RPSBLAST alignment for GI: 254780138 and conserved domain: pfam02405

>gnl|CDD|145511 pfam02405, DUF140, Domain of unknown function DUF140. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 150 amino acids long. Length = 215
 Score =  219 bits (561), Expect = 9e-58
 Identities = 86/213 (40%), Positives = 131/213 (61%)

Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215
           ++RQ+Y+VGV  +P+V L +F  GAV+A QGA+QL QFGAE F   L+++  +RE+G +L
Sbjct: 3   ILRQIYFVGVGSLPIVALTAFFIGAVLALQGAYQLRQFGAESFVGALVALSLVRELGPVL 62

Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275
           TA+++AGR GSAI AE+G+M++ EEIDA+  MG+D +R L+ PR+ A +I+LPLLTI+A+
Sbjct: 63  TALLVAGRVGSAITAELGTMRVTEEIDALEVMGIDPIRYLVLPRVLAGVIALPLLTIIAD 122

Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335
              I+G  +V      I    F   F S     ++  GLIKA      I ++    G   
Sbjct: 123 LVGILGGYLVAVVVLGISPGAFLHSFQSFVDPTDVLVGLIKAVVFGLIIALIGCYYGLTA 182

Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368
              +  +G+  T  VV SI  +I++D +    +
Sbjct: 183 KGGAEGVGRATTRAVVTSIVAIIVLDFVLTALF 215