HHsearch alignment of GI: 254780144 and MMDB domain: 3i8i_J_

>3i8i_J (J:) Elongation Complex Of The 70s Ribosome With Three Trnas And Mrna. This Entry 3i8i Contains 50s Ribosomal Subnit. {Thermus thermophilus HB8}
Probab=100.00  E-value=9.8e-37  Score=241.85  Aligned_cols=123  Identities=55%  Similarity=0.793  Sum_probs=110.9

Q ss_pred             CC-CHHHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCC-CCCCCCCCCCCCCCCCEEEEEECCCCCCCHHHHHHH
Q ss_conf             97-1899999996099999999999999993787100012235-544443222222243115777437755433578776
Q gi|254780144|r    1 MS-NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-PVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEV   78 (126)
Q Consensus         1 ma-ki~~ive~i~~LTllE~~eLv~~leekfgv~~~~~~~~~~-~~~~~~~~~~~EKt~fdV~L~~~~~~~~Ki~vIK~v   78 (126)
                      || ++++|+|+|++|||+|++||++.|+++|||++++++++++ +++++++++.+|||+|||+|++|++  +||++||+|
T Consensus         1 mS~~~~~iv~~i~~LtllE~~eLv~~le~~~gv~~~~~~~~~~~~~~~~~~~~~~ekt~fdV~L~~~~~--~Ki~vIK~v   78 (125)
T 3i8i_J            1 MALDIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAPAAGAAAAPAEEKTEFDVILKEAGA--KKLEVIKEL   78 (125)
T ss_dssp             CHHHHHTTTSCSSSSSSSTTSTTTGGGTCC--------------------------------------------------
T ss_pred             CCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHCCCEEEEEECCCCH--HHHHHHHHH
T ss_conf             986588899998628788999999999987088954334455678876545400015511354057771--569999998


Q ss_pred             HHHCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             776599889999998637977660999899999999999748579939
Q gi|254780144|r   79 RAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        79 R~it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
                      |++|||||+|||++|| +|++||++++|+|||++|++|+++||+|+||
T Consensus        79 R~it~lgLkEAK~lVe-aP~~ike~vsKeeAE~ik~kLe~aGA~Veik  125 (125)
T 3i8i_J           79 RAITGLGLKEAKDLAE-KGGPVKEGVSKQEAEEIKKKLEAVGAVVELK  125 (125)
T ss_dssp             ------------------------------------------------
T ss_pred             HHHCCCCHHHHHHHHH-CCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             8405998889999871-7536650799878999999998768636409