RPSBLAST alignment for GI: 254780139 and conserved domain: PRK15093

>gnl|CDD|185049 PRK15093, PRK15093, antimicrobial peptide ABC transporter ATP-binding protein; Provisional. Length = 330
 Score = 53.7 bits (129), Expect = 4e-08
 Identities = 25/77 (32%), Positives = 46/77 (59%)

Query: 148 PFQLSGGMIKRVSLARALAIDPDLLFLDEPTSGLDPIAAEEFDKLLIKLRHSLGLSVYMI 207
           P++L+ G  ++V +A ALA  P LL  DEPT+ ++P    +  +LL +L  +   ++ +I
Sbjct: 156 PYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLTRLNQNNNTTILLI 215

Query: 208 THDLNNLISTCNRVAVI 224
           +HDL  L    +++ V+
Sbjct: 216 SHDLQMLSQWADKINVL 232