BLAST/PSIBLAST alignment of GI: 254780142 and GI: 222148358 at iteration 1
>gi|222148358|ref|YP_002549315.1| DNA-directed RNA polymerase subunit beta' [Agrobacterium vitis S4] Length = 1403
>gi|221735346|gb|ACM36309.1| DNA-directed RNA polymerase beta subunit [Agrobacterium vitis S4] Length = 1403
 Score = 2088 bits (5410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 986/1378 (71%), Positives = 1173/1378 (85%)

Query: 1    MQQEVMRFFNPWTDDRGFDSVRISIASPAKIASLSYGEIKKPETINYRTFKPERDGLFCA 60
            M QEVM  FNP    + FDS+RISIASP KI S SYGEIKKPETINYRTFKPERDGLFCA
Sbjct: 1    MNQEVMNLFNPQVPAQHFDSIRISIASPEKILSWSYGEIKKPETINYRTFKPERDGLFCA 60

Query: 61   RIFGPIKDYECICGKYKRMKYKGIICEKCGVEVTLSSVRRDRMAHIDLASPVAHPWFLKS 120
            RIFGPIKDYEC+CGKYKRMKYKGIICEKCGVEVTLS VRR+RM HI+LA+PVAH WFLKS
Sbjct: 61   RIFGPIKDYECLCGKYKRMKYKGIICEKCGVEVTLSRVRRERMGHIELAAPVAHIWFLKS 120

Query: 121  LPSRISTLLGMSLRDVERVLYFESYVVVDPGLSSLEKYQILTEEEYVEAVSQFGQDQFIA 180
            LPSRISTLL M+L+DVERVLYFE+Y+V +PGL++L++ Q+L+EEEY+ AV ++G+DQF A
Sbjct: 121  LPSRISTLLDMTLKDVERVLYFENYIVTEPGLTALKQNQLLSEEEYMMAVDEYGEDQFTA 180

Query: 181  MMGADAIYELLIALDLQNLALTLRDQLSKSSSIFRRKKIIKRLKIVDSFITSGNNPGWMI 240
            M+GA+AI+E+L +++L+ +A  LR  L+ ++S  ++KK++KRLKIV++F+ SGN P WMI
Sbjct: 181  MIGAEAIFEMLASMNLERIAGELRQDLADTTSDLKQKKLMKRLKIVENFMESGNRPEWMI 240

Query: 241  IRKLPVLPPDLRPLVALDFGRFAASDLNDLYRRVIGRNNRLMRLKSLHAPEIIIRNEKRM 300
            ++ +PV+PPDLRPLV LD GRFA SDLNDLYRRVI RNNRL RL  L AP IIIRNEKRM
Sbjct: 241  MKVVPVIPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLIELRAPGIIIRNEKRM 300

Query: 301  LQESVDALFDNGRHKRVVTGANRRPLKSLSDMLKGKQGRFRTNLLGKRVDYSGRSVIVAG 360
            LQESVDALFDNGR  RV+TGAN+RPLKSLSDMLKGKQGRFR NLLGKRVDYSGRSVIV G
Sbjct: 301  LQESVDALFDNGRRGRVITGANKRPLKSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVTG 360

Query: 361  PELQLHQCGLPKLMALELFKPFLYAQLEKKGYVSTVKQAKKFVEKERPEVWDVLAEVVHQ 420
            PEL+LHQCGLPK MALELFKPF+YA+L+ KGY STVKQAKK VEKE+PEVWD+L EV+ +
Sbjct: 361  PELKLHQCGLPKKMALELFKPFIYARLDAKGYSSTVKQAKKLVEKEKPEVWDILDEVIRE 420

Query: 421  HVVLLNRAPSLHRLSMQAFEPKIISGKAIQLHPLVCAGYNADFDGDQMAVYAVISPEAQL 480
            H VLLNRAP+LHRL +QAFEP ++ GKAIQLHPLVC  +NADFDGDQMAV+  +S EAQL
Sbjct: 421  HPVLLNRAPTLHRLGIQAFEPILVEGKAIQLHPLVCTAFNADFDGDQMAVHVPLSLEAQL 480

Query: 481  EARVLMLSTNNLLHPASGAPVTVPSQDMVLGLCYLSTVHEGDPGEGMLFADMGEVYHALE 540
            EARVLM+STNN+LHPA+GAP+ VPSQDMVLGL YLS +++ +PGEGM+F+D+GE++HALE
Sbjct: 481  EARVLMMSTNNILHPANGAPIIVPSQDMVLGLYYLSIMNQNEPGEGMVFSDIGELHHALE 540

Query: 541  NKIVTLHSKIRGRYKSVDKDGNSISKIYDTTPGRMIIGEILPRHHEISFDICNQEMIKKN 600
            NK+VTLHSKIRGR+K+VD DG  +SKI++TTPGRM+IGE+LP++  + FD CNQEM KKN
Sbjct: 541  NKVVTLHSKIRGRFKTVDADGKPVSKIFETTPGRMLIGELLPKNVNVPFDTCNQEMTKKN 600

Query: 601  ISAMVDTIYRHCGQKSTVAFCDDLMRLGFRYACSSGISFGKDDIIVPESKEKIIAEADKM 660
            IS M+DT+YRHCGQK TV FCD +M+LGFR+AC +GISFGKDD+++P+SK KI+ + + +
Sbjct: 601  ISKMIDTVYRHCGQKDTVIFCDRIMQLGFRHACKAGISFGKDDMVIPDSKVKIVGDTESL 660

