG +   T E  +S +  KG   + I Q+Y++GV    VV++    TG V+
Sbjct: 7   RFVAEWLQGLGRISLLTKEALSSLFSLKGSWGNFIYQLYFIGVKSQSVVLITGAFTGMVL 66

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
             Q  +Q  Q   +  ++ ++S+    E+G +LTA+M+AGR G+A+ AEIG+MK+ E++D
Sbjct: 67  CAQTYYQFHQVKLDTATLAVVSVSMCSELGPVLTALMVAGRVGAAMAAEIGTMKVTEQVD 126

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+RT+    V  L+ PR+ A ++SLPLLT  A    II   +V      I     ++   
Sbjct: 127 ALRTLATHPVDYLVVPRLTASVVSLPLLTAEAIAVGIISGYMVGVYLLGIDPVYSYTNML 186

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                +++ TG+IK+      I I+   +G   G  +  +G+  T  VV +   ++I + 
Sbjct: 187 KYTNSSDVMTGIIKSVIFGVIIAIIGCYKGMTCGEGAEGVGRATTEAVVYASITILISNF 246

Query: 363 LFAIFYFAI 371
              +    +
Sbjct: 247 FLTLCLKEL 255


>gi|296532300|ref|ZP_06895039.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Roseomonas cervicalis
           ATCC 49957]
 gi|296267376|gb|EFH13262.1| toluene tolerance efflux ABC superfamily ATP binding cassette
           transporter, membrane protein [Roseomonas cervicalis
           ATCC 49957]
          Length = 261

 Score =  200 bits (508), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 60/254 (23%), Positives = 121/254 (47%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +              G +     E  +   +   +    +R    +G   +PVV L + 
Sbjct: 7   ALAAIGRGVLGACRAAGAIALFAVEGVSHLVRPPFYPRLFLRAFVEIGYFSLPVVSLTAI 66

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
            TG V+A Q     S+FGAE    +++ +   RE+G +L  +M+AGR G+A  AEIG+M+
Sbjct: 67  FTGMVLALQSYSGFSRFGAESAIANVVVLSITRELGPVLAGLMVAGRIGAAFAAEIGTMR 126

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + ++IDA+ T+  + ++ L++PR+ A  +++PLL ++A+   ++G  ++         A 
Sbjct: 127 VTDQIDALTTLSTNPMKYLVAPRLLAGTLAMPLLVVVADILGVMGGWLIGTAQLGFTSAS 186

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           + +   +     ++ +GL+KA      I ++    G+     +  +G   T  VV S  +
Sbjct: 187 YLTSTLNFVQPMDVISGLVKAAVFGFTITLMGCYSGYNSRGGAQGVGAATTRAVVASSIL 246

Query: 357 VIIIDSLFAIFYFA 370
           ++ +D +    +F 
Sbjct: 247 ILALDYILTAMFFG 260


>gi|15606674|ref|NP_214054.1| hypothetical protein aq_1530 [Aquifex aeolicus VF5]
 gi|2983906|gb|AAC07457.1| hypothetical protein aq_1530 [Aquifex aeolicus VF5]
          Length = 340

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 101/366 (27%), Positives = 173/366 (47%), Gaps = 33/366 (9%)

Query: 8   VFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHG 67
           V +  G   +  I  +           I  +   +DLS + ++DT GA  +   +++ + 
Sbjct: 8   VLKVEGELTAENIKSL----------KIPKNIEKIDLSDLKKLDTFGATFLALLIKENNI 57

Query: 68  KIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCS 127
            ++         +L  L+    +   +  + + SF                   + +  S
Sbjct: 58  PLERVEGGEKHVELIKLVLDNLKLPKEIPEKKVSFS------------------LKNLFS 99

Query: 128 QAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGA 187
               LGL + ++ ++            +  +++   G+  V +++ +SF+ G VIA Q A
Sbjct: 100 FPEFLGLFLIHSFKYIKQ-----FEFSAFFKELQTSGLGSVLILVSLSFLIGVVIAYQSA 154

Query: 188 FQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTM 247
            QL  FGA IF +DL+ I   RE+  LLT +++AGR  S   A +G  KINEEIDA+R M
Sbjct: 155 VQLRAFGAGIFIVDLVGISTFRELAPLLTGIILAGRVSSGYTANVGLRKINEEIDALRVM 214

Query: 248 GLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATL 307
           GL  V +L+ PR+ A +I  PLLT L+  + ++G +I+   +  I    FF +       
Sbjct: 215 GLSPVVLLVLPRVLASLIYTPLLTSLSAVAMLLGGAIIAQVFLGIGVEEFFKKLPEAVAK 274

Query: 308 ANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIF 367
            ++F G +K PF   AI +  +  GF       SLG  V   VV  IS++I++D++F+I 
Sbjct: 275 EDLFAGYVKTPFFGVAIALNGVYYGFLTDPKPESLGYSVMRSVVTGISVIILLDAVFSII 334

Query: 368 YFAIGI 373
           +  +GI
Sbjct: 335 FLRLGI 340


>gi|78357340|ref|YP_388789.1| hypothetical protein Dde_2297 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78219745|gb|ABB39094.1| Protein of unknown function DUF140 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. G20]
          Length = 270

 Score =  200 bits (508), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 129/254 (50%), Gaps = 5/254 (1%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
              ++      LG V+    +     +        +++Q+Y++G   + V+ LI   TG 
Sbjct: 17  LGRNTLRFIGELGAVLLFFLDAVRHIFIASRLFRKVVQQVYFIGSKSLFVIALIGIFTGM 76

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+  QG + L +FG+E      +++  +RE+G +LTA+M+ GR+GSA+ AEIG M+I+++
Sbjct: 77  VLGLQGYYTLVKFGSEGLLGAAVALTLIRELGPVLTAIMVTGRAGSAMAAEIGVMRISDQ 136

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+  M +  +  L++PR+ A +I  P+LT L N   IIG  +       I   V+F R
Sbjct: 137 IDALEVMDVPPMGYLVTPRLLASLIVFPMLTALFNTIGIIGGYLTGVVLLGINSGVYFYR 196

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV-----GVHSNSLGKKVTTCVVQSIS 355
             S+   +++  G +K    A  + I++  +G+       G+    +    T+ VV S  
Sbjct: 197 IDSSVGWSDVSGGFLKTMVFAVIVSIISCYQGYFTHMRKDGMGPEGVSNSTTSAVVMSCV 256

Query: 356 IVIIIDSLFAIFYF 369
           +V++ D +   F  
Sbjct: 257 LVLVSDYVLTSFLL 270


>gi|190571416|ref|YP_001975774.1| hypothetical protein WPa_1028 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|190357688|emb|CAQ55136.1| Putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
          Length = 260

 Score =  199 bits (507), Expect = 4e-49,   Method: Composition-based stats.
 Identities = 59/251 (23%), Positives = 115/251 (45%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +        +    +G       +     +    +  ++ RQ+  +G   +P+V L   
Sbjct: 8   SVRIIGRCFMNFLLRIGNAFVFFIQSLYHCFIPPYYFSNVARQIIEIGFFSLPIVGLTGV 67

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
             GAVI  Q +        E     L++I  ++E+G +L ++++ G+ GS+I AEIG+M+
Sbjct: 68  FIGAVIVLQSSLSGILINQEQVVPKLVTITIIKELGPVLISLIMVGKVGSSIAAEIGTMR 127

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           I E+IDA+ T+ ++  + LI PRI A +I  P+LT+ A+   I G  +     ++    +
Sbjct: 128 ITEQIDALTTLDINPFKYLIVPRILASVIVFPILTVCADLIGIFGGYVTAVFEFNHNLNI 187

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +         + +   GL+KA      I + +   G+     +  +G   T+ VV S  +
Sbjct: 188 YIKYTAQFFNMYDFIVGLMKATAFGAIISVSSCYYGYHCREGARGVGIATTSTVVISSIL 247

Query: 357 VIIIDSLFAIF 367
           +I+ + L  + 
Sbjct: 248 IILANYLITLI 258


>gi|85703132|ref|ZP_01034236.1| ABC transporter, inner membrane subunit [Roseovarius sp. 217]
 gi|85672060|gb|EAQ26917.1| ABC transporter, inner membrane subunit [Roseovarius sp. 217]
          Length = 261

 Score =  199 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 54/253 (21%), Positives = 115/253 (45%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +        +    +G +     +  +   +   +    +  +  +G   +PVV + +  
Sbjct: 8   LASIGRTVLNGLASMGRIALFASDTLSHLARPPFYWREFLHALVQIGWLSLPVVGMTALF 67

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG  +A Q     ++F AE     +++I   RE+G +L  +M+A R  S+I AEIG+MK+
Sbjct: 68  TGGALALQIYAGGARFNAETVVPSIVAIGLTRELGPVLGGLMVAARVASSIAAEIGTMKV 127

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  + ++ L  PR+ A  +++P+L  + +   I+G  +V     D   A +
Sbjct: 128 TEQIDALTTLSTNPMKYLTLPRVLAATLAVPVLVGVGDVIGIMGGFLVGVGRLDFSAATY 187

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                      ++ +GLIK       + ++    G   G  +  +G+   + VV +  ++
Sbjct: 188 LHNTMDFLETWDVVSGLIKGAAFGFIVALMGCYYGMNSGRGAQGVGRATKSAVVAASVLI 247

Query: 358 IIIDSLFAIFYFA 370
           +  + +    +F+
Sbjct: 248 LASNYILTEVFFS 260


>gi|327399719|ref|YP_004340588.1| hypothetical protein Hipma_1573 [Hippea maritima DSM 10411]
 gi|327182348|gb|AEA34529.1| protein of unknown function DUF140 [Hippea maritima DSM 10411]
          Length = 254

 Score =  199 bits (507), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 68/261 (26%), Positives = 111/261 (42%), Gaps = 8/261 (3%)

Query: 109 NLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGV 168
            +   IG+  + F  D      +    I    E        K        QMY++GV   
Sbjct: 2   GIIAAIGRFTINFTRDMGGVFLLFISTIKALFE--------KPRFHLTAEQMYFIGVKST 53

Query: 169 PVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAI 228
            +V L S   G V   Q      +FGAE      +++   RE+  +LTA+MI  R+ SA+
Sbjct: 54  LIVALTSMFVGMVEVLQIYHGFHKFGAESMIGYTVAVSLGRELSPVLTALMIVARNVSAM 113

Query: 229 VAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWK 288
            AE+G+M++ ++IDA+  M ++ +  L++PR+ A  + LP L  L+N    IG  +V   
Sbjct: 114 AAELGTMRVTQQIDALEVMAVNPINFLVAPRVIATTVMLPALVSLSNAIGNIGGYLVGIG 173

Query: 289 YYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTT 348
              +    +         + ++  GLIKA      I ++    G      S  +G   T 
Sbjct: 174 VLGLNPTSYTKNIQVYIDMTDLTYGLIKAAVFGLIISLIGCYMGLTTKGGSRGVGISTTK 233

Query: 349 CVVQSISIVIIIDSLFAIFYF 369
            VV +   V++ D     F F
Sbjct: 234 AVVAASISVLVADYFLTAFLF 254


>gi|218961384|ref|YP_001741159.1| hypothetical protein CLOAM1090 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167730041|emb|CAO80953.1| conserved hypothetical protein; putative membrane protein
           [Candidatus Cloacamonas acidaminovorans]
          Length = 263

 Score =  199 bits (506), Expect = 6e-49,   Method: Composition-based stats.
 Identities = 65/244 (26%), Positives = 115/244 (47%)

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           +    +G      G+               + Q   +G   + +++L +  TG V A Q 
Sbjct: 18  NLFAGIGEYTIFVGKCLGKIPSLFKRYQEFLIQFKRIGFDSLFLILLTAAFTGLVTALQA 77

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
            +Q   +        L+    + E+  +LTA+++ G+ G++I AEIG+M+++E+IDA+ +
Sbjct: 78  VYQSKGYVPVNLLSVLIGKSTMIELAPVLTALVLTGKVGASIAAEIGTMRVSEQIDALES 137

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           M +D    L  PRI A +++ PL+T+ AN   II A    W  Y I +  FF+   S   
Sbjct: 138 MNIDPYEFLYMPRILAGVLAFPLVTVFANAVGIICAWYFSWLRYGIHYYTFFNNMRSYFI 197

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            ++++ GL K+      I   A   G      +  +GK  T+ VV S   ++++D + A 
Sbjct: 198 PSDLWGGLAKSFVFGFIITSFACYHGDRCFGGAEGVGKATTSTVVYSSVAILVMDFIVAW 257

Query: 367 FYFA 370
           F F 
Sbjct: 258 FLFG 261


>gi|254513828|ref|ZP_05125889.1| ABC transporter permease protein [gamma proteobacterium NOR5-3]
 gi|219676071|gb|EED32436.1| ABC transporter permease protein [gamma proteobacterium NOR5-3]
          Length = 369

 Score =  199 bits (506), Expect = 7e-49,   Method: Composition-based stats.
 Identities = 93/376 (24%), Positives = 168/376 (44%), Gaps = 18/376 (4%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           +S +   +   AG+W +  +  +       +          VD++++T  D      +++
Sbjct: 9   LSADDQLLI--AGDWSAAVLPTLDSLFTTLLE---TEGPLKVDVTSVTVWDPRLEAKLLH 63

Query: 61  FME---KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKK 117
                     +++L G      QLF L +               F   + ++    IG  
Sbjct: 64  LQRLAYAGQRQLELLGTPDSQTQLFKLATAVAPYAGTAATSSGLFTLKNLRSTLADIG-- 121

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
                +D       LG   S            +      I  +   G   + ++ L S +
Sbjct: 122 -----DDLLESLEFLGATTSAVLRTLLGRSGMRR--REFIESLAQAGPQAMGIITLTSVL 174

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G ++A  GA QL QFGA +F  DL++I  LRE+G L+TA+++AGR+G+A  A++ +M+ 
Sbjct: 175 VGMILAYLGAAQLQQFGAAVFVADLVAIGMLREMGALMTAIVMAGRTGAAYAAQLSTMQT 234

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           NEEIDAI T+G++ +  L+ PR+ AL++ +PLL + A+    I    V+     +    +
Sbjct: 235 NEEIDAITTLGINPLEFLVVPRMLALLLMMPLLVVYADAL-GIVGGAVVAGGMGVTPLQY 293

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
            S+  S  T+ +   G++K    A  I I   + G   G +S ++G+  T  VV ++  +
Sbjct: 294 ISQLDSAITITHFLVGVVKGLIFALLIAIAGCRAGMNAGRNSEAVGRATTEAVVTAVVYL 353

