RPSBLAST alignment for GI: 254780139 and conserved domain: PRK11248

>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional. Length = 255
 Score =  115 bits (290), Expect = 1e-26
 Identities = 67/199 (33%), Positives = 101/199 (50%), Gaps = 10/199 (5%)

Query: 13  ILSVRNLTIELNNRIILNNINLDILRGEILGVIGSSGTGKSILMRGILGLIPRVSGEVKV 72
           +L + +L  +   +  L +INL +  GE+L V+G SG GK+ L+  I G +P   G + +
Sbjct: 1   MLQISHLYADYGGKPALEDINLTLESGELLVVLGPSGCGKTTLLNLIAGFVPYQHGSITL 60

Query: 73  LGEHLNLAKGKQNFAFSAKLGVLFQHGALFSSMTVQENISMPIKEHLNLPADLIEHIVHT 132
            G+ +            A+ GV+FQ+  L     VQ+N++  + +   +       I H 
Sbjct: 61  DGKPVE--------GPGAERGVVFQNEGLLPWRNVQDNVAFGL-QLAGVEKMQRLEIAHQ 111

Query: 133 KIAIVGLPPETANLMPFQLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKL 192
            +  VGL         +QLSGG  +RV +ARALA +P LL LDEP   LD    E+   L
Sbjct: 112 MLKKVGLE-GAEKRYIWQLSGGQRQRVGIARALAANPQLLLLDEPFGALDAFTREQMQTL 170

Query: 193 LIKLRHSLGLSVYMITHDL 211
           L+KL    G  V +ITHD+
Sbjct: 171 LLKLWQETGKQVLLITHDI 189