HHsearch alignment of GI: 254780144 and MMDB domain: 2ftc_E_66-137

>2ftc_E (E:66-137) Mitochondrial ribosomal protein L7/12, mitochondrial 39S ribosomal protein L3; mitochondrial ribosome, large ribosomal subunit, ribosomal RNA; 12.10A {Bos taurus}
Probab=99.90  E-value=9.9e-24  Score=163.47  Aligned_cols=71  Identities=38%  Similarity=0.586  Sum_probs=67.8

Q ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHH-HCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             24311577743775543357877677-6599889999998637977660999899999999999748579939
Q gi|254780144|r   55 KTEFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        55 Kt~fdV~L~~~~~~~~Ki~vIK~vR~-it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
                      ||+|||+|++|++ ++||+|||+||+ +|||||+|||++||++|++|++++||+|||++|++|+++||+|+|.
T Consensus         1 Kt~f~V~L~~~~~-~kKi~vIK~vr~~~tglgL~eAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGA~Vele   72 (72)
T 2ftc_E            1 RTHFTVRLTEAKP-VDKVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEAEKIKAALEAVGGTVVLE   72 (72)
T ss_pred             CCEEEEEECCCCC-CCHHHHHHHHHHHCCCCCHHHHHHHHHHCCHHHHCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             3356887224774-11457999999871799879999998708888870899999999999999859979739