Query: 358 IIIDSLFAIFYFAIGI 373
           I+ D+   I    +GI
Sbjct: 354 IVADAAINILCQLLGI 369


>gi|295691537|ref|YP_003595230.1| hypothetical protein Cseg_4204 [Caulobacter segnis ATCC 21756]
 gi|295433440|gb|ADG12612.1| protein of unknown function DUF140 [Caulobacter segnis ATCC 21756]
          Length = 269

 Score =  199 bits (505), Expect = 8e-49,   Method: Composition-based stats.
 Identities = 73/254 (28%), Positives = 122/254 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      + +   ++G V        A++     F   L+RQ   +G   +PVV L +  
Sbjct: 15  IQALGRSTLAAVRMVGAVGVFAARGTAAALSPPWFPGQLLRQFMAIGFFSLPVVGLTAVF 74

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TGA +A        +F AE     ++++   RE+G +L A+M+AGR  +AI AEIG+M+ 
Sbjct: 75  TGAALALNIFTGGGRFNAEQVMPQIVALGITRELGPVLAALMLAGRVSAAIAAEIGAMRA 134

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+RT+  D  R L+ PR+ A ++ LPLLT +A+   + G  +V  +  D    V+
Sbjct: 135 TEQIDAMRTLSTDPFRYLVGPRLLAGVLMLPLLTAVADTIGVAGGWLVATRVLDFSPTVY 194

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                      +I +GLIKA      + ++    G+     +  +G+  T  VV S  ++
Sbjct: 195 IRNTIDFLESWDIVSGLIKAAVFGFIVALMGCYHGYNASGGARGVGRATTHAVVSSAILI 254

Query: 358 IIIDSLFAIFYFAI 371
              D L   F+  +
Sbjct: 255 FASDYLLTTFFTHM 268


>gi|15605864|ref|NP_213241.1| hypothetical protein aq_355 [Aquifex aeolicus VF5]
 gi|2983037|gb|AAC06647.1| hypothetical protein aq_355 [Aquifex aeolicus VF5]
          Length = 245

 Score =  198 bits (504), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 118/243 (48%)

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  +G     T       +K    L   I Q+ YV     PVV++ S  TG VIA 
Sbjct: 1   MTKFLEEVGRATLLTLWSIFFLFKKPPRLKHFISQLTYVAAETTPVVLVTSLFTGGVIAL 60

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q      +F AE     +++I   RE+G +LT++M+  R GSA+ A IG+M+I ++IDA+
Sbjct: 61  QTYSTFHRFNAEYLIGAVVAISMGRELGPVLTSLMVVARVGSAMTASIGTMRITQQIDAL 120

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             M ++ +  L++PRI+A    +PLLT+L++ + I G   V  K + +   +++ +    
Sbjct: 121 EVMAINPISFLVTPRIFATTFGVPLLTVLSDVAGIFGGWFVATKLFGVNEYLYWQKMVDL 180

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               +I  GL KA F    IG V+   GF     +  +GK  T  VV S  +++I D   
Sbjct: 181 TEFHDIVGGLYKATFFGFIIGAVSCYYGFYTKGGTAGVGKATTNSVVTSSMLILISDYFL 240

Query: 365 AIF 367
              
Sbjct: 241 TAV 243


>gi|212703465|ref|ZP_03311593.1| hypothetical protein DESPIG_01509 [Desulfovibrio piger ATCC 29098]
 gi|212673125|gb|EEB33608.1| hypothetical protein DESPIG_01509 [Desulfovibrio piger ATCC 29098]
          Length = 264

 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 69/255 (27%), Positives = 126/255 (49%), Gaps = 5/255 (1%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +           LG V     +     +     +   I+Q+Y +G   + V++LI    G
Sbjct: 10  RLGAAVLRMLDSLGAVTLFMLDGLRHIFTSPRIVPRTIQQLYVIGYKSLFVILLIGIFCG 69

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+  QG + L QFG+       +S+  +RE+G +LTA+M+AGR+GS++ AEIG M+I++
Sbjct: 70  MVLGLQGYYTLVQFGSVGMLGSAVSLSLIRELGPVLTAIMLAGRAGSSMAAEIGVMRISD 129

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+  M ++ +  L+SPR+ A +++ PLLT + +   IIG  +       I    +  
Sbjct: 130 QIDALDVMDINSMAYLVSPRLVASLLAFPLLTAIFDVIGIIGGYLTGVLMLHINEGAYLY 189

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV-----HSNSLGKKVTTCVVQSI 354
           R  S+ T+ ++  G IK+      +  V   +G+   +        ++G   T+ VV S 
Sbjct: 190 RIASSVTMNDVAGGFIKSLVFGLLVATVCCHQGYTTHMRRDSVGPEAVGNATTSAVVISC 249

Query: 355 SIVIIIDSLFAIFYF 369
            ++++ D +   F  
Sbjct: 250 VLILVADYVLTSFLL 264


>gi|289547869|ref|YP_003472857.1| hypothetical protein Thal_0093 [Thermocrinis albus DSM 14484]
 gi|289181486|gb|ADC88730.1| protein of unknown function DUF140 [Thermocrinis albus DSM 14484]
          Length = 245

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 74/243 (30%), Positives = 122/243 (50%)

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  +G     T       ++    L   ++Q+ Y+G   VPVV++ S  +G VIA 
Sbjct: 1   MLRVFEEVGKAALLTFLGIYFLFRNPPRLYHFVKQLAYLGAETVPVVVITSLFSGGVIAL 60

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q      +F AE     ++++   RE+G +LTA+M+  R GSA+ A IG+M+I E+IDA+
Sbjct: 61  QTYSTFHRFNAEFLIGAVVALSMFRELGPVLTALMVTARVGSAMTASIGTMRITEQIDAL 120

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             MG++ V  L++PRI A ++ LPLLTI+++ + I+G   V    + +   +F+ R    
Sbjct: 121 EVMGMNPVSYLVTPRIVAGVLGLPLLTIISDVAGILGGWFVAVGLFGVNNHLFWERMRDL 180

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               +   GL KA F    +  V+   GF     +  +G+  T+ VV S  +V+I D   
Sbjct: 181 VEFYDFVGGLYKAVFFGLVVSAVSCYFGFYTKGGTEGVGRATTSSVVTSSMLVLISDYFL 240

Query: 365 AIF 367
              
Sbjct: 241 TAI 243


>gi|297621446|ref|YP_003709583.1| putative permease component of ABC transporter [Waddlia
           chondrophila WSU 86-1044]
 gi|297376747|gb|ADI38577.1| putative permease component of ABC transporter [Waddlia
           chondrophila WSU 86-1044]
          Length = 274

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 71/249 (28%), Positives = 124/249 (49%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +N   +    LG            ++K       +  QMY +GV  +PVV +  F TG V
Sbjct: 13  LNILVNTLAALGDYFRLIALVIWEAFKNPPQAKLIRNQMYEIGVLSLPVVAITGFSTGMV 72

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q  FQL+  G    +  +++   + E+G +LTA M+ GR G+++ AE+G+MK+ E+I
Sbjct: 73  LAAQSFFQLADKGLASATGLMVAKAMMVELGPVLTAFMVTGRVGASMCAELGTMKVTEQI 132

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+++M ++ +  LI+PR  A  + LPLLT+ +    I G  ++   +Y +P   F    
Sbjct: 133 DALKSMTVNPLGYLIAPRFIAGTLMLPLLTVFSTVMGIGGGYMIAVWFYKMPSNTFLDPL 192

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
               T  + F+GL+KA      I  ++  +G      +  +G+  T  VV   S+++I +
Sbjct: 193 PINITNFDFFSGLVKAISFGIVIVTISCYKGMTTRGGAAGVGRATTNSVVICYSVILIGN 252

Query: 362 SLFAIFYFA 370
            L  +    
Sbjct: 253 FLLTVALNE 261


>gi|121534945|ref|ZP_01666764.1| protein of unknown function DUF140 [Thermosinus carboxydivorans
           Nor1]
 gi|121306544|gb|EAX47467.1| protein of unknown function DUF140 [Thermosinus carboxydivorans
           Nor1]
          Length = 256

 Score =  198 bits (503), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 121/252 (48%), Gaps = 2/252 (0%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           + K       Q    G VI    E      +F   L   +RQ  ++GV  +P+V+L    
Sbjct: 6   LEKLGRTVLVQLETTGRVILLFTETIYHLRRF--NLKLTLRQAAHLGVDSLPIVLLTILF 63

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+  Q A +  ++GA+     ++++   RE+  +LT V+ AGR G+AI AEIGSMK+
Sbjct: 64  TGMVMTVQTAHEFIKYGAQSSVGGVVAVAMGRELAPVLTGVVAAGRVGAAITAEIGSMKV 123

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+R M  + +  L+ PR+ A +  LP+L + A+     G  +V   Y  I    +
Sbjct: 124 TEQIDALRVMATNPIAYLVVPRLVACVFMLPILVVFADVIGTFGGYLVATLYAGIGSFTY 183

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    + ++  GLIKA      I I+   +G      +  +G+  T  VV SI ++
Sbjct: 184 LHSIKVFTAINDVTGGLIKAMVFGAIIAIIGCYKGLTTDEGAEGVGRATTGSVVASIILI 243

Query: 358 IIIDSLFAIFYF 369
            + +   ++  +
Sbjct: 244 FVTNYFLSLLLY 255


>gi|296117337|ref|ZP_06835927.1| hypothetical protein GXY_16012 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976103|gb|EFG82891.1| hypothetical protein GXY_16012 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 433

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 80/372 (21%), Positives = 147/372 (39%), Gaps = 8/372 (2%)

Query: 2   SENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF 61
           +E   T+   +G W   +     D     +  + +          +   DT     +   
Sbjct: 70  AEANRTLITLSGEW-IAQTGTTPDFPNNGLAPATKGKPLEFSTDGLGRWDTSLISFLWEL 128

Query: 62  MEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKF 121
                         T  +    L+            P    F          +G+  +  
Sbjct: 129 KRDARQADLSVSAETLPDSARKLLDLLPEIPPDAHAPPPHHFAP-----VTAVGQFTLDT 183

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           +N+    + +                  +     L+  +   G + + +V +++F+ GA+
Sbjct: 184 LNEIGCVSEMGVATAKGGLAALLGKGMMRTI--DLMSDVRAAGPTALVIVGVVNFLVGAI 241

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A  GA QL +F A+I+   L+ I  +RE+  ++TA+++AGR+G A  A I +M+ NEEI
Sbjct: 242 LAFVGAVQLHKFAADIYVASLVGIAMVREMSAVMTAIIMAGRTGGAYAARISTMQGNEEI 301

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+   G+     LI P + ALI+++PLL +      + G   V +   ++    +F   
Sbjct: 302 DALTVFGIPVASYLILPSVLALILTMPLLYLYGCLIGMFGGFFVSYIMLNVTPLGYFHET 361

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
                L+    G IK+      IG+ + + G   G  +  +G   T  VV  I  VI ID
Sbjct: 362 LYAVALSQFVFGFIKSIVFGGFIGLTSCRIGLKAGRSAADVGIAATRAVVVGIVGVIAID 421

Query: 362 SLFAIFYFAIGI 373
           ++FA+    + I
Sbjct: 422 AIFAVIANVLDI 433


>gi|94498322|ref|ZP_01304881.1| ABC transporter, permease protein, putative [Sphingomonas sp.
           SKA58]
 gi|94422202|gb|EAT07244.1| ABC transporter, permease protein, putative [Sphingomonas sp.
           SKA58]
          Length = 303

 Score =  197 bits (502), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 95/298 (31%), Positives = 156/298 (52%), Gaps = 4/298 (1%)

Query: 76  THIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSCSQAHILGLV 135
              E L  LI          Q+                 G++++    D+       G +
Sbjct: 10  GEREDLQRLIDLVRPAL--EQESSGKAGVTGVLGFFERFGRQVIGTAGDAYQMLVFTGQL 67

Query: 136 ISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGA 195
           I   G    +  + +     L+  M   G++G+P+V +++F  GAVIA  G   L+  G 
Sbjct: 68  IIALGRTLGNPRRLRM--TPLVAFMQDAGINGLPIVFIMTFFIGAVIALVGTNLLTTLGV 125

Query: 196 EIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRIL 255
           E+F+I L+ +  LRE GV++TA++++GRS S+  A+IGSM++N+E DA++ MG+D    L
Sbjct: 126 EVFTIQLVGVAILREFGVVITAILLSGRSASSFAAQIGSMRMNQETDAMQVMGVDRFDAL 185

Query: 256 ISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLI 315
           + PRI A ++ +PL+T  A+   + G  +V W   DI    F  R   T  + + + G+ 
Sbjct: 186 VIPRILAALLMMPLMTFCADIGGLAGGLLVSWVTIDISPVFFIQRTLETVDIKHFWIGMC 245

Query: 316 KAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAIGI 373
           KAPF+A  I     + G  VG    SLG+ VT+ VVQSI +VI+ D++FA+ + A+ +
Sbjct: 246 KAPFLALIIAAAGCRHGLMVGGDVQSLGQNVTSAVVQSIFMVIMFDAIFAVIFMALDL 303


>gi|292670497|ref|ZP_06603923.1| ABC superfamily ATP binding cassette transporter, permease protein
           [Selenomonas noxia ATCC 43541]
 gi|292647907|gb|EFF65879.1| ABC superfamily ATP binding cassette transporter, permease protein
           [Selenomonas noxia ATCC 43541]
          Length = 310

 Score =  197 bits (501), Expect = 2e-48,   Method: Composition-based stats.
 Identities = 71/254 (27%), Positives = 125/254 (49%), Gaps = 1/254 (0%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + +        +    +G V    GE      + +  + S+I QM ++G   + +V L  
Sbjct: 58  RILEAVGAFVLTHLANIGRVTLLYGETIRQVTR-RLRVRSIIYQMAHLGADSLLIVGLTL 116

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG V+  Q A +  ++GA+     +++I   RE+G +L  V+ AGR G+AI AE+ +M
Sbjct: 117 LFTGVVLTLQIAHEFIRYGAQSTVGAVIAIGIGRELGPVLVGVVCAGRVGAAITAEVSTM 176

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           K+ E+IDA+R M +  V  LI PR+ A ++ +P+LT+  +   ++G  +    Y  I   
Sbjct: 177 KVTEQIDALRVMAVSPVNYLIVPRMLACMVVVPILTVFGDVIGVLGGYLTAVYYSGISAY 236

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            F +     A + ++  GLIKA F    I ++    G      +  +GK     VV SI 
Sbjct: 237 TFTNSITQFALIYDMTGGLIKAIFFGNVIAVLGCHYGLNAPSGAEGVGKATMHTVVTSII 296

Query: 356 IVIIIDSLFAIFYF 369
           ++ I++++   F F
Sbjct: 297 VIFILNAVLTFFLF 310


>gi|242277698|ref|YP_002989827.1| hypothetical protein Desal_0221 [Desulfovibrio salexigens DSM 2638]
 gi|242120592|gb|ACS78288.1| protein of unknown function DUF140 [Desulfovibrio salexigens DSM
           2638]
          Length = 270

