RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62] (373 letters) >gnl|CDD|31110 COG0767, Ttg2B, ABC-type transport system involved in resistance to organic solvents, permease component [Secondary metabolites biosynthesis, transport, and catabolism]. Length = 267 Score = 220 bits (562), Expect = 6e-58 Identities = 102/260 (39%), Positives = 148/260 (56%), Gaps = 7/260 (2%) Query: 114 IGKKIVKFINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVIL 173 +GK ++K + LG G ++ L+RQ+Y+VGV +P+V L Sbjct: 15 LGKALLKTLRS-------LGRAFLFLGNALRGLFREPFRPRELVRQLYFVGVGSLPIVAL 67 Query: 174 ISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIG 233 S GAV+A QG QL FGAE FS L+++ LRE+G +LTA+++AGR GSAI AEIG Sbjct: 68 TSLFVGAVLALQGYTQLRDFGAEDFSGFLVALSLLRELGPVLTALVVAGRVGSAITAEIG 127 Query: 234 SMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIP 293 +M+I EEIDA+ MG+D + L++PR+ A +I LPLLT LA+ + I+G +V I Sbjct: 128 AMRITEEIDALEVMGIDPISRLVAPRVLAGVIVLPLLTALADAAGILGGYLVAVFLLGIS 187 Query: 294 FAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQS 353 F SR + ++ GLIKAP IG++ G+ VG +G+ T VV S Sbjct: 188 PGAFLSRLQTFVGPEDVLIGLIKAPVFGVIIGLIGCYYGYTVGGGPEGVGRATTRSVVTS 247 Query: 354 ISIVIIIDSLFAIFYFAIGI 373 I +VI++D + F +GI Sbjct: 248 ILVVIVLDFVLTALMFGVGI 267 >gnl|CDD|145511 pfam02405, DUF140, Domain of unknown function DUF140. This domain has no known function nor do any of the proteins that possess it. The aligned region is approximately 150 amino acids long. Length = 215 Score = 219 bits (561), Expect = 9e-58 Identities = 86/213 (40%), Positives = 131/213 (61%) Query: 156 LIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLL 215 ++RQ+Y+VGV +P+V L +F GAV+A QGA+QL QFGAE F L+++ +RE+G +L Sbjct: 3 ILRQIYFVGVGSLPIVALTAFFIGAVLALQGAYQLRQFGAESFVGALVALSLVRELGPVL 62 Query: 216 TAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLDFVRILISPRIWALIISLPLLTILAN 275 TA+++AGR GSAI AE+G+M++ EEIDA+ MG+D +R L+ PR+ A +I+LPLLTI+A+ Sbjct: 63 TALLVAGRVGSAITAELGTMRVTEEIDALEVMGIDPIRYLVLPRVLAGVIALPLLTIIAD 122 Query: 276 FSAIIGASIVIWKYYDIPFAVFFSRFHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAV 335 I+G +V I F F S ++ GLIKA I ++ G Sbjct: 123 LVGILGGYLVAVVVLGISPGAFLHSFQSFVDPTDVLVGLIKAVVFGLIIALIGCYYGLTA 182 Query: 336 GVHSNSLGKKVTTCVVQSISIVIIIDSLFAIFY 368 + +G+ T VV SI +I++D + + Sbjct: 183 KGGAEGVGRATTRAVVTSIVAIIVLDFVLTALF 215 >gnl|CDD|132914 cd07043, STAS_anti-anti-sigma_factors, Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation. Anti-anti-sigma factors play an important role in the regulation of several sigma factors and their corresponding anti-sigma factors. Upon dephosphorylation they bind the anti-sigma factor and induce the release of the sigma factor from the anti-sigma factor. In a feedback mechanism the anti-anti-sigma factor can be inactivated via phosphorylation by the anti-sigma factor. Well studied examples from Bacillus subtilis are SpoIIAA (regulating sigmaF and sigmaC which play an important role in sporulation) and RsbV (regulating sigmaB involved in the general stress response). The STAS domain is also found in the C- terminal region of sulphate transporters and stressosomes. Length = 99 Score = 32.1 bits (74), Expect = 0.25 Identities = 17/88 (19%), Positives = 38/88 (43%), Gaps = 5/88 (5%) Query: 3 ENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYF- 61 G+ V R +G + E+ + + + + + ++DLS +T ID+ G +++ Sbjct: 6 RGGVLVVRLSGELDAATAPELREALEELLAEGPRR--LVLDLSGVTFIDSSGLGVLLGAY 63 Query: 62 --MEKYHGKIKLQGVSTHIEQLFSLISF 87 G++ L VS + ++ L Sbjct: 64 KRARAAGGRLVLVNVSPAVRRVLELTGL 91 >gnl|CDD|37454 KOG2243, KOG2243, KOG2243, Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms]. Length = 5019 Score = 29.7 bits (66), Expect = 1.3 Identities = 16/56 (28%), Positives = 32/56 (57%), Gaps = 7/56 (12%) Query: 55 AELIMYFMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQ-----RSFFYN 105 AE ++ + E + G+I++ G + IE+++ IS + R + +KPQ R F ++ Sbjct: 4153 AESVLNYFEPFLGRIEIMGGAKKIERVYFEISESSRTQW--EKPQVKESKRQFIFD 4206 >gnl|CDD|145083 pfam01740, STAS, STAS domain. The STAS (after Sulphate Transporter and AntiSigma factor antagonist) domain is found in the C terminal region of Sulphate transporters and bacterial antisigma factor antagonists. It has been suggested that this domain may have a general NTP binding function. Length = 106 Score = 28.3 bits (64), Expect = 3.8 Identities = 17/90 (18%), Positives = 34/90 (37%), Gaps = 10/90 (11%) Query: 4 NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSA---IVDLSAITEIDTIGAELIMY 60 GI + R G P A+ + ++I+ I+DLS + ID+ G ++ Sbjct: 8 PGILILRLDG----PLDFANAEAFRERLLRAIEEGEIRHVILDLSGVPFIDSSGLGALLE 