RPSBLAST alignment for GI: 254780138 and conserved domain: COG0767

>gnl|CDD|31110 COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 267
 Score =  220 bits (562), Expect = 6e-58
 Identities = 102/260 (39%), Positives = 148/260 (56%), Gaps = 7/260 (2%)

Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173
           +GK ++K +         LG      G      ++       L+RQ+Y+VGV  +P+V L
Sbjct: 15  LGKALLKTLRS-------LGRAFLFLGNALRGLFREPFRPRELVRQLYFVGVGSLPIVAL 67

Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233
            S   GAV+A QG  QL  FGAE FS  L+++  LRE+G +LTA+++AGR GSAI AEIG
Sbjct: 68  TSLFVGAVLALQGYTQLRDFGAEDFSGFLVALSLLRELGPVLTALVVAGRVGSAITAEIG 127

Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293
           +M+I EEIDA+  MG+D +  L++PR+ A +I LPLLT LA+ + I+G  +V      I 
Sbjct: 128 AMRITEEIDALEVMGIDPISRLVAPRVLAGVIVLPLLTALADAAGILGGYLVAVFLLGIS 187

Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353
              F SR  +     ++  GLIKAP     IG++    G+ VG     +G+  T  VV S
Sbjct: 188 PGAFLSRLQTFVGPEDVLIGLIKAPVFGVIIGLIGCYYGYTVGGGPEGVGRATTRSVVTS 247

Query: 354 ISIVIIIDSLFAIFYFAIGI 373
           I +VI++D +     F +GI
Sbjct: 248 ILVVIVLDFVLTALMFGVGI 267