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 69/254 (27%), Positives = 125/254 (49%), Gaps = 5/254 (1%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
               S +  +  G +           +   G     ++++Y++GV  + V+ LI   TG 
Sbjct: 17  VGKLSINLLNEAGAMFIFLMHGLLHIFSSLGIFKKSVKELYFIGVKSITVISLIGLFTGM 76

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+  Q  + LS+FG+E F    +++  +RE+G +LTA+M+ GR+GS++ AEIG M+I+E+
Sbjct: 77  VVGLQTQYALSKFGSEGFLGAAVALSLVRELGPVLTAIMLTGRAGSSMTAEIGVMRISEQ 136

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+  M ++ +  L+SP++ A +IS P+LT   +   I+G  +           V++ R
Sbjct: 137 IDALELMDINPINYLVSPKLVASLISFPILTAFFDLIGIVGGYLSGVMLMGGNAGVYWHR 196

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV-----GVHSNSLGKKVTTCVVQSIS 355
            H+     +I  G  K+   A  +  V   +G+       G     + +  TT VV S  
Sbjct: 197 VHTALGWDDISAGFNKSLVFAVLVCTVCCFQGYFTHHRKDGKGPEGVSQATTTAVVMSCV 256

Query: 356 IVIIIDSLFAIFYF 369
           +V++ D +      
Sbjct: 257 LVLVADYIITSLLL 270


>gi|213018814|ref|ZP_03334622.1| putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|212995765|gb|EEB56405.1| putative membrane protein [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 244

 Score =  197 bits (500), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 59/242 (24%), Positives = 114/242 (47%)

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
            +    +G       +     +    +  ++ RQ+  +G   +P+V L     GAVI  Q
Sbjct: 1   MNFLLRIGNAFVFFIQSLYHCFIPPYYFSNVARQIIEIGFFSLPIVGLTGVFIGAVIVLQ 60

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
            +        E     L++I  ++E+G +L ++++ G+ GS+I AEIG+M+I E+IDA+ 
Sbjct: 61  SSLSGILINQEQVVPKLVTITIIKELGPVLISLIMVGKVGSSIAAEIGTMRITEQIDALT 120

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
           T+ ++  + LI PRI A +I  P+LT+ A+   I G  +     ++    ++        
Sbjct: 121 TLDINPFKYLIVPRILASVIVFPILTVCADLIGIFGGYVTAVFEFNHNLNIYIKYTAQFF 180

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFA 365
            + +   GL+KA      I + +   G+     +  +G   T+ VV S  ++I+ + L  
Sbjct: 181 NMYDFIVGLMKATAFGAIISVSSCYYGYHCREGARGVGIATTSTVVISSILIILANYLIT 240

Query: 366 IF 367
           + 
Sbjct: 241 LI 242


>gi|302340503|ref|YP_003805709.1| protein of unknown function DUF140 [Spirochaeta smaragdinae DSM
           11293]
 gi|301637688|gb|ADK83115.1| protein of unknown function DUF140 [Spirochaeta smaragdinae DSM
           11293]
          Length = 253

 Score =  196 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 60/249 (24%), Positives = 118/249 (47%)

Query: 123 NDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVI 182
                     G       +    +++       ++ Q  ++GV  V ++ L S   G + 
Sbjct: 3   RRLVRTFEQFGSFCLFALDSFRWTFRRPWRPGLVLEQAEHIGVDSVLIIALSSLSIGMIF 62

Query: 183 AQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEID 242
           + Q    ++ F AE      +++   RE+  + T++M+  ++GSA+ AEIG+M+++E+ID
Sbjct: 63  SLQVTDLMAMFRAETMVGSAVAMTMGRELAPVFTSLMLVAKNGSAMAAEIGTMRVSEQID 122

Query: 243 AIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFH 302
           A+ TM ++ ++ L+ PRI   II  P+LT L+N   ++G+ +V      +  A +  + +
Sbjct: 123 AMETMSVNPIQYLVVPRIIGSIIVFPILTALSNVVGVLGSYVVSIHMKGVDPAGYLDQLY 182

Query: 303 STATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDS 362
                 +I++G IKA  M   + ++    GF     S  +G   T  VV +   V++ D 
Sbjct: 183 RFVDPVDIWSGFIKAAIMGALVSLICCFFGFTTSGGSKEVGTASTKAVVTASVAVLVSDY 242

Query: 363 LFAIFYFAI 371
           + +     I
Sbjct: 243 IMSDIMLKI 251


>gi|163783076|ref|ZP_02178071.1| hypothetical protein HG1285_00835 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881756|gb|EDP75265.1| hypothetical protein HG1285_00835 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 248

 Score =  196 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 67/243 (27%), Positives = 117/243 (48%)

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  +G       +     +K    +   I Q  Y+      VV++ S  TG VIA 
Sbjct: 4   LLKLTEEVGKASLLALQAVYFLFKKPPKVRHFIDQFTYIAAETSLVVLVTSTFTGGVIAL 63

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q      +F AE     ++++   RE+G +LT++M+  R GSA+ A IG+M+I ++IDA+
Sbjct: 64  QTYSTFHRFNAEYLIGAVVALSMGRELGPVLTSLMVVARVGSAMTANIGTMRITQQIDAL 123

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             M ++ VR L++PRI+A  + +PLLTI++N + + G  +V  K + +   +++ +    
Sbjct: 124 EVMAVNPVRYLVTPRIFATTVGVPLLTIVSNVAGMFGGWLVATKLFKVNEYLYWQKMIDL 183

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
               +I  GL KA      I  V+   GF     +  +G+  T  VV +  +++I D   
Sbjct: 184 TEFYDIVGGLYKAFVFGFIIAAVSCYFGFYTRGGTEGVGRSTTNSVVTASMLILITDYFL 243

Query: 365 AIF 367
              
Sbjct: 244 TAI 246


>gi|320103291|ref|YP_004178882.1| hypothetical protein Isop_1750 [Isosphaera pallida ATCC 43644]
 gi|319750573|gb|ADV62333.1| protein of unknown function DUF140 [Isosphaera pallida ATCC 43644]
          Length = 280

 Score =  196 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 60/245 (24%), Positives = 116/245 (47%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           + +      +     G  +  +                L+   + +GV  +PVV +    
Sbjct: 15  LTRVGERIITMVSEFGSWVQFSAATLGWMVARPPRRSHLVPNFFTIGVRSLPVVAVTGLF 74

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V++ Q      + G E     +++I  ++E+G +L A M+AGR GSA+ AE+G+M++
Sbjct: 75  IGMVLSVQSFNSFKEMGLETRLGSVVNISLVKELGPVLAATMLAGRVGSAMAAELGTMRV 134

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+  +G++ +  L+ PR  A ++ +P LT++A+F+  +G S V  K   +    +
Sbjct: 135 TEQIDALHALGVNPIAYLVVPRFLACVVLIPALTLVADFAGALGGSFVSVKMLGVDGYYY 194

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           +    S     ++  GL K+ F   AI +++   GF     +  +G+  T   V S   +
Sbjct: 195 WKHSQSFVEPLDVVAGLFKSVFFGAAIALISCHRGFHSKGGAEGVGQAATEAFVSSFIAI 254

Query: 358 IIIDS 362
           + +D 
Sbjct: 255 LFLDF 259


>gi|320107063|ref|YP_004182653.1| hypothetical protein AciPR4_1853 [Terriglobus saanensis SP1PR4]
 gi|319925584|gb|ADV82659.1| protein of unknown function DUF140 [Terriglobus saanensis SP1PR4]
          Length = 259

 Score =  196 bits (499), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 76/250 (30%), Positives = 125/250 (50%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
           ++ +      L      +G    S      +   +  QM  +G   +P+VIL  F TG V
Sbjct: 7   VDFTKRSIAALQEYSLLSGRAMKSLLTPPIYWDEIFTQMDSIGFGSLPIVILAGFFTGCV 66

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q A  L QFGA   +  L+++  ++E+G +LT +M++GR+ S I +E+GSM++ E+I
Sbjct: 67  LALQSATALQQFGAVSKTGSLVALSMVKELGPVLTGLMVSGRNASGIASELGSMRVTEQI 126

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+R +G D VR L+ PRI A +I L  L+IL+    I G ++V      +  + +F   
Sbjct: 127 DAMRALGTDPVRKLVLPRIAATVIMLAFLSILSAAMGIAGGALVSVALLGLNSSAYFHSS 186

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           +++    ++  GL+K  F    I  V    G      +  +GK  T  VV S   +I++D
Sbjct: 187 YASLVYGDVVQGLVKPVFFGFIIASVGCYFGMTTKGGTQGVGKSTTQAVVISSVCIIVVD 246

Query: 362 SLFAIFYFAI 371
            L       I
Sbjct: 247 FLLTRLMIGI 256


>gi|239906932|ref|YP_002953673.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
 gi|239796798|dbj|BAH75787.1| hypothetical membrane protein [Desulfovibrio magneticus RS-1]
          Length = 269

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 72/255 (28%), Positives = 131/255 (51%), Gaps = 5/255 (1%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +      LG +   T +              +++Q+Y++GV  + V+ LI   TG
Sbjct: 15  ALGRVTLRFVAELGGLFLFTLQGLWRILVPAPSWSKIVQQVYFIGVKSIFVIALIGLFTG 74

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+  QG + L +FG+E      +++  +RE+G +LTA+MI GR+GS++ AE+G M+I+E
Sbjct: 75  MVLGLQGYYTLVKFGSEGLLGAAVALSIIRELGPVLTAIMITGRAGSSMAAELGIMRISE 134

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+ TM ++ +R L++PR+ A +I  PLLT + +   I+G  +       I   V+F 
Sbjct: 135 QIDALSTMDINPMRFLVAPRLAASLICFPLLTAIFDVVGILGGYLSGCVLLGINPGVYFD 194

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGV-----HSNSLGKKVTTCVVQSI 354
           R  +T  LA++  G +K+   A  + ++   EG+          +  +    T+ VV S 
Sbjct: 195 RIDATVELADVTGGFVKSVVFALLVAVICCYEGYFTHARQGGFGAKGVSLATTSAVVLSC 254

Query: 355 SIVIIIDSLFAIFYF 369
            ++++ D +   F  
Sbjct: 255 VVILVADYVLTSFLL 269


>gi|255549070|ref|XP_002515591.1| Inner membrane protein yrbE, putative [Ricinus communis]
 gi|223545535|gb|EEF47040.1| Inner membrane protein yrbE, putative [Ricinus communis]
          Length = 350

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 58/239 (24%), Positives = 117/239 (48%), Gaps = 1/239 (0%)

Query: 135 VISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFG 194
           V+   G+      K K    + ++Q+  VG   V V +L S   G     Q   + ++ G
Sbjct: 105 VLVVAGQVIIRILKGKVHWRNTLQQLERVGPKSVGVCLLTSAFVGMAFTIQFVREFTKLG 164

Query: 195 AEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRI 254
            +     ++++   RE+  ++T++++AGR GSA  AE+G+M+++E+ D +R +G + V  
Sbjct: 165 LQRSVGGVLALAFSRELSPVVTSIVVAGRIGSAYAAELGTMQVSEQTDTLRVLGTNPVDY 224

Query: 255 LISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGL 314
           L++PR+ A  ++LPLLT++     +  ++I+    + +   +            +I + +
Sbjct: 225 LVTPRVIASCVALPLLTLMCFTVGLASSAILADGVFGVSINIILDSAQRVLKSWDIISAM 284

Query: 315 IKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI-FYFAIG 372
           IK+      I IV+   G      +  +G+  T+ VV S+  + I D   +  F+  +G
Sbjct: 285 IKSQVFGAIISIVSCAWGVTTSGGAKGVGESTTSAVVISLVGIFIADFALSYCFFQGVG 343


>gi|86159557|ref|YP_466342.1| hypothetical protein Adeh_3136 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85776068|gb|ABC82905.1| protein of unknown function DUF140 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 386

 Score =  196 bits (498), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 86/369 (23%), Positives = 157/369 (42%), Gaps = 9/369 (2%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63
           +G  V   AG W+  +    A DV   ++++    +A+   + +   D+  A  +    +
Sbjct: 26  DGALVIALAGIWRLADGLPPAADVARELDRTPAPRAAVD-AAGVAAWDSALAVFVHGVAQ 84

Query: 64  KYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFIN 123
               +     +      L  L+               +       +    +G + ++   
Sbjct: 85  TCRTRGVPLDLRALPAGLARLLDLVREPAA------PASRAAPASHGIARLGVRALRREE 138

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
              +    +G          A   + +   L L+ Q  + G   +P+V L+SF+ G ++A
Sbjct: 139 RLRAAVAFVGETAIAFARLAARRARLRPQDLWLLVQ--HSGAEALPIVALVSFLVGIILA 196

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
             G  QL  FGAE F  D++ I  +R++  L+T V +AGRSG A  A++ +M + +EIDA
Sbjct: 197 FVGITQLRFFGAEAFVADIVGIAIVRDMAALITGVTLAGRSGGAFAAQLATMNVTQEIDA 256

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           +RT+G+  V  L+ PR+ AL   +PLLT+ A+ S I+G ++V       P A +  +   
Sbjct: 257 LRTLGISPVEYLVVPRVLALTAMMPLLTLFADASGILGGAMVGTTMLHQPLAGYLHQTAL 316

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
                ++  GL+K       I +     G      +  +G+  T  VV  I  +I    +
Sbjct: 317 ALVPGDLAGGLVKGATYGLLIALTGAFRGMQAERSAERVGEAATQAVVTGIVAIISACGV 376

Query: 364 FAIFYFAIG 372
           +   +F  G
Sbjct: 377 YQYVFFLFG 385


>gi|116747921|ref|YP_844608.1| hypothetical protein Sfum_0473 [Syntrophobacter fumaroxidans MPOB]
 gi|116696985|gb|ABK16173.1| protein of unknown function DUF140 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 258

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 72/257 (28%), Positives = 126/257 (49%), Gaps = 5/257 (1%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +  Q   LG +    G   A   +  G  LS+++Q+ ++G     V+   +  
Sbjct: 2   IRSLGAYTVVQVGFLGRLGLFLGRMLAGITRPPGKFLSVVKQIQFIGTKSFLVIGFTAIF 61

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A QG + L+  G+E +    +S+  +RE+G +LTA+M+ GR+GSA+ AEIG M+I
Sbjct: 62  TGMVLALQGYYALASVGSEGWLGKAVSLSLIRELGPVLTALMVTGRAGSAMCAEIGIMRI 121

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
           +E+IDAI  M +D    LI+PR+ A +I+LPLLT   +   I+G  +V      +    +
Sbjct: 122 DEQIDAIECMAIDPHSYLITPRLLAALIALPLLTAFCDVVGIVGGYLVGVNLLGVNAGAY 181

