HHsearch alignment of GI: 254780144 and MMDB domain: 1rqu_A_41-120

>1rqu_A (A:41-120) L8, 50S ribosomal protein L7/L12; ribosome,; NMR {Escherichia coli}
Probab=99.92  E-value=2e-25  Score=173.73  Aligned_cols=79  Identities=61%  Similarity=0.825  Sum_probs=74.3

Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             44322222224311577743775543357877677659988999999863797766099989999999999974857993
Q gi|254780144|r   46 AEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL  125 (126)
Q Consensus        46 ~~~~~~~~EKt~fdV~L~~~~~~~~Ki~vIK~vR~it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~Vei  125 (126)
                      ++..+..+|||+|||+|++|+  ++||+|||+||++|||||+|||+|||++|++|+++++++|||++|++|+++||+|+|
T Consensus         2 ~~~~~~~~ekt~f~V~L~~~~--~~Ki~vIK~VR~itglgL~eAK~lve~~P~~ike~v~keeAE~ik~~Le~aGA~vei   79 (80)
T 1rqu_A            2 AGPVEAAEEKTEFDVILKAAG--ANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEV   79 (80)
T ss_dssp             CCCCCSSCCCCCEEEEEEECC--SCHHHHHHHHHHHSCCCHHHHHHHHHTCSEEEEEEECHHHHHHHHHHHHHHTCEEEE
T ss_pred             CCCCCCCCCCCHHHHHHHCCC--CCCHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHCCCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             676544444303566640255--431178999998259988999999870879888089999999999999985997852


Q ss_pred             C
Q ss_conf             9
Q gi|254780144|r  126 R  126 (126)
Q Consensus       126 K  126 (126)
                      |
T Consensus        80 k   80 (80)
T 1rqu_A           80 K   80 (80)
T ss_dssp             C
T ss_pred             C
T ss_conf             9