HHsearch alignment for GI: 254780144 and conserved domain: CHL00083

>CHL00083 rpl12 ribosomal protein L12.
Probab=100.00  E-value=1.3e-40  Score=265.53  Aligned_cols=125  Identities=58%  Similarity=0.822  Sum_probs=111.2

Q ss_pred             CCCHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCC----CCCCCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHH
Q ss_conf             971899999996099999999999999993787100012----2355444432222222431157774377554335787
Q gi|254780144|r    1 MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----VVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIK   76 (126)
Q Consensus         1 maki~~ive~i~~LTllE~~eLv~~leekfgv~~~~~~~----~~~~~~~~~~~~~~EKt~fdV~L~~~~~~~~Ki~vIK   76 (126)
T Consensus         1 S~kv~~ive~i~~LtllE~~eLv~~lee~fgv~~~~~~~~~~~~~~~~~~~~~~~~~ekteF~V~L~~~~-~~kKi~VIK   79 (129)
T CHL00083          1 STKINEIIEKLKSLTLLEAAELVKQIEETFGVDASAPVGGGMMMAAAAAGEAAEAVEEKTEFDVILEEVP-ADKRIAVLK   79 (129)
T ss_pred             CHHHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECC-CCCCCEEEE
T ss_conf             9059999999974889999999999999969984432221124677777665442111664689984368-877413552


Q ss_pred             HHHHHCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             76776599889999998637977660999899999999999748579939
Q gi|254780144|r   77 EVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        77 ~vR~it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
T Consensus        80 ~VR~it~LgLkEAK~lVe~~P~~iKe~vsKeeAe~iK~kLe~aGA~VelK  129 (129)
T CHL00083         80 VVRSLTGLGLKEAKELVESLPKTIKEGVSKEEAEEAKKQLEEAGAKVILK  129 (129)
T ss_pred             HHHHHCCCCHHHHHHHHHCCCHHHHCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             33844699879999998718898862889999999999999859989739