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVG-----VHSNSLGKKVTTCVVQ 352
                S+    +++ G++K+      I  +   +G+  G          + +  T  VV 
Sbjct: 182 LDSMESSVVWKDVYMGIVKSICFGVLIIWICTYKGYYAGVDENNFGPEQVSRATTNAVVL 241

Query: 353 SISIVIIIDSLFAIFYF 369
           S   +++ D +      
Sbjct: 242 SSISILVCDYVVTSVLL 258


>gi|120602860|ref|YP_967260.1| hypothetical protein Dvul_1816 [Desulfovibrio vulgaris DP4]
 gi|120563089|gb|ABM28833.1| protein of unknown function DUF140 [Desulfovibrio vulgaris DP4]
          Length = 267

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 72/243 (29%), Positives = 128/243 (52%), Gaps = 5/243 (2%)

Query: 132 LGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLS 191
           LG +     +     +     L  ++ Q+Y +G   + V++LI   TG V+  QG + L 
Sbjct: 25  LGAMFIFMLDGFRHIFASTKQLPKIVNQVYVIGYKSLFVILLIGIFTGMVLGLQGYYTLV 84

Query: 192 QFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDF 251
           +FG+E      +++  +RE+G +LTA+M+ GR+GS++ AEIG M+I ++IDA+  M ++ 
Sbjct: 85  KFGSEGLLGAAVALTLIRELGPVLTAIMVTGRAGSSMAAEIGVMRITDQIDALDVMDINP 144

Query: 252 VRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIF 311
           +  L+SPRI A +++ PLLT L +   IIG  +       I   V+F R  ++  LA++ 
Sbjct: 145 MGYLVSPRIAASLVAFPLLTALFDVIGIIGGYVTGVMLLGINEGVYFHRIATSVELADVT 204

Query: 312 TGLIKAPFMACAIGIVAMKEGFAV-----GVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
            G +K+   A  +  V+  +G+       G+    +    T+ VV S  +V++ D +   
Sbjct: 205 GGFMKSLLFALIVSTVSCYQGYFTHMRRDGMGPEGVSNSTTSAVVMSCVLVLVADYVLTS 264

Query: 367 FYF 369
           F  
Sbjct: 265 FLL 267


>gi|34558257|ref|NP_908072.1| ABC transporter permease [Wolinella succinogenes DSM 1740]
 gi|34483976|emb|CAE10972.1| ABC TRANSPORTER, PERMEASE PROTEIN [Wolinella succinogenes]
          Length = 268

 Score =  196 bits (498), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 72/270 (26%), Positives = 119/270 (44%), Gaps = 4/270 (1%)

Query: 103 FYNSFKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYY 162
                      +G+ ++             G  +        + +        L  QM  
Sbjct: 2   RSKMVTAFFGALGRPVLLLWKS----LEKFGEFLMFHLRLIPAYFTPPFRARELFIQMES 57

Query: 163 VGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAG 222
           +GV    V++L S  TG V+A Q      QFGAE F    + +   RE+G +  A+M+  
Sbjct: 58  IGVGSFWVIVLTSVFTGMVLAIQFYQGFHQFGAENFMSYPIFLAITRELGPVFAALMLTS 117

Query: 223 RSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGA 282
           R+ SA+ AE+G+M++ E+IDAI T+ +D  R LI PRI A  +SLPLL IL NF   + A
Sbjct: 118 RAISAMAAELGTMRVTEQIDAIDTLAIDSKRYLIVPRILASTLSLPLLVILFNFIGNLSA 177

Query: 283 SIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSL 342
             +      +    + S       L+++   L+KA      + +V    G+     +  +
Sbjct: 178 YFISIHVLGVNEESYRSIVRQYLELSDLVISLVKAFVFGYLVSLVGTYIGYNTRGGARGV 237

Query: 343 GKKVTTCVVQSISIVIIIDSLFAIFYFAIG 372
           G+  T+ VV S   +   + L + F+ A+ 
Sbjct: 238 GRSTTSAVVFSAVTIFGANYLLSAFFLAMD 267


>gi|114328883|ref|YP_746040.1| ABC transporter permease [Granulibacter bethesdensis CGDNIH1]
 gi|114317057|gb|ABI63117.1| ABC transporter permease protein [Granulibacter bethesdensis
           CGDNIH1]
          Length = 259

 Score =  195 bits (497), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 61/250 (24%), Positives = 120/250 (48%)

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
                 S     G +        +   +   +    +R +  +G   +PVV L +  TG 
Sbjct: 9   LGRGFFSACASTGRMGVFGLTALSHLLRPPFYGRMFLRALVEIGYFSLPVVALTAIFTGM 68

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           V+A Q     ++F AE     L+S+   RE+G +L  +M+AGR G+A+ AE+G+M++ ++
Sbjct: 69  VLALQSYTGFARFSAESAIASLVSLSVTRELGPVLAGLMVAGRVGAAMAAELGTMRVTDQ 128

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDA+ T+    ++ L++PR+ A  I+LPLL I+A+   ++G  +V           + + 
Sbjct: 129 IDALTTLSTHPMKYLVAPRLLAGTIALPLLVIIADILGVMGGWLVASIKLGFNSHTYLAN 188

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
             ++  + ++ +GL KA      I +     G+     +  +G   T+ VV +  +++  
Sbjct: 189 TIASIHMDDVMSGLTKAAVFGFLIALQGCYHGYNSRGGAQGVGSATTSAVVTASVLILAF 248

Query: 361 DSLFAIFYFA 370
           D +    +F+
Sbjct: 249 DYVLTELFFS 258


>gi|322435258|ref|YP_004217470.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX9]
 gi|321162985|gb|ADW68690.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX9]
          Length = 259

 Score =  195 bits (497), Expect = 7e-48,   Method: Composition-based stats.
 Identities = 71/243 (29%), Positives = 124/243 (51%)

Query: 129 AHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAF 188
              +       G   A+ +    +   +  QM  +GV  +P+V+L  F TG V+A Q A 
Sbjct: 14  VTAIQDYSLLAGRGVANLFSPPVYWDDIFTQMDSIGVGSLPIVVLTGFFTGCVLALQSAT 73

Query: 189 QLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMG 248
            L QFG+   +  L+++  ++E+G +LT +M++GR+ S + +E+GSM + E+IDA+R +G
Sbjct: 74  ALKQFGSISLTGSLVALSMVKELGPVLTGLMVSGRNASGMASELGSMMVTEQIDAMRALG 133

Query: 249 LDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLA 308
            D +R L++PRI A ++ L  LTIL++   I G ++V      +  + +    + +    
Sbjct: 134 TDPIRKLVTPRIIATVVMLFFLTILSDAVGIAGGALVSVTILGLNLSSYLHTSYQSLLYG 193

Query: 309 NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
           ++  GL K  F A  I  V    G      +  +GK  T  VV S   +I++D L +   
Sbjct: 194 DVVQGLTKPLFSAFIIATVGCFFGLKTKGGTQGVGKATTQAVVYSSVFIIVVDFLVSRLM 253

Query: 369 FAI 371
             +
Sbjct: 254 IGL 256


>gi|186472351|ref|YP_001859693.1| hypothetical protein Bphy_3498 [Burkholderia phymatum STM815]
 gi|184194683|gb|ACC72647.1| protein of unknown function DUF140 [Burkholderia phymatum STM815]
          Length = 382

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 80/367 (21%), Positives = 157/367 (42%), Gaps = 4/367 (1%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYH 66
            V    G+W +      +   V  I K++ + +  ++ S +   D+     +M   E   
Sbjct: 20  AVLHLRGDWITCATGVRSAAEVHEIVKAVGACALRLETSNLGRWDSALIVFLMMLRESVR 79

Query: 67  GKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDSC 126
                       +      +            + +      ++L   +G+   +   ++ 
Sbjct: 80  KGGTRPFEIDESD--LPHAAQRLLALAAAGSGEVAGIAAVHRSLATQVGEAYFQAWANAV 137

Query: 127 SQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQG 186
           S   ++G    +     A   + +G    +++ M   G   + +V +++ + GA++A  G
Sbjct: 138 SIVALVGETALHCTAAFAHRVRTRGV--DVLQLMREAGAGALAIVAIVNGLVGAILAFIG 195

Query: 187 AFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRT 246
           A Q  +FGA I+  +L+ I  +RE+  L TA+++AGR+G A  A + +M+ NEEIDA+  
Sbjct: 196 AVQFQRFGAGIYVANLVGIAVVREMAALATAIVMAGRTGGAYAAHLATMQGNEEIDALNA 255

Query: 247 MGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTAT 306
           +G+     L+ PR+ AL+  +PLL + +    ++   IV     DI    +  +      
Sbjct: 256 VGIPVFDFLVLPRVIALVSMMPLLYVYSCAVGLLSGFIVTLATLDITAVTYLQQLRGAVD 315

Query: 307 LANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
                 GL K+      + +     G   G  +  +G+  T+ VV  I  VI +D++FA+
Sbjct: 316 GVQFAIGLAKSIAFGSFVALAGCHIGLKAGRSAAEVGRAATSAVVVGIVGVISLDAIFAV 375

Query: 367 FYFAIGI 373
              A+GI
Sbjct: 376 CTNALGI 382


>gi|149178242|ref|ZP_01856835.1| probable permease of ABC transporter [Planctomyces maris DSM 8797]
 gi|148842891|gb|EDL57261.1| probable permease of ABC transporter [Planctomyces maris DSM 8797]
          Length = 280

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 65/249 (26%), Positives = 120/249 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I        +   +LG +     E             +L   MY++G+  +PV+++    
Sbjct: 14  IHGLGRGVINTVCLLGDLFLFGWEMLGWIITRLPPRSNLWSCMYHIGIQSIPVILITGGF 73

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V+A Q   Q      E     +++I  + E+G +L A+M+AGR G+++ AE+G+M++
Sbjct: 74  IGMVLAVQSYDQFKLMHLENQIGAVIAISLVEELGPVLAAIMLAGRVGTSMSAELGTMRV 133

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+R +G D +  L+ PR  A  + +PLLTI+A+   I+G      +   +    +
Sbjct: 134 TEQIDALRALGADPIHYLVVPRFLACCLLIPLLTIVADAVGILGGWFFSTQILGVDSFYY 193

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           +          ++  G+ K+ F   AI +++   GF  G  +  +GK  T   V S  ++
Sbjct: 194 WHYSEQFVYAYDVMGGIFKSFFFGAAISLISCHRGFHCGAGAEGVGKAATEAFVYSFIVI 253

Query: 358 IIIDSLFAI 366
           +I+D L  +
Sbjct: 254 MILDFLLGV 262


>gi|222054639|ref|YP_002537001.1| protein of unknown function DUF140 [Geobacter sp. FRC-32]
 gi|221563928|gb|ACM19900.1| protein of unknown function DUF140 [Geobacter sp. FRC-32]
          Length = 258

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 71/265 (26%), Positives = 129/265 (48%), Gaps = 9/265 (3%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
                  IG+K++KF         +LG  +    E           L S+  QM  +G  
Sbjct: 1   MAGAIDRIGRKVIKFHEIIGEMLILLGQTVYFFREA-------PRNLASIFAQMAIIGYE 53

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
            +PV  +++F  G V+A Q   +L+++G++     ++    +RE+G ++T+ ++AGR GS
Sbjct: 54  TLPVASVMAFFVGMVLALQTGVELNKYGSQDIIGAIVGHSMVRELGPVMTSFLVAGRVGS 113

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A+ AE+G MK+ EEIDA++T+ ++ VR L  PR  A I+ +P L I ++   I+G +I+ 
Sbjct: 114 AMAAELGVMKVYEEIDALKTLDINPVRYLAMPRFIACIVCVPALVIYSDCIGIVGGAIIS 173

Query: 287 WKY--YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
             +    + ++ ++    +      I  GLIKA      + +V+   GF     +  +G 
Sbjct: 174 NLHPKIFVSYSTYYDSLTAALKFQEIGNGLIKAFVFGAIVALVSCYVGFKTSGGARGIGI 233

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYF 369
             T  VV S  ++++ D        
Sbjct: 234 STTRSVVWSFMLILVADYFLTRLLM 258


>gi|225848307|ref|YP_002728470.1| toluene tolerance protein Ttg2B [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225643396|gb|ACN98446.1| putative toluene tolerance protein Ttg2B [Sulfurihydrogenibium
           azorense Az-Fu1]
          Length = 247

 Score =  195 bits (496), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 68/243 (27%), Positives = 119/243 (48%)

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                   G +     +   +++K    L  +++ M  +GV+   ++IL  F TG V+  
Sbjct: 3   FTKFVEHTGEITLFFIKTLIATFKRFPKLKHILKYMEDIGVNAALLIILTGFFTGGVLVV 62

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           +      +F AE     L+S+   RE+  +L A+++  RSGSAI A IG+M+I E+IDA+
Sbjct: 63  ETYPTFHKFNAEYLMGALVSLSLARELSPVLVALLVTARSGSAIAANIGTMRITEQIDAL 122

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
             M ++    L+SPR+ A ++ +P LT+L+  S +IG        Y I   +++ +    
Sbjct: 123 EVMAVNPYSYLVSPRLIAAVVMVPALTVLSYVSGVIGGYFTSVYIYGINEYMYWEKLKDF 182

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
             L +IF GL KA      + IV    G+     +  +G+  TT VV +  +++I+D   
Sbjct: 183 TELKDIFGGLYKAAVFGAVLTIVTSYFGYITKGGAEGVGRSTTTAVVVASVLILILDYFL 242

Query: 365 AIF 367
              
Sbjct: 243 TAL 245


>gi|91201081|emb|CAJ74139.1| strongly similar to ABC-transporter, permease [Candidatus Kuenenia
           stuttgartiensis]
          Length = 260

 Score =  195 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 69/247 (27%), Positives = 115/247 (46%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
            N        LG +                    +I+Q+ ++GV  V V++L    TG V
Sbjct: 12  GNSLHKFIRELGKMGCFFANALFYMLFPPYLFRRIIKQINFIGVKTVLVIVLTGTFTGMV 71

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +A Q  + L +FGAE      +++  ++E+G ++ A+M+ GR+GSAI AEIG M+I+E++
Sbjct: 72  LALQMYYVLIKFGAEARLGPAVAMSLIKELGPVICALMVTGRAGSAITAEIGIMRISEQV 131

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  M L+  + LI P I A +ISLPLL  +     + G   V      +    +F   
Sbjct: 132 DALDAMALNPYKYLIIPNIIAGVISLPLLNAIFVVLGVFGGYAVGVGLMGVSSGTYFGGI 191

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           +      ++F G  K+      I  ++  +GF  G  +  + K  T  VV S  +++I D
Sbjct: 192 NDFVAARDVFEGFYKSLSFGVLITWISCYKGFYTGYGAEGVSKATTQSVVISSVVILIWD 251

