BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus
Liberibacter asiaticus str. psy62]
         (373 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780138|ref|YP_003064551.1| ABC transporter [Candidatus Liberibacter asiaticus str. psy62]
          Length = 373

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60
           MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY
Sbjct: 1   MSENGITVFRFAGNWKSPEISEIADDVVMAINKSIQSDSAIVDLSAITEIDTIGAELIMY 60

Query: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120
           FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK
Sbjct: 61  FMEKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGKKIVK 120

Query: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180
           FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA
Sbjct: 121 FINDSCSQAHILGLVISNTGEFCASSYKFKGFLLSLIRQMYYVGVSGVPVVILISFVTGA 180

Query: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240
           VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE
Sbjct: 181 VIAQQGAFQLSQFGAEIFSIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEE 240

Query: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300
           IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR
Sbjct: 241 IDAIRTMGLDFVRILISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSR 300

Query: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360
           FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII
Sbjct: 301 FHSTATLANIFTGLIKAPFMACAIGIVAMKEGFAVGVHSNSLGKKVTTCVVQSISIVIII 360

Query: 361 DSLFAIFYFAIGI 373
           DSLFAIFYFAIGI
Sbjct: 361 DSLFAIFYFAIGI 373


>gi|254780474|ref|YP_003064887.1| ubiquinol oxidase, subunit II [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 332

 Score = 25.8 bits (55), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 23/54 (42%)

Query: 63  EKYHGKIKLQGVSTHIEQLFSLISFTHRKKIKNQKPQRSFFYNSFKNLHYHIGK 116
           E +  K+K QG   + ++   L   + R  ++   P     Y S  NL  H GK
Sbjct: 246 EDWISKVKRQGTFLNRQEYLLLKKPSERDSVRYFSPIEKGLYYSILNLCVHPGK 299


>gi|254780889|ref|YP_003065302.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 493

 Score = 24.3 bits (51), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 10/67 (14%)

Query: 177 VTGAVIAQQGAFQLSQFGAEIFSIDLM--SILQLR--------EIGVLLTAVMIAGRSGS 226
           + G +   +GA  L   GA+I  + +   SI   R        ++  +++ V +A R+G 
Sbjct: 278 MAGNIATAEGALALIDAGADIIKVGIGPGSICTTRVVTGVGCPQLSAIMSVVEVAERAGV 337

Query: 227 AIVAEIG 233
           AIVA+ G
Sbjct: 338 AIVADGG 344


>gi|254780579|ref|YP_003064992.1| hypothetical protein CLIBASIA_02330 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 207

 Score = 24.3 bits (51), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 151 GFLLSLIRQMYYVGVSGVPVVILISFVTGAVIAQQGAFQL--SQFGAEIF 198
           GF+ S IR +  + +   P V  I  +TG  I  + AF+L  +Q G +IF
Sbjct: 18  GFI-SFIRYVKQMHIPDHPSVSAIVVLTGEPIRIERAFELLENQIGEKIF 66


>gi|254780143|ref|YP_003064556.1| DNA-directed RNA polymerase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 1386

 Score = 23.9 bits (50), Expect = 4.3,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 56/124 (45%), Gaps = 7/124 (5%)

Query: 28  VMAINKSIQSDSAIVDLSAITEIDTIGAELIMYFMEKYHGKIKLQGVSTHIEQLFSLISF 87
           ++ + +SI+   + VD+ ++   D I A+ ++  + ++    +L  +  H+  L S I+ 
Sbjct: 479 LLRMERSIKERISSVDIDSVMPQDLINAKPVVSAVCEFFCSSQLSQLEEHVNSL-SRITH 537

Query: 88  THRKKIKNQKP-QRSFFYNSFKNLH-YHIGKKIVKFINDSCSQAHILGLVISNTGEFCAS 145
           T R     Q    R+      +++H  H G    +      S+ H +GLV S T     +
Sbjct: 538 TRRLSALGQGGVARARAGVEMRDVHPTHYG----RICPAETSEGHNIGLVSSLTSFARVN 593

Query: 146 SYKF 149
           +Y F
Sbjct: 594 AYGF 597


>gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional
           regulatory protein [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 495

 Score = 23.5 bits (49), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 4/47 (8%)

Query: 255 LISPRIWALIISLPLLTILANFSAIIGASIVIWKYYDIPFAVFFSRF 301
           L+ P  W    +   LTI  + + +I  SI     + +P+AVF S F
Sbjct: 126 LVEPGTW----TPEYLTIYKSATLLIALSISALSNFMLPYAVFLSFF 168


>gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 467

 Score = 23.5 bits (49), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 171 VILISFVTGAVIAQQGAFQLSQFGAEIFSIDLMSILQL 208
           V +ISF  G   A + A +L + G +   IDL +I  +
Sbjct: 341 VTIISFGIGMTYATKAAIELEKNGIDAELIDLRTIRPM 378


>gi|254780285|ref|YP_003064698.1| arginyl-tRNA synthetase [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 586

 Score = 23.1 bits (48), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 5/56 (8%)

Query: 216 TAVMIAGRS---GSAIVAE--IGSMKINEEIDAIRTMGLDFVRILISPRIWALIIS 266
            A MI  R        +AE  +  +KI+ ++D++   G  F+ + +SP     I+S
Sbjct: 48  NAAMILSRPLGLDPLTIAELIVARIKIDPDVDSVFIAGKGFINLYLSPSYLRKILS 103


>gi|254780368|ref|YP_003064781.1| electron transfer flavoprotein beta subunit [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 249

 Score = 22.7 bits (47), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 10/52 (19%)

Query: 199 SIDLMSILQLREIGVLLTAVMIAGRSGSAIVAEIGSMKINEEIDAIRTMGLD 250
            I L   LQLRE G+          +   IV  IGS K+ E +     MG D
Sbjct: 40  EIALEESLQLREKGI----------ATEVIVVSIGSCKVEEVLKNSLAMGAD 81


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.327    0.140    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 226,221
Number of Sequences: 1233
Number of extensions: 9218
Number of successful extensions: 42
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 34
Number of HSP's gapped (non-prelim): 13
length of query: 373
length of database: 328,796
effective HSP length: 75
effective length of query: 298
effective length of database: 236,321
effective search space: 70423658
effective search space used: 70423658
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 39 (19.6 bits)