RPSBLAST alignment for GI: 254780139 and conserved domain: cd03221

>gnl|CDD|72980 cd03221, ABCF_EF-3, ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth. EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site. The reaction requires ATP hydrolysis. EF-3 contains two ATP nucleotide binding sequence (NBS) motifs. NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.. Length = 144
 Score = 53.2 bits (128), Expect = 8e-08
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 14 LSVRNLTIELNNRIILNNINLDILRGEILGVIGSSGTGKSILMRGILGLIPRVSGEVKV 72
          + + NL+     +++L +I+L I  G+ +G++G +G GKS L++ I G +    G V  
Sbjct: 1  IELENLSKTYGGKLLLKDISLTINPGDRIGLVGRNGAGKSTLLKLIAGELEPDEGIVTW 59