Query: 362 SLFAIFY 368
                  
Sbjct: 252 YFMTSLL 258


>gi|58584874|ref|YP_198447.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
 gi|58419190|gb|AAW71205.1| ABC-type transport system involved in resistance to organic
           solvents, permease component [Wolbachia endosymbiont
           strain TRS of Brugia malayi]
          Length = 260

 Score =  195 bits (496), Expect = 9e-48,   Method: Composition-based stats.
 Identities = 62/251 (24%), Positives = 115/251 (45%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            I             LG       +     +    +L ++ +Q+  +G   +P+V L   
Sbjct: 8   GIRIIGRCFIKLLLRLGSAFIFFIQSLYHCFVPPYYLGNIAKQIIEIGFFSLPIVGLTGI 67

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
             GAVI  Q +        E     L+++  ++E+G +L ++++ G+ GS+I AEIG+M+
Sbjct: 68  FIGAVIVLQSSLSGPLISPEQIIPKLVTVTIIKELGPVLISLIMVGKVGSSIAAEIGTMR 127

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           I E+IDA+ T+ ++  + LI+PRI A +I  P+ TI A+   I G  I     ++    +
Sbjct: 128 ITEQIDALTTLNINPFKYLIAPRILASVIVFPIFTICADLIGIFGGYITAVFKFNHNLNI 187

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +         + N  TGLIKA      I + +   G+     +  +    T+ VV S  +
Sbjct: 188 YIKYTTQFFNMYNFITGLIKATAFGAIISVSSCYYGYHCQEGARGVSIATTSTVVLSSIL 247

Query: 357 VIIIDSLFAIF 367
           +I+ + +  + 
Sbjct: 248 IILANYMITLI 258


>gi|116789794|gb|ABK25388.1| unknown [Picea sitchensis]
          Length = 462

 Score =  195 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 54/232 (23%), Positives = 115/232 (49%)

Query: 139 TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIF 198
            G+  A  +K K    + ++Q+  VG     V +L +   G     Q   + ++ G    
Sbjct: 220 AGQVIARVFKGKIHTRNTLQQLEVVGPGSSGVCLLTAAFVGMAFTIQFVREFTRLGLTRS 279

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISP 258
              ++++   RE+  ++T+++IAGR GSA  AE+G+M+++E+ D +R +G D V  LI P
Sbjct: 280 VGGVLALAFSRELSPVVTSIIIAGRVGSAFAAELGTMQVSEQTDTLRVLGTDPVDYLIIP 339

Query: 259 RIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAP 318
           R+ A  ++LP+LT++    ++  + ++    Y++   +       +    +I + ++K+ 
Sbjct: 340 RVIACCLALPILTLICFSVSLAASVLLADGVYNVSANIILESARRSLHPWDIISAMVKST 399

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
                I +++   G      +  +G+  T+ VV S+  + I D + +  +F 
Sbjct: 400 VFGGLISVISCAWGVTTLGGAKGVGESTTSAVVISLVCIFIADFILSWCFFQ 451


>gi|10086491|gb|AAG12551.1|AC007797_11 Hypothetical Protein [Arabidopsis thaliana]
          Length = 283

 Score =  195 bits (496), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 55/232 (23%), Positives = 113/232 (48%)

Query: 139 TGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIF 198
            G+      K K    + ++Q+   G   + V +L S   G     Q   + ++ G    
Sbjct: 42  AGQVVLRILKGKIHWRNTLQQLERTGPKSLGVCLLTSTFVGMAFTIQFVREFTRLGLNRS 101

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISP 258
              ++++   RE+  ++T++++AGR GSA  AE+G+M+++E+ D +R +G D +  LI+P
Sbjct: 102 IGGVLALAFSRELSPVITSIVVAGRMGSAFAAELGTMQVSEQTDTLRVLGADPIDYLITP 161

Query: 259 RIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAP 318
           R+ A  ++LP LT++     +  ++++    Y I   +     H      +I + +IK+ 
Sbjct: 162 RVIASCLALPFLTLMCFTVGMASSALLSDAVYGISINIIMDSAHRALRPWDIVSAMIKSQ 221

Query: 319 FMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
                I +++   G      +  +G+  T+ VV S+  + I D + + F+F 
Sbjct: 222 VFGAIISVISCSWGVTTTGGAKGVGESTTSAVVMSLVGIFIADFVLSSFFFQ 273


>gi|149913819|ref|ZP_01902351.1| ABC transporter, inner membrane subunit [Roseobacter sp. AzwK-3b]
 gi|149812103|gb|EDM71934.1| ABC transporter, inner membrane subunit [Roseobacter sp. AzwK-3b]
          Length = 261

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 55/251 (21%), Positives = 111/251 (44%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +      +    +G V     E      +   +       +  +G   +PVV + +  TG
Sbjct: 10  RLGAQVLAMLGAVGRVTLFALETVTHLMRPPFYAREFGHALVQIGWLSLPVVGMTALFTG 69

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
             +A Q     ++F AE     +++I   RE+G +L  +M+A R  S+I AEIG+MK+ E
Sbjct: 70  GALALQIYAGGARFNAETVVPSIVAIGLTRELGPVLGGLMVAARVASSIAAEIGTMKVTE 129

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+ T+  + ++ L  PR+ A  +++PLL  + +   I+G  +V     D     +  
Sbjct: 130 QIDALTTLSTNPMKYLTLPRVLAATLAVPLLVGVGDVIGIMGGFLVGVGRLDFGAGTYLH 189

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                    ++ +G+IK       + ++    G   G  +  +G+     VV +  +++ 
Sbjct: 190 NTLDFLETWDVVSGMIKGAVFGFIVALMGCYYGMNSGRGAQGVGRATKAAVVAASVLILA 249

Query: 360 IDSLFAIFYFA 370
            + +    +F+
Sbjct: 250 SNYILTELFFS 260


>gi|323699476|ref|ZP_08111388.1| protein of unknown function DUF140 [Desulfovibrio sp. ND132]
 gi|323459408|gb|EGB15273.1| protein of unknown function DUF140 [Desulfovibrio desulfuricans
           ND132]
          Length = 267

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 71/248 (28%), Positives = 124/248 (50%), Gaps = 5/248 (2%)

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQ 185
                 +G +     +     +   G    ++RQ+Y++GV  V V+ LI   TG V+  Q
Sbjct: 19  REVVDEIGSLTLFLLDSMRLVFAGLGQFPKIVRQIYFIGVQSVSVIALIGLFTGMVMGMQ 78

Query: 186 GAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIR 245
             + LS FGA+ F    +++  +RE+  +LTA+M+ GR+GSA+ AEIG M+I+E+IDA+ 
Sbjct: 79  LYYALSVFGADGFLGTGVALSMVRELAPVLTAIMLTGRAGSAMTAEIGVMRISEQIDALT 138

Query: 246 TMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTA 305
            M ++ +R L++P++ A +IS P+LT   N  A+ G  +   K       V++SR   + 
Sbjct: 139 IMDINPMRYLVAPKMAACLISFPILTAFFNLIALWGGWLTGVKLLGANAGVYWSRVSGSL 198

Query: 306 TLANIFTGLIKAPFMACAIGIVAMKEGFAV-----GVHSNSLGKKVTTCVVQSISIVIII 360
              +I  G IK+      +  +   EG+             + +  T+ VV+S  I++  
Sbjct: 199 DWDDIEGGFIKSIVFGLLVCTICCFEGYNTHLRSGHAGPEGVSQSTTSAVVKSCVIILAA 258

Query: 361 DSLFAIFY 368
           D +     
Sbjct: 259 DYILTSLL 266


>gi|326405357|ref|YP_004285439.1| putative ABC transporter permease [Acidiphilium multivorum AIU301]
 gi|325052219|dbj|BAJ82557.1| putative ABC transporter permease protein [Acidiphilium multivorum
           AIU301]
          Length = 260

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 123/253 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +     +LG +        +   +    L +  R +  +G S +PVV L +  
Sbjct: 8   IAALGRLALGFVIMLGELALFAAAGLSGLVRPPFHLRNFGRALMEIGYSSLPVVALTAVF 67

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A Q     S+F +      ++ +   RE+G +L  +M+AGR+GSAI AE+G+M++
Sbjct: 68  TGMVLALQSYIGFSRFDSSSVIASVVVLSLTRELGPVLAGLMVAGRAGSAIAAEMGTMRV 127

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            ++IDA+ T+  D +R L++PR+ A +I+LPLL ++A+   + G  +V           +
Sbjct: 128 TDQIDALTTLATDPMRYLVTPRLLAGVIALPLLVVIADILGVAGGFLVSTVRLGFEPNAY 187

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                +     ++ +GL+KA      I ++    G+     +  +G   T  VV +  ++
Sbjct: 188 LRDTVNYLHSNDVVSGLVKAAVFGFVIALMGCFHGYRSRGGAQGVGGATTAAVVSASVLI 247

Query: 358 IIIDSLFAIFYFA 370
           + +D L    +F+
Sbjct: 248 LALDYLMTQAFFS 260


>gi|284049033|ref|YP_003399372.1| protein of unknown function DUF140 [Acidaminococcus fermentans DSM
           20731]
 gi|283953254|gb|ADB48057.1| protein of unknown function DUF140 [Acidaminococcus fermentans DSM
           20731]
          Length = 260

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 71/260 (27%), Positives = 123/260 (47%), Gaps = 9/260 (3%)

Query: 113 HIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVI 172
            +G+K+V     +    ++        G               ++RQM  +G   +P+V 
Sbjct: 9   WVGRKMVDLCARTGRVVNLFLEACRAAGTA---------DRREVLRQMARLGADSLPIVS 59

Query: 173 LISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEI 232
           +    TG V++ Q A +  +FGA      +++I   RE+  +LT V++AGR G+AI AEI
Sbjct: 60  MTILCTGMVMSVQTAKEFVRFGAADSVGGIVAIAMGRELSPILTGVVVAGRIGAAIAAEI 119

Query: 233 GSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDI 292
           G+MK+ E+IDA+R M +  +R L++PR+ A+++ +P+L + AN    +G   V   Y  I
Sbjct: 120 GTMKVTEQIDALRVMAVSPIRFLVTPRLLAIVLMMPVLVVYANLVGDVGGWFVAENYAGI 179

Query: 293 PFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQ 352
              +F           +I  GLIK       I  +   +G      +  +G   T  VV 
Sbjct: 180 SSHMFLESIRGFIEPWDIIGGLIKGAVFGAIIATIGCHKGLNAQQGAEGVGMATTKSVVL 239

Query: 353 SISIVIIIDSLFAIFYFAIG 372
           SI ++ I +   ++  +  G
Sbjct: 240 SIILIFIANYFLSVILYVHG 259


>gi|167645294|ref|YP_001682957.1| hypothetical protein Caul_1329 [Caulobacter sp. K31]
 gi|167347724|gb|ABZ70459.1| protein of unknown function DUF140 [Caulobacter sp. K31]
          Length = 270

 Score =  195 bits (495), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 121/252 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      + +   ++G V         ++     FL  L RQ   +G   +PVV L +  
Sbjct: 15  IRALGRSTLAAVRMVGGVGVFAVRGTVAALTPPWFLGQLWRQFVAIGFFSLPVVGLTAVF 74

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TGA +A        +F AE     ++++   RE+G +L A+M+AGR  +AI AEIG+M+ 
Sbjct: 75  TGAALALNIFTGGGRFNAEQVMPQIVALGITRELGPVLAALMLAGRVSAAIAAEIGAMRA 134

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+RT+  D  R L+ PR+ A ++ LP+LT +A+   + G  +V  +  D   AV+
Sbjct: 135 TEQIDAMRTLSTDPFRYLVGPRLLAGVLMLPILTAVADTIGVAGGWLVATRVLDFSSAVY 194

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                      ++ +GLIKA      + ++    G+     +  +G+  T  VV S  ++
Sbjct: 195 IRNTLDFLQGWDVISGLIKAAVFGFIVALMGCYHGYNAKGGARGVGRATTHAVVSSAILI 254

Query: 358 IIIDSLFAIFYF 369
              D L   F+ 
Sbjct: 255 FASDYLLTTFFT 266


>gi|160872193|ref|ZP_02062325.1| toluene tolerance protein Ttg2B [Rickettsiella grylli]
 gi|159120992|gb|EDP46330.1| toluene tolerance protein Ttg2B [Rickettsiella grylli]
          Length = 262

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 68/256 (26%), Positives = 124/256 (48%), Gaps = 1/256 (0%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           +K+ +            G       +      +F+     LI Q+Y++GV  + ++++  
Sbjct: 5   EKLQQLGQRGLRLLVNFGRATLFLTQLLIRKPRFRKSFPLLIEQLYFIGVLSLIIMVISG 64

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
              G V+  QG   L++FGA      L+++  +RE+G ++TA++ AGR+GSA+ AEIG M
Sbjct: 65  LFIGMVVGLQGYNTLNKFGASQQLGQLVALSVVRELGPVITALLFAGRAGSALTAEIGLM 124

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           K  E++ ++  MG+D +  +ISPR W   IS+P L I+ +  AI G  +V   +  +   
Sbjct: 125 KSTEQLASMEMMGIDPLWRVISPRFWGGFISMPFLMIIFSTVAIWGGYLVGVVWLGVDGG 184

Query: 296 VFFSRFHSTATLA-NIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSI 354
            F+S   S      +I  G+IK+      +  +A+ +G+        +G+  T  VV S 
Sbjct: 185 TFWSAMQSAVNFHDDIINGIIKSIVFGGVVTWIAVFQGYDTIPTPQGVGRATTHTVVYSS 244

Query: 355 SIVIIIDSLFAIFYFA 370
             ++ +D +       
Sbjct: 245 LAILGLDFVLTAVMMG 260


>gi|328952205|ref|YP_004369539.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
 gi|328452529|gb|AEB08358.1| protein of unknown function DUF140 [Desulfobacca acetoxidans DSM
           11109]
          Length = 255

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 65/252 (25%), Positives = 116/252 (46%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +             LG +     +      +         RQ+ ++GV    +V+L    
Sbjct: 4   LTTLGRLWVHFLQELGGMALLLAQAGLWLPRRPYRWRHFFRQLEFIGVKSFFIVVLTGLF 63

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A Q  +   +FG E      +++   RE+G +LT++M+A R+GSA+ AE+G+MK+
Sbjct: 64  TGMVLALQAYYGFRKFGGESLLGGAVALSMTRELGPVLTSLMVAARAGSAMAAELGAMKV 123

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E++DA+  M +  V  L  PR+ A +I  PLLT++A +  I+G   V     D+    F
Sbjct: 124 TEQVDALLAMAVQPVHYLALPRLLAAVIMTPLLTVIAVYIGIVGGYFVGVILLDVNPGTF 183