63 Query: 61 FMEKYH---GKIKLQGVSTHIEQLFSLISF 87 ++ ++ L G S + + Sbjct: 64 LYKELRRRGVELVLVGPSPEVRRTLEKTGL 93 >gnl|CDD|30407 COG0058, GlgP, Glucan phosphorylase [Carbohydrate transport and metabolism]. Length = 750 Score = 27.9 bits (62), Expect = 4.4 Identities = 34/157 (21%), Positives = 52/157 (33%), Gaps = 30/157 (19%) Query: 4 NGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFME 63 NGIT R W +P +AD + I +D I+D D ELI Sbjct: 410 NGITPRR----WLAPANPGLADLLDEKIGDEWLNDLDILDELLWFADDKAFRELIAEI-- 463 Query: 64 KYHGKIKL-------QGVSTHIEQLF------------SLISFTH----RKKIKNQKPQR 100 K K +L G+ LF L++ + +K R Sbjct: 464 KRENKKRLAEEIADRTGIEVDPNALFDGQARRIHEYKRQLLNLLDIERLYRILKEDWVPR 523 Query: 101 SFFYNSFK-NLHYHIGKKIVKFINDSCSQAHILGLVI 136 + K + + K+I+K IND + V+ Sbjct: 524 VQIIFAGKAHPADYAAKEIIKLINDVADVINNKLKVV 560 >gnl|CDD|132915 cd06586, TPP_enzyme_PYR, Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes. Thiamine pyrophosphate (TPP) family, pyrimidine (PYR) binding domain; found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. A polar interaction between the conserved glutamate of the PYR domain and the N1' of the TPP aminopyrimidine ring is shared by most TPP-dependent enzymes, and participates in the activation of TPP. The PYR and PP domains have a common fold, but do not share strong sequence conservation. The PP domain is not included in this group. Most TPP-dependent enzymes have the PYR and PP domains on the same subunit although these domains can be alternatively arranged in the primary structure. In the case of 2-oxoisovalerate dehydrogenase (2OXO), sulfopyruvate decarboxylase (ComDE), and the E1 component of human pyruvate dehydrogenase complex (E1- PDHc) the PYR and PP domains appear on different subunits. TPP-dependent enzymes are multisubunit proteins, the smallest catalytic unit being a dimer-of-active sites. For many of these enzymes the active sites lie between PP and PYR domains on different subunits. However, for the homodimeric enzymes 1-deoxy-D-xylulose 5-phosphate synthase (DXS) and Desulfovibrio africanus pyruvate:ferredoxin oxidoreductase (PFOR), each active site lies at the interface of the PYR and PP domains from the same subunit. Length = 154 Score = 27.3 bits (61), Expect = 6.8 Identities = 12/46 (26%), Positives = 16/46 (34%), Gaps = 3/46 (6%) Query: 152 FLLSLIRQMYYVGVSGVPVVILI---SFVTGAVIAQQGAFQLSQFG 194 LL+ I + +PVV LI A Q F L + Sbjct: 70 GLLNAINGLADAAAEHLPVVFLIGARGISAQAKQTFQSMFDLGMYR 115 >gnl|CDD|99996 cd04300, GT1_Glycogen_Phosphorylase, This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.. Length = 797 Score = 27.0 bits (61), Expect = 8.6 Identities = 6/13 (46%), Positives = 9/13 (69%) Query: 112 YHIGKKIVKFIND 124 Y++ K I+K IN Sbjct: 582 YYMAKLIIKLINA 594 >gnl|CDD|132839 cd07200, cPLA2_Grp-IVA, Group IVA cytosolic phospholipase A2; catalytic domain; Ca-dependent. Group IVA cPLA2, an 85 kDa protein, consists of two domains: the regulatory C2 domain and the alpha/beta hydrolase PLA2 domain. Group IVA cPLA2 is also referred to as cPLA2-alpha. The catalytic domain of cytosolic phospholipase A2 (cPLA2; EC 3.1.1.4) hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms. Movement of the cPLA2 lid possibly exposes a greater hydrophobic surface and the active site. cPLA2 belongs to the alpha-beta hydrolase family which is identified by a characteristic nucleophile elbow with a consensus sequence of Sm-X-Nu-Sm (Sm = small residue, X = any residue and Nu = nucleophile). Calcium is required for cPLA2 to bind with membranes or phospholipids. A calcium-dependent phospholipid binding domain resides in the N-terminal region of cPLA2; it is homologous to the C2 domain superfamily which is not included in this hierarchy. Includes PLA2G4A from chicken, human, and frog. Length = 505 Score = 27.0 bits (60), Expect = 9.3 Identities = 10/20 (50%), Positives = 12/20 (60%) Query: 208 LREIGVLLTAVMIAGRSGSA 227 L + GVL A +AG SGS Sbjct: 68 LYDSGVLDCATYVAGLSGST 87 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.327 0.140 0.401 Gapped Lambda K H 0.267 0.0719 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 4,428,234 Number of extensions: 243813 Number of successful extensions: 950 Number of sequences better than 10.0: 1 Number of HSP's gapped: 944 Number of HSP's successfully gapped: 73 Length of query: 373 Length of database: 6,263,737 Length adjustment: 95 Effective length of query: 278 Effective length of database: 4,210,882 Effective search space: 1170625196 Effective search space used: 1170625196 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 58 (26.1 bits)