Query: 661  VKEYENQYNDGLITRGEKYNKVVDLWGKTTDKVTEEMMARIKRVEFDPETGRQKKMNSIF 720
            VKEYE QYNDGLIT+GEKYNKVVD WGK T+KV E+MMARIK VEFDPETGRQK MN+I+
Sbjct: 661  VKEYEQQYNDGLITQGEKYNKVVDAWGKATEKVAEDMMARIKAVEFDPETGRQKPMNAIY 720

Query: 721  MMSHSGARGSIHQMRQLGGMRGLIAKPSGEIIESPIRSHFKGGLCGFEFFQSCVGGRKGL 780
            MMSHSGARGS +QMRQLGGMRGL+AKPSGEIIE+PI S+FK GL   E+F S  G RKGL
Sbjct: 721  MMSHSGARGSPNQMRQLGGMRGLMAKPSGEIIETPIISNFKEGLTVNEYFNSTHGARKGL 780

Query: 781  LDVVMRTASSGYLSRRLVDVAQNCVVNQVDCNTKKGLTITHIVDSGQVVYSLGSRVLGRT 840
             D  ++TA+SGYL+RRLVDVAQ+C+VN VDC T KGLT+T IVD+GQVV S+G RVLGRT
Sbjct: 781  ADTALKTANSGYLTRRLVDVAQDCIVNLVDCGTDKGLTMTAIVDAGQVVASIGVRVLGRT 840

Query: 841  ALDDIINPLTNECIVKAGQLILESHVNEIEKCGIRSVRIRSALTCESSRGVCVLCYGRDL 900
            ALDDI +P+T E IV AG++ILE+ V EIEK GI+S+RIRSALTCE   GVC +CYGRDL
Sbjct: 841  ALDDIDHPVTGERIVDAGRMILEADVIEIEKAGIQSIRIRSALTCEVQTGVCSICYGRDL 900

Query: 901  ARGSLVNVGEAVGVIAAQSIGEPGTQLTMRTFHLGGAVTVMDRSFIESPCDGIVKIKNRN 960
            ARG+ VN+GEAVGVIAAQSIGEPGTQLTMRTFHLGG   V+D+SF+E+  +G ++IKNRN
Sbjct: 901  ARGTPVNMGEAVGVIAAQSIGEPGTQLTMRTFHLGGTANVVDQSFLEASYEGTIQIKNRN 960

Query: 961  VCRNSTNDLISMGRNTTLQILDMSGQEQYSHRIMYGAKLFVDDGGVIECGQRISEWDPHT 1020
            + RNS    ++MGR+  + ILD  G E+ S R+ YG+KLFVDDG  ++ GQR++EWDP+T
Sbjct: 961  MLRNSDGIYVAMGRSIAVTILDERGVERSSQRVAYGSKLFVDDGDKVKRGQRLAEWDPYT 1020

Query: 1021 FPIITEVSGTVGFEDLVDGISVIESIGESTGIAKRKVIDWRFASRSQNLKPAIVVTDENG 1080
             P++TEV G V FEDLVDGISV+E+  ESTGI KR+VIDWR   R  +LKPAIV+ D  G
Sbjct: 1021 RPMMTEVEGVVHFEDLVDGISVLEATDESTGITKRQVIDWRSTPRGADLKPAIVIKDTQG 1080

Query: 1081 VVLKSARGTDARWFLPVDALLSVSPGQKVSTGDVLARLPISSAKTKDITSGLPRVAELFE 1140
             VLK  RG +AR+ L VDA+LSV PGQ+VS GDVLAR P+ SAKTKDIT GLPRVAELFE
Sbjct: 1081 NVLKVPRGGEARFQLSVDAILSVEPGQRVSQGDVLARSPMESAKTKDITGGLPRVAELFE 1140

Query: 1141 ARRPKNHAILAEISGTIRIKRNYKNKSRVVIEPFEDGVEPAEYFIPKNKHFYLQDGDHVE 1200
            ARRPK+HAI+AEI GTIR+ R+YKNK RV+IEP EDGVEP EY IPK K F+LQ+GD++E
Sbjct: 1141 ARRPKDHAIIAEIDGTIRLGRDYKNKRRVIIEPAEDGVEPVEYLIPKGKPFHLQEGDYIE 1200

Query: 1201 KGDYILDGNPVPQDILRIKGVEALASYLINEVQEVYRLEGVAINHKHIEVVVRHMLQKVE 1260
            KGDYILDGNP P DIL IKGVEALASYL+NE+QEVYRL+GV IN KHIEV+VR MLQKVE
Sbjct: 1201 KGDYILDGNPAPHDILAIKGVEALASYLVNEIQEVYRLQGVVINDKHIEVIVRQMLQKVE 1260

Query: 1261 ITDPADTEYILGDNVDRIEVEELNRSLAQQGKKLVSFSPILQGITKASLQTKSFISAASF 1320
            ITD  D++YI+GDNVDRIE++E N  L ++GKK     P+L GITKASLQT SFISAASF
Sbjct: 1261 ITDSGDSQYIVGDNVDRIELDEANERLVEEGKKPAFGDPVLLGITKASLQTPSFISAASF 1320

Query: 1321 QETTKVLTEAAIAGKVDTLDGFKENVIVGRSIPAGTGAILHEKRRVAMNRDQMILKER 1378
            QETTKVLTEAAIAGK DTL G KENVIVGR IPAGTG  + + RR+A +RD +IL+ER
Sbjct: 1321 QETTKVLTEAAIAGKTDTLQGLKENVIVGRLIPAGTGGTMTQIRRIATSRDDLILEER 1378