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
             +       ++++ GL K+      + +++  EG      +  +G   T  VV S   +
Sbjct: 184 MQKMLEMVNSSDLYNGLFKSVIFGLLLALISCYEGLQAKGGAEGVGLVTTRAVVYSAISI 243

Query: 358 IIIDSLFAIFYF 369
           +I D +     F
Sbjct: 244 LIADYILTALLF 255


>gi|148261852|ref|YP_001235979.1| hypothetical protein Acry_2870 [Acidiphilium cryptum JF-5]
 gi|146403533|gb|ABQ32060.1| protein of unknown function DUF140 [Acidiphilium cryptum JF-5]
          Length = 260

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 65/253 (25%), Positives = 123/253 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +     +LG +        +   +    L +  R +  +G S +PVV L +  
Sbjct: 8   IAALGRLALGFVIMLGELALFAAAGLSGLVRPPFHLRNFGRALMEIGYSSLPVVALTAVF 67

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG V+A Q     S+F +      ++ +   RE+G +L  +M+AGR+GSAI AE+G+M++
Sbjct: 68  TGMVLALQSYVGFSRFDSSSVIASVVVLSLTRELGPVLAGLMVAGRAGSAIAAEMGTMRV 127

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            ++IDA+ T+  D +R L++PR+ A +I+LPLL ++A+   + G  +V           +
Sbjct: 128 TDQIDALTTLATDPMRYLVTPRLLAGVIALPLLVVIADILGVAGGFLVSTVRLGFEPNAY 187

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                +     ++ +GL+KA      I ++    G+     +  +G   T  VV +  ++
Sbjct: 188 LRDTVNYLHSNDVVSGLVKAAVFGFVIALMGCFHGYRSRGGAQGVGGATTAAVVSASVLI 247

Query: 358 IIIDSLFAIFYFA 370
           + +D L    +F+
Sbjct: 248 LALDYLMTQAFFS 260


>gi|16127925|ref|NP_422489.1| ABC transporter permease [Caulobacter crescentus CB15]
 gi|221236745|ref|YP_002519182.1| organic solvent resistance transport system permease [Caulobacter
           crescentus NA1000]
 gi|13425459|gb|AAK25657.1| ABC transporter, permease protein, putative [Caulobacter crescentus
           CB15]
 gi|220965918|gb|ACL97274.1| organic solvent resistance transport system permease [Caulobacter
           crescentus NA1000]
          Length = 269

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 72/254 (28%), Positives = 123/254 (48%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      + +   ++G V         ++     FL  L RQ+  +G   +PVV L +  
Sbjct: 15  IQALGRSTLATVRMVGAVGVFAVRGVIAALTPIWFLSQLRRQIVAIGFFSLPVVGLTAVF 74

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TGA +A        +F AE     ++++   RE+G +L A+M+AGR  +AI AEIG+M+ 
Sbjct: 75  TGAALALNIFTGGGRFNAEQVMPQIVALGITRELGPVLAALMLAGRVSAAIAAEIGAMRA 134

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+RT+  D  R L++PR+ A +++LPLLT +A+   I G  +V  +  +    V+
Sbjct: 135 TEQIDAMRTLSTDPFRYLVAPRLLAAVLTLPLLTAVADIIGIAGGWLVATRVLEFNPTVY 194

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                      +I +GLIKA      + ++    G+     +  +G+  T  VV S  ++
Sbjct: 195 IRNTIDFLESWDIISGLIKAAVFGFIVALMGCYHGYNASGGARGVGRATTHAVVSSAILI 254

Query: 358 IIIDSLFAIFYFAI 371
              D L    +  +
Sbjct: 255 FATDYLLTTLFTHM 268


>gi|317152440|ref|YP_004120488.1| hypothetical protein Daes_0725 [Desulfovibrio aespoeensis Aspo-2]
 gi|316942691|gb|ADU61742.1| protein of unknown function DUF140 [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 268

 Score =  194 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 72/252 (28%), Positives = 123/252 (48%), Gaps = 5/252 (1%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                     LG +        A  +   G     +RQ+Y++GV  V V+ LI   TG V
Sbjct: 16  GRMFGRVLDELGGMFLFFLSAVALMFAGWGQFSKTVRQIYFIGVQSVTVIALIGLFTGMV 75

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
           +  Q  + LS FGA+ F    +++  +RE+  +L A+M+ GR+GSA+ AEIG M+I+E+I
Sbjct: 76  MGMQLYYALSVFGADGFLGTGVALSMVRELAPVLAAIMLTGRAGSAMTAEIGVMRISEQI 135

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  MG++ +R L++P++ A +IS P+L    N  A+ G  +   K       V+++R 
Sbjct: 136 DALTIMGINPMRYLVAPKMAACLISFPILNAFFNLIALWGGWLTGVKLLGANEGVYWARV 195

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV-----GVHSNSLGKKVTTCVVQSISI 356
             +   ++I  G IK+   A  +  +   EG+             + +  T  VV+S  I
Sbjct: 196 QGSLDWSDIQGGFIKSMVFAVLVCTICCFEGYYTHTRSGHAGPEGVSQSTTNAVVKSCVI 255

Query: 357 VIIIDSLFAIFY 368
           ++  D +     
Sbjct: 256 ILAADYVLTSLL 267


>gi|39996998|ref|NP_952949.1| transporter [Geobacter sulfurreducens PCA]
 gi|39983886|gb|AAR35276.1| transporter, putative [Geobacter sulfurreducens PCA]
 gi|298506015|gb|ADI84738.1| transporter membrane protein of unknown function DUF140 [Geobacter
           sulfurreducens KN400]
          Length = 257

 Score =  194 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/252 (27%), Positives = 126/252 (50%), Gaps = 2/252 (0%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
           +      S   +LG ++   G       +    L S+  QM  +G   VP+  +++F  G
Sbjct: 6   RVGKKVLSFHEVLGEMLMLLGRTVWFFREAPRNLPSIFNQMAIIGYETVPIASVMAFFVG 65

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
            V+A Q   +L ++G +     ++ +  +RE+G ++T+ ++AGR GSA+ AEIG MK+ E
Sbjct: 66  MVLALQTGVELQKYGTQNIIGGIVGLSMVRELGPVMTSFLVAGRVGSAMAAEIGVMKVYE 125

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKY--YDIPFAVF 297
           EIDA++T+ ++ VR L  PR+ A ++ +P L I AN   I+G +I+   +    I ++ +
Sbjct: 126 EIDALKTLDINPVRYLAMPRLIACLVCVPALVIFANAVGIVGGAIMSHLHPKIFISYSTY 185

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           +    +   L  +  GL+KA      I +VA   GF     +  + +  T  VV S  ++
Sbjct: 186 YDSLKTALKLKEVGAGLVKATVFGGIIALVACYTGFKTSGGARGIAQATTRAVVLSFMLI 245

Query: 358 IIIDSLFAIFYF 369
           ++ D        
Sbjct: 246 LVADYFLTRILM 257


>gi|39995923|ref|NP_951874.1| hypothetical protein GSU0817 [Geobacter sulfurreducens PCA]
 gi|39982687|gb|AAR34147.1| conserved hypothetical protein [Geobacter sulfurreducens PCA]
 gi|298504937|gb|ADI83660.1| transporter membrane protein of unknown function DUF140 [Geobacter
           sulfurreducens KN400]
          Length = 257

 Score =  194 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/249 (28%), Positives = 130/249 (52%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            I K    +      +G ++        +     G  + + +Q++++G   + V++L + 
Sbjct: 5   SIEKIGALTLFVVREMGKMLIFLTYALVNIVIRPGKPIHIYKQIHFIGAKSLFVIVLTAA 64

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
            TG V+  QG + L++FG+E      +++  +RE+G +L+A+M+ GR+GSAI AEIG  K
Sbjct: 65  FTGMVLGLQGYYTLAKFGSEGMLGSAVALSLIRELGPVLSALMVVGRAGSAITAEIGIKK 124

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           I E+IDA++TM L+  + L+SP+I A +I+LPLL  + +   I G  +V  K   +    
Sbjct: 125 ITEQIDALKTMALEPFKYLVSPKILAALIALPLLCAIFDVVGIYGGYVVGVKLLGVNPGA 184

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +FS    +    ++++G++K+      I  V   +G+     +  + +  T  VV S  +
Sbjct: 185 YFSEMERSVEWKDVWSGIVKSFSFGGIIAWVCCYKGYHASHGAEGVSRATTEAVVMSSVL 244

Query: 357 VIIIDSLFA 365
           V+I D    
Sbjct: 245 VLIWDYFLT 253


>gi|291279509|ref|YP_003496344.1| ABC transporter permease [Deferribacter desulfuricans SSM1]
 gi|290754211|dbj|BAI80588.1| ABC transporter, permease [Deferribacter desulfuricans SSM1]
          Length = 256

 Score =  194 bits (494), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 70/248 (28%), Positives = 128/248 (51%)

Query: 122 INDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAV 181
                +  +  G +     +F   ++     +  L +QM ++GV+ + V+IL    TG V
Sbjct: 9   GAPILNFIYGSGRIFLFFIDFFRWAFIPPYRVRLLFKQMEFIGVNSLSVIILTGTFTGMV 68

Query: 182 IAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEI 241
            A Q      +FGAE     ++ +   RE+G +L+++M+A R+GSAI AEIG+M++ E+I
Sbjct: 69  FAFQSYIGFHRFGAEYMVGTVVGLGMARELGPVLSSIMVAARAGSAIAAEIGTMRVTEQI 128

Query: 242 DAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           DA+  + ++ V+ L+ PR+ A +I +P+L I+A F  ++G   V  +   I   ++    
Sbjct: 129 DALYALAVEPVQYLVVPRMLAGVIVMPILNIIAVFCGVVGGYFVGVEILGINKTLYLEYM 188

Query: 302 HSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIID 361
           +      +I+ G+IKA      + +V   +GF     +  +GK  T  VV S  ++++ D
Sbjct: 189 YRYVDFDDIYNGIIKATVFGLILTLVGCYKGFYTSGGAEGVGKSTTESVVLSSVLILVFD 248

Query: 362 SLFAIFYF 369
            +   F F
Sbjct: 249 YILTAFMF 256


>gi|89054229|ref|YP_509680.1| hypothetical protein Jann_1738 [Jannaschia sp. CCS1]
 gi|88863778|gb|ABD54655.1| protein of unknown function DUF140 [Jannaschia sp. CCS1]
          Length = 260

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 64/251 (25%), Positives = 117/251 (46%)

Query: 120 KFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTG 179
                +      +G +     +          ++    RQ   +G   +PVV L +F TG
Sbjct: 9   ALGRATLIALATIGQIALFALDALRHLATPPFYIRETARQFLTIGWLSLPVVGLTAFFTG 68

Query: 180 AVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINE 239
             +A Q     ++F AE     +++I   RE+G +L  +M+AGR  +AI AEI +MK+ E
Sbjct: 69  GALALQIYAGGARFNAEAVVPQIVAISIARELGPVLGGLMVAGRVAAAIAAEIATMKVTE 128

Query: 240 EIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFS 299
           +IDA+RT+    ++ L +PR+ A  +SLP+L  + +   I G  +V     D   A + S
Sbjct: 129 QIDALRTLSTHPMKYLTAPRLIAATLSLPVLVAVGDSIGIFGGYLVSTSRLDFNPAAYLS 188

Query: 300 RFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVII 359
                 T+ ++ +GL+K       + ++    G   G  +  +G+  T  VV +  +++ 
Sbjct: 189 NTRDFLTIRDVTSGLVKGAVFGFIVALMGCYHGMNSGRGARGVGRATTQAVVSASILILA 248

Query: 360 IDSLFAIFYFA 370
            + L    +F+
Sbjct: 249 ANYLLTEAFFS 259


>gi|218885146|ref|YP_002434467.1| hypothetical protein DvMF_0038 [Desulfovibrio vulgaris str.
           'Miyazaki F']
 gi|218756100|gb|ACL06999.1| protein of unknown function DUF140 [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 381

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 85/369 (23%), Positives = 158/369 (42%), Gaps = 9/369 (2%)

Query: 7   TVFRFAGNWKSPEISEIADDVVMAIN-KSIQSDSAIVDLSAITEIDTIGAELIMYFMEKY 65
                +G W      + A         +     + I+    + + D+  A  +   +   
Sbjct: 20  LRLAVSGAWNLDAPPDGAARASAMARLREPGVATVILVAEGLGDWDSSLAIFVAGVVRAC 79

Query: 66  HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVKFINDS 125
             +      S     L  L+  +        +   +   ++   L   IG+ ++      
Sbjct: 80  RERNLSVDTSGLPAGLIRLVDLSFAV----PERAGAARGDARSGLLERIGEAVLALPMPV 135

Query: 126 CSQAHILGLVISNTGEFCASSYKFKGF-LLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
            S    +G V              +   LL     M   G + +P+V LIS + G ++A 
Sbjct: 136 GSTLDFIGEVAFALYRLARGKADMRRRDLLQF---MSESGSAALPIVSLISMLVGLILAF 192

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
            GA QL  FGA+I+   L++I  +R +G ++T + +AGR+G++  A +G+M++NEE+DA+
Sbjct: 193 VGAVQLRVFGAQIYVASLVAIAMVRVMGAIMTGITMAGRTGASYAAILGTMQVNEEVDAL 252

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
            TMGL  V  L+ PR+ AL++ LPLLT+ A+   ++G  IV     D+    + +     
Sbjct: 253 ATMGLRPVEQLVLPRLLALVVMLPLLTVYADLMGMLGGFIVGVFMLDLNPMEYLNATREA 312

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +LAN++ G+         + +     G   G  ++++G   T  VV  I  +I+  +  
Sbjct: 313 LSLANLWIGITHGAVFGVVVALCGCYHGMRCGRSASAVGAATTAAVVSGIVSIIVCTAFI 372

Query: 365 AIFYFAIGI 373
            +    +GI
Sbjct: 373 TVACEVLGI 381


>gi|149202595|ref|ZP_01879567.1| ABC transporter, inner membrane subunit [Roseovarius sp. TM1035]
 gi|149143877|gb|EDM31911.1| ABC transporter, inner membrane subunit [Roseovarius sp. TM1035]
          Length = 261

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 57/253 (22%), Positives = 115/253 (45%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           +        S    +G +     +  +   +   +    +  +  +G   +PVV + +  
Sbjct: 8   LASIGRTVLSGLAAIGRIALFAADTISQLARPPFYFREFLHALVQIGWLSLPVVGMTALF 67

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG  +A Q     ++F AE     +++I   RE+G +L  +M+A R  S+I AEIG+MK+
Sbjct: 68  TGGALALQIYAGGARFNAETVVPSIVAIGLTRELGPVLGGLMVAARVASSIAAEIGTMKV 127

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  + ++ L  PR+ A  +++P+L  + +   I+G  +V     D   A +
Sbjct: 128 TEQIDALTTLSTNPMKYLTLPRVLAATLAVPVLVGVGDVLGIMGGFLVGVGRLDFSAATY 187

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                      ++ +GLIK       + ++    G   G  +  +G+   + VV +  ++
Sbjct: 188 LHNTIDFLETWDVVSGLIKGAAFGFIVALMGCYYGMNSGRGAQGVGRATKSAVVAASVLI 247

Query: 358 IIIDSLFAIFYFA 370
           +  + L    +FA
Sbjct: 248 LASNYLLTELFFA 260


>gi|260753847|ref|YP_003226740.1| hypothetical protein Za10_1620 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|283856508|ref|YP_163326.2| hypothetical protein ZMO1591 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258553210|gb|ACV76156.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|283775512|gb|AAV90215.2| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ZM4]
          Length = 273

 Score =  194 bits (493), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 115/255 (45%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + +        +    +G +                +      + + +G + +PVV L +
Sbjct: 19  RCLAAIGRLFIAFLAGIGRIARFGMTILLRGALPPYYPGRFFHEFFEIGWNSLPVVALTA 78

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG+ +AQQ     S+F A+      + I  +RE+G +L  +M+ GR  SAI AE+G+M
Sbjct: 79  VFTGSALAQQVYAAASRFSAQSTVPAAVVIGMVRELGPVLVGLMVVGRVTSAIAAELGAM 138

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E+IDA+ T+  D  R L++PR++A  ++LP L +LAN   I G  ++          
Sbjct: 139 RVTEQIDAMETLHTDPYRYLLAPRLYAATLALPFLVMLANVIGIFGGYLLSISKLGFNPE 198

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            +           ++   L+K+      + ++    GF     +  +G+  T  VV +  
Sbjct: 199 NYLKVTREFLKAEDVHMALVKSAVFGFLVALLGCYNGFFATGGAAGVGRSTTRAVVSAFI 258

Query: 356 IVIIIDSLFAIFYFA 370
           +++  + +  +F+F 
Sbjct: 259 MILFSNLMITMFFFG 273


>gi|146277114|ref|YP_001167273.1| hypothetical protein Rsph17025_1067 [Rhodobacter sphaeroides ATCC
           17025]
 gi|145555355|gb|ABP69968.1| protein of unknown function DUF140 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 260

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 56/252 (22%), Positives = 114/252 (45%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +      +G +        +  ++   +    +  +  +G   +PVV L +  
Sbjct: 7   IAALGRATLGALAAIGRIALFAAAVISHLFRPPFYPREFLNALIQIGWLSLPVVGLTAIF 66

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG  +A Q     ++F AE     +++I   RE+G +L  +M+A R  S+I AEIG+MK+
Sbjct: 67  TGGALALQIYAGGARFSAEAVVPSIVAIGMTRELGPVLGGLMVAARVASSIAAEIGTMKV 126

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  + ++ L  PR+ A  +++P+L  + +   I G  +V     D   A +
Sbjct: 127 TEQIDALVTLSTNPLKYLAVPRVLAATLAVPVLVAVGDSIGIAGGWLVGVNRLDFNSATY 186

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    + ++ +GL+K       + ++    G   G  +  +G+   + VV +  ++
Sbjct: 187 IKNTVDFLEVWDVGSGLVKGAAFGFIVALMGCYHGMNSGRGAQGVGRATKSAVVAASVLI 246

Query: 358 IIIDSLFAIFYF 369
           +  + L    +F
Sbjct: 247 LAANYLLTEVFF 258


>gi|319954485|ref|YP_004165752.1| hypothetical protein Celal_2978 [Cellulophaga algicola DSM 14237]
 gi|319423145|gb|ADV50254.1| protein of unknown function DUF140 [Cellulophaga algicola DSM
           14237]
          Length = 258

 Score =  194 bits (492), Expect = 2e-47,   Method: Composition-based stats.
 Identities = 67/247 (27%), Positives = 129/247 (52%), Gaps = 1/247 (0%)

Query: 125 SCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQ 184
                  +G +   +G F   + +        +RQ Y +G   + +V++  F+ G V+  
Sbjct: 9   IKQALTEIGELTYFSGRFFREALRPPFEFNEFLRQCYQIGNRSLTLVLVTGFIIGLVLDL 68

Query: 185 QGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAI 244
           Q    + QFGA  +  +++ I  +RE+G ++TA++ AGR  S I AE+GSM++ E+IDA+
Sbjct: 69  QSRPTMIQFGAISWMPNMVGISIVRELGPVITALVCAGRISSGIGAELGSMRVTEQIDAM 128

Query: 245 RTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHST 304
              G +  + L+  R+ A I+ LPLL IL++  ++ G++++     ++ F ++F+     
Sbjct: 129 EVSGTNPFKYLVVTRVMASILMLPLLVILSDAVSLFGSALIENIKGNVSFQLYFNTIFDA 188

Query: 305 ATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLF 364
            +  ++   +IK  F   AIG+V   +G+     +  +G    T VV +  ++ +ID + 
Sbjct: 189 LSYTDLIPAIIKTFFFGFAIGLVGCFKGYYCKKGTAGVGIAANTAVVMTSLLLFVIDFV- 247

Query: 365 AIFYFAI 371
           A+F   I
Sbjct: 248 AVFISNI 254


>gi|241762420|ref|ZP_04760498.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|241373014|gb|EER62672.1| protein of unknown function DUF140 [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
          Length = 273

 Score =  194 bits (492), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 58/255 (22%), Positives = 115/255 (45%)

Query: 116 KKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILIS 175
           + +        +    +G +                +      + + +G + +PVV L +
Sbjct: 19  RCLAAIGRLFIAFLAGIGRIARFGITILLRGALPPYYPGRFFHEFFEIGWNSLPVVALTA 78

Query: 176 FVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSM 235
             TG+ +AQQ     S+F A+      + I  +RE+G +L  +M+ GR  SAI AE+G+M
Sbjct: 79  VFTGSALAQQVYAAASRFSAQSTVPAAVVIGMVRELGPVLVGLMVVGRVTSAIAAELGAM 138

Query: 236 KINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFA 295
           ++ E+IDA+ T+  D  R L++PR++A  ++LP L +LAN   I G  ++          
Sbjct: 139 RVTEQIDAMETLHTDPYRYLLAPRLYAATLALPFLVMLANVIGIFGGYLLSISKLGFNPE 198

Query: 296 VFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSIS 355
            +           ++   L+K+      + ++    GF     +  +G+  T  VV +  
Sbjct: 199 NYLKVTREFLKAEDVHMALVKSTVFGFLVALLGCYNGFFATGGAAGVGRSTTRAVVSAFI 258

Query: 356 IVIIIDSLFAIFYFA 370
           +++  + +  +F+F 
Sbjct: 259 MILFSNLMITMFFFG 273


>gi|299136991|ref|ZP_07030174.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX8]
 gi|298601506|gb|EFI57661.1| protein of unknown function DUF140 [Acidobacterium sp. MP5ACTX8]
          Length = 259

 Score =  193 bits (491), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 71/255 (27%), Positives = 128/255 (50%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
           K+V     + +    +      +G    + +    ++     QM  +GV  +P+V+L  F
Sbjct: 2   KLVSPGAFAKNVVASVQEYSLLSGRAIGNLFTNPRYIADTFTQMDSIGVGSLPIVVLTGF 61

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
            TG V+A Q A  L +FGA   +  L+++  ++E+G +LT +M++GR+ S + +E+GSMK
Sbjct: 62  FTGCVLALQAAVSLKEFGAINMTGKLVALSMVKELGPVLTGLMVSGRNASGMASELGSMK 121

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + E+IDA+R +G D +R L++PR+ A +  L  LTI+++     G ++V      +    
Sbjct: 122 VTEQIDAMRALGTDPIRKLVTPRLVATVFMLFFLTIISDACGTGGGALVAVVLLRLNGPA 181

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           FF   + +    ++  GL+K  F    I  +    G      +  +GK  T  VV S  +
Sbjct: 182 FFHTAYMSLVGGDVVEGLVKPLFSGFIIATIGCYYGLRTTGGTQGVGKATTQAVVASSVL 241

Query: 357 VIIIDSLFAIFYFAI 371
           +I++D L       I
Sbjct: 242 IILVDFLVTQLMIGI 256


>gi|225871870|ref|YP_002753324.1| transporter, putative ER-chloroplast lipid translocase (ECLT)
           family [Acidobacterium capsulatum ATCC 51196]
 gi|225792942|gb|ACO33032.1| transporter, putative ER-chloroplast lipid translocase (ECLT)
           family [Acidobacterium capsulatum ATCC 51196]
          Length = 259

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 64/238 (26%), Positives = 120/238 (50%)

Query: 134 LVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQF 193
                T     + ++   +   ++ Q  Y+G+  +P+VIL  F TG V+A   A  L+QF
Sbjct: 19  EYALLTTRALLNLFRRPFYWSDIVFQADYIGIGSLPIVILTGFFTGGVLALNSASTLAQF 78

Query: 194 GAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVR 253
           GA   +  L+S+  ++E+G +LT++M++GR+ S + +E+GSM + E++DA+R +G D ++
Sbjct: 79  GATAVTGQLVSLSMIKELGPVLTSLMVSGRNASGMASELGSMIVTEQVDAMRALGTDPMK 138

Query: 254 ILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTG 313
            L+ PRI A +  +  LTI+++    +G + V         + +F   +      ++F G
Sbjct: 139 KLVMPRIVATVCMMFFLTIVSDAIGTLGGAFVSGILLGQNTSQYFHTAYQALRYPDVFEG 198

Query: 314 LIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFAI 371
           LIK       I  +    G      +  +G+  T  VV +  ++I  D   +    +I
Sbjct: 199 LIKPVIFGFIIATIGCFYGMKTRGGTQGVGRSTTQAVVVASVLIIATDFFISQIVISI 256


>gi|94969917|ref|YP_591965.1| hypothetical protein Acid345_2890 [Candidatus Koribacter versatilis
           Ellin345]
 gi|94551967|gb|ABF41891.1| protein of unknown function DUF140 [Candidatus Koribacter
           versatilis Ellin345]
          Length = 258

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 63/237 (26%), Positives = 117/237 (49%)

Query: 134 LVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQF 193
                 G    + +    +L   ++Q   +GV  +P+VIL  F TGA +A   +  L +F
Sbjct: 19  EYAQLAGRSLTNLFSQPRYLSDTLQQADLIGVGSLPIVILAGFFTGAALALNTSATLQKF 78

Query: 194 GAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVR 253
           G+   +  L+S   +RE+G +LT +M+AGR+ S + +E+GSMK+ E+IDA+R +G D  +
Sbjct: 79  GSITLTGQLVSYSMVRELGPVLTGLMVAGRNSSGMASELGSMKVTEQIDAMRALGTDPSK 138

Query: 254 ILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTG 313
            L++PR+ + ++ L  L+I+++   + G  I+ W    +    +++  +      ++  G
Sbjct: 139 KLVTPRVISTVVMLFFLSIISDLLGMAGGFIISWTLLGLDANQYWTTAYQALVFQDVLMG 198

Query: 314 LIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFYFA 370
           L+K       I  V    G      +  +G+  T  VV +  ++I  D     F   
Sbjct: 199 LVKPVVFGFFIASVGCYYGMNATGGTQGVGRATTQAVVTASVLIIASDLFITRFLMV 255


>gi|152990804|ref|YP_001356526.1| ABC transporter, permease [Nitratiruptor sp. SB155-2]
 gi|151422665|dbj|BAF70169.1| ABC transporter, permease [Nitratiruptor sp. SB155-2]
          Length = 263

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 63/249 (25%), Positives = 113/249 (45%)

Query: 124 DSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIA 183
                    G  I    +     +K    +   ++QM  +GV  + V+ L +  TG V A
Sbjct: 14  QFFRMLERFGAFILFQIKILPLFFKPPYRVKETLQQMDIIGVGSLFVISLTAIFTGLVEA 73

Query: 184 QQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDA 243
            Q      +FGAE F    + +   +E+G +  A+M+  R+ SA+ AE+G+M++ E+IDA
Sbjct: 74  IQLYHGFHKFGAEEFMGYTIFVSISKELGPVFGALMLVSRAVSAMTAELGTMRVTEQIDA 133

Query: 244 IRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHS 303
           I T+ +D  + LI PR+ A  +S P+L I+  F   I A ++      +    + +   +
Sbjct: 134 IDTLAVDSKKYLIVPRVIAATLSTPILVIVFVFLGNIAAYLISVYALGVNPNSYKNTITT 193

Query: 304 TATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSL 363
               ++I TG+IKA      I I+    G+     +  +G   T  VV +   V + +  
Sbjct: 194 YLEFSDIGTGIIKAFVFGYLISIIGTYIGYFTRGGARGVGLSTTKSVVYAAMTVFVANYF 253

Query: 364 FAIFYFAIG 372
            +  +  + 
Sbjct: 254 LSTLFLYLD 262


>gi|126727195|ref|ZP_01743032.1| ABC transporter, inner membrane subunit [Rhodobacterales bacterium
           HTCC2150]
 gi|126703623|gb|EBA02719.1| ABC transporter, inner membrane subunit [Rhodobacterales bacterium
           HTCC2150]
          Length = 258

 Score =  193 bits (490), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 61/253 (24%), Positives = 115/253 (45%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            +      +      +G V            +   ++    + +  +G   +PVV L + 
Sbjct: 4   ALATLGQSTLGLLAAIGRVCLFAFSVVTHMLRPPFYIREFSQALLNIGFFSLPVVGLTAL 63

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
            TG  +A Q     ++F AE     ++SI  +RE+G +L+ +M+AGR  ++I AE+ SMK
Sbjct: 64  FTGGALALQIYAGGARFNAEAVVPSIVSIGMVRELGPVLSGLMVAGRVSASIAAELASMK 123

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + E+IDA+ T+  + ++ L  PR+ A  ++LP+L  + +   I G  +V     D   A 
Sbjct: 124 VTEQIDALVTLSSNPLKYLAVPRVLAATLTLPILVAVGDSIGIFGGYLVGVNSLDFNAAG 183

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +     +   L ++ +GLIK       + I+    G   G  +  +G+     VV S  +
Sbjct: 184 YLKNTVTFLELWDVTSGLIKGAVFGFILSIMGCYHGMNSGRGAQGVGRATINAVVSSSIL 243

Query: 357 VIIIDSLFAIFYF 369
           ++  + L    +F
Sbjct: 244 ILAANYLLTSLFF 256


>gi|209543397|ref|YP_002275626.1| hypothetical protein Gdia_1228 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531074|gb|ACI51011.1| protein of unknown function DUF140 [Gluconacetobacter
           diazotrophicus PAl 5]
          Length = 383

 Score =  193 bits (490), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 83/377 (22%), Positives = 157/377 (41%), Gaps = 17/377 (4%)

Query: 4   NGITVFRFAGNWKSPEISEIADDVV----MAINKSIQSDSAIVDLSAITEIDTIGAELIM 59
           +G TV   +GNW +         +       + ++           A+   DT     + 
Sbjct: 17  DGATVIVLSGNWLAQGGQGPGGPIPTFPPDGLRQAAPGRPLTFRSDALGRWDTGLIAFLW 76

Query: 60  YFMEKY---HGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
              ++    H  ++   +     +L  L+          +    +            +G 
Sbjct: 77  DLKQRATQAHLDLRTDTLPDSARKLLDLLPEAPPPPPTPRPRTFAP--------VTALGA 128

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
             ++ + +  +   +         E      + +     L+  +   G S + +V +++F
Sbjct: 129 FTIESLTEIGTVTELGVETARGGLEAVTGRGRMRSI--DLMSNIRDAGPSALLIVSVVNF 186

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + GA++A  GA QL +F A+I+   L+ I  +RE+  ++TA+++AGR+G A  A I +M+
Sbjct: 187 LVGAILAFVGAVQLRKFAADIYVASLVGIAMVREMSAVMTAIIMAGRTGGAYAARIATMQ 246

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
            NEEIDA+   G+     LI P I  L+ ++P L +      ++G   V      +  A 
Sbjct: 247 GNEEIDALTVFGIPVSSYLILPSILGLVATMPFLYLYGCLIGMLGGFTVAISMLAVTGAG 306

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +F +  +   L     G IK+ F A  IG+ + + G   G  +  +G   T  VV  I  
Sbjct: 307 YFHQTINAVGLNQFEFGFIKSIFFAILIGLTSCRIGLRSGRSAADVGVAATRAVVVGIVG 366

Query: 357 VIIIDSLFAIFYFAIGI 373
           VI +D++FA+    +GI
Sbjct: 367 VITLDAIFAVIATTLGI 383


>gi|322420104|ref|YP_004199327.1| hypothetical protein GM18_2600 [Geobacter sp. M18]
 gi|320126491|gb|ADW14051.1| protein of unknown function DUF140 [Geobacter sp. M18]
          Length = 258

 Score =  192 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 71/265 (26%), Positives = 130/265 (49%), Gaps = 9/265 (3%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
              +   +GK+++ F       A ++G ++    E           + S++ QM  +G  
Sbjct: 1   MTQVFEPLGKRVLYFYQVMGEMAILMGKIVYFVREA-------PRNIPSILAQMAIIGWD 53

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
            +PV  +++F  G V+A Q   +L ++G +     ++    +RE+G ++T+ ++AGR GS
Sbjct: 54  TLPVASVMAFFVGMVLALQTGVELQKYGGQNIIGAIVGHSMVRELGPVMTSFLVAGRCGS 113

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A+ AE+G M + EEIDA++T+ +D VR L  PR  A II +P L I A+   I G +++ 
Sbjct: 114 AMAAELGVMTVYEEIDALKTLDIDPVRYLAMPRFIACIICVPALVIYADLIGITGGALIS 173

Query: 287 WK--YYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
                  + +A ++    +   +  I  GL K+      I +V+   GFA    +  +G+
Sbjct: 174 NLHPQIFVSYATYYDSLTAALKMKEIGIGLTKSMVFGAIIALVSCYVGFATSGGARGIGQ 233

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYF 369
             T  VV S  +++I D +      
Sbjct: 234 STTRSVVLSFMLILIADYVLTRLLM 258


>gi|148265726|ref|YP_001232432.1| hypothetical protein Gura_3706 [Geobacter uraniireducens Rf4]
 gi|146399226|gb|ABQ27859.1| protein of unknown function DUF140 [Geobacter uraniireducens Rf4]
          Length = 258

 Score =  192 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 73/265 (27%), Positives = 128/265 (48%), Gaps = 9/265 (3%)

Query: 107 FKNLHYHIGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVS 166
              +   IGKK++ F         +LG  I    E           + S+  QM  +G  
Sbjct: 1   MTGVFDRIGKKVILFHEIVGEMLILLGQTIYFFREA-------PRNIASIFAQMAIIGYE 53

Query: 167 GVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGS 226
            +PV  +++F  G V+A Q   +L ++G++     ++    +RE+G ++T+ ++AGR+GS
Sbjct: 54  TLPVASVMAFFVGMVLALQTGVELQKYGSQNIIGAIVGHSMVRELGPVMTSFLVAGRAGS 113

Query: 227 AIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVI 286
           A+ AE+G M + EEIDA++T+ ++ VR L  PR  A I+ LP L I ++F  I G +I+ 
Sbjct: 114 AMAAELGVMTVYEEIDALKTLDINPVRYLAMPRFIACIVCLPALVIYSDFIGITGGAIIS 173

Query: 287 WKY--YDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGK 344
             +    + ++ ++    +      I  GLIKA      I +V+   GF     +  +G 
Sbjct: 174 NLHPKIFVSYSTYYDSLTAALKFHEIGIGLIKAFVFGAIIALVSCYIGFKTSGGARGIGI 233

Query: 345 KVTTCVVQSISIVIIIDSLFAIFYF 369
             T  VV S  ++++ D        
Sbjct: 234 STTRSVVLSFMLILVADYFLTRILM 258


>gi|163788065|ref|ZP_02182511.1| ABC transporter, permease [Flavobacteriales bacterium ALC-1]
 gi|159876385|gb|EDP70443.1| ABC transporter, permease [Flavobacteriales bacterium ALC-1]
          Length = 260

 Score =  192 bits (489), Expect = 6e-47,   Method: Composition-based stats.
 Identities = 79/247 (31%), Positives = 128/247 (51%)

Query: 117 KIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISF 176
            + K      S    +G +   TG F    +K       L+ Q Y +G   + +V +  F
Sbjct: 3   GMHKIKAQLDSFLIEIGDMSYFTGRFFKELFKRPFEFKELLNQCYSMGNKSLLLVGITGF 62

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMK 236
           + G V+  Q    L +FGA  +   ++SI  +REIG +LTA++ AGR GS I AEIGSMK
Sbjct: 63  IIGLVLTLQTRPTLMEFGAVSWMPSMVSISIVREIGPILTALVCAGRIGSGIGAEIGSMK 122

Query: 237 INEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAV 296
           + E+IDA+   G +  + L+  R+ A+ + LPLL I+ +  A++G+ +V     D+ F +
Sbjct: 123 VTEQIDAMEVSGTNPFKYLVVTRVLAVTLMLPLLVIIGDAVALLGSYLVESVKGDVSFVL 182

Query: 297 FFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISI 356
           +F++        +I    IK+ F   AIGIV   +G+     +  +GK   T VV +  +
Sbjct: 183 YFNQVFDALKFGDIMPATIKSFFFGLAIGIVGCYKGYYCKKGTAGVGKAANTAVVFTSLL 242

Query: 357 VIIIDSL 363
           + IID +
Sbjct: 243 LFIIDFI 249


>gi|77463016|ref|YP_352520.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           2.4.1]
 gi|126461890|ref|YP_001043004.1| hypothetical protein Rsph17029_1122 [Rhodobacter sphaeroides ATCC
           17029]
 gi|77387434|gb|ABA78619.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           2.4.1]
 gi|126103554|gb|ABN76232.1| protein of unknown function DUF140 [Rhodobacter sphaeroides ATCC
           17029]
          Length = 260

 Score =  192 bits (488), Expect = 7e-47,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 116/252 (46%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +      +G +    G   +  ++   +   L+  +  +G   +PVV L +  
Sbjct: 7   IAALGRATLGMLAAVGRIALFAGAVVSHIFRPPFYPRELLTALIQIGWLSLPVVGLTAIF 66

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG  +A Q     ++F AE     +++I   RE+G +L  +M+A R  S+I AEIG+MK+
Sbjct: 67  TGGALALQIYAGGARFSAEAVVPSIVAIGMTRELGPVLGGLMVAARVASSIAAEIGTMKV 126

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  + ++ L  PR+ A  +++P+L  + +   I G  +V     D   A +
Sbjct: 127 TEQIDALVTLSTNPLKYLAVPRVLAATLAVPILVAVGDSIGIAGGWLVGVNRLDFNSATY 186

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    + ++ +GL+K       + ++    G   G  +  +G+   + VV +  ++
Sbjct: 187 IKNTTDFLEVWDVGSGLVKGAAFGFIVALMGCYHGMNSGRGAQGVGRATKSAVVAASVLI 246

Query: 358 IIIDSLFAIFYF 369
           +  + L    +F
Sbjct: 247 LAANYLLTEVFF 258


>gi|305664733|ref|YP_003861020.1| organic solvents resistance ABC transporter [Maribacter sp.
           HTCC2170]
 gi|88707855|gb|EAR00094.1| ABC-type transport system involved in resistance to organic
           solvents [Maribacter sp. HTCC2170]
          Length = 264

 Score =  192 bits (488), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 65/246 (26%), Positives = 121/246 (49%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
            ++ +         +G + +    F   + K       L+RQ Y +G   + +V +  F+
Sbjct: 8   TIQSVQKLRQFFVEIGELSNFAMRFFKEALKPPYEFKELLRQCYNMGNRSLVLVGVTGFI 67

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
            G V+  Q    L +FGA  +  +++ I  +REIG ++TA++ AGR  S I AE+GSM++
Sbjct: 68  IGLVLTLQSRPTLIEFGAVSWMPNMVGISIVREIGPVITALICAGRIASGIGAELGSMRV 127

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+   G +  + L+  RI A  + LPLL I  +  A+ G+++V     ++ F ++
Sbjct: 128 TEQIDAMEVSGTNPFKYLVVTRIMATTLMLPLLVIFGDLVALYGSALVENLKGNVSFQLY 187

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
           F+         ++    IK+ F    IG+V   +G+     +  +G    T VV +  ++
Sbjct: 188 FNTVFDALEFGDLIPATIKSFFFGFTIGLVGCYKGYYSKKGTAGVGVAANTAVVLASLLL 247

Query: 358 IIIDSL 363
             +D +
Sbjct: 248 FFVDFI 253


>gi|221638873|ref|YP_002525135.1| ABC transporter inner membrane subunit [Rhodobacter sphaeroides
           KD131]
 gi|221159654|gb|ACM00634.1| ABC transporter, inner membrane subunit [Rhodobacter sphaeroides
           KD131]
          Length = 260

 Score =  192 bits (488), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 58/252 (23%), Positives = 116/252 (46%)

Query: 118 IVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFV 177
           I      +      +G +    G   +  ++   +   L+  +  +G   +PVV L +  
Sbjct: 7   IAALGRATLGMLAAVGRIALFAGAVVSHLFRPPFYPRELLTALIQIGWLSLPVVGLTAIF 66

Query: 178 TGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKI 237
           TG  +A Q     ++F AE     +++I   RE+G +L  +M+A R  S+I AEIG+MK+
Sbjct: 67  TGGALALQIYAGGARFSAEAVVPSIVAIGMTRELGPVLGGLMVAARVASSIAAEIGTMKV 126

Query: 238 NEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVF 297
            E+IDA+ T+  + ++ L  PR+ A  +++P+L  + +   I G  +V     D   A +
Sbjct: 127 TEQIDALVTLSTNPLKYLAVPRVLAATLAVPILVAVGDSIGIAGGWLVGVNRLDFNSATY 186

Query: 298 FSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIV 357
                    + ++ +GL+K       + ++    G   G  +  +G+   + VV +  ++
Sbjct: 187 IKNTTDFLEVWDVGSGLVKGAAFGFIVALMGCYHGMNSGRGAQGVGRATKSAVVAASVLI 246

Query: 358 IIIDSLFAIFYF 369
           +  + L    +F
Sbjct: 247 LAANYLLTEVFF 258


>gi|46447386|ref|YP_008751.1| hypothetical protein pc1752 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|46401027|emb|CAF24476.1| conserved hypothetical protein [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 240

 Score =  192 bits (488), Expect = 8e-47,   Method: Composition-based stats.
 Identities = 65/219 (29%), Positives = 119/219 (54%)

Query: 148 KFKGFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQ 207
           +     + +  Q++ +GV  +PVV +  F TG V+A Q  FQLS  G    +  +++   
Sbjct: 5   RRPPTWILIRDQLFDIGVMSLPVVAITGFSTGMVLAAQSFFQLSDKGLASATGLMVAKAM 64

Query: 208 LREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISL 267
           L E+G +LTA M+ GR G+A+ AE+G+M++ E+IDA+RTM ++ +  L++PR  A +I +
Sbjct: 65  LVELGPVLTAFMVTGRVGAAMCAELGTMRVTEQIDAMRTMSVNPLGYLVAPRFLAGMIMM 124

Query: 268 PLLTILANFSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIV 327
           PLLT+ +    I G  ++   +Y +P + F           +  +G++KA      I  +
Sbjct: 125 PLLTVFSAIMGIFGGYLIAVYFYKMPASSFIDPLPLHINTFDFISGMVKAFVFGIIIVTI 184

Query: 328 AMKEGFAVGVHSNSLGKKVTTCVVQSISIVIIIDSLFAI 366
           +  +G      +  +G+  T  VV   S+++II+ +  +
Sbjct: 185 SCYKGMKTRGGAAGVGRSTTNSVVICYSVILIINFILTL 223


>gi|312887098|ref|ZP_07746702.1| protein of unknown function DUF140 [Mucilaginibacter paludis DSM
           18603]
 gi|311300410|gb|EFQ77475.1| protein of unknown function DUF140 [Mucilaginibacter paludis DSM
           18603]
          Length = 256

 Score =  192 bits (487), Expect = 1e-46,   Method: Composition-based stats.
 Identities = 73/255 (28%), Positives = 130/255 (50%)

Query: 119 VKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVT 178
           +  I D+ S     G +   TG F +   + +  +  L+ Q Y +G    P++ L  F+ 
Sbjct: 1   MALIEDTRSFLDETGSMAKFTGHFFSHGLRPRFEVKELLGQCYTIGYKSFPLIGLTGFIM 60

Query: 179 GAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKIN 238
           G V+  Q    L  +G +     ++ I  +REIG ++TA++ AG+ GS+I AE+GSMK+ 
Sbjct: 61  GLVLTMQLRPSLVSYGVQSELPVMVGIAIVREIGPVITALIFAGKIGSSIGAELGSMKVT 120

Query: 239 EEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFF 298
           E+IDA+   G +  + L++ R+ A  + LP+LT+L +  ++ GA I +          FF
Sbjct: 121 EQIDAMEVSGTNPYKYLVATRVLATTLMLPILTVLGDAISLFGAYIGVNLSSVTSLHFFF 180

Query: 299 SRFHSTATLANIFTGLIKAPFMACAI