HHsearch results for GI: 254780144 and protein with PDBid: 1ctf_A

>1ctf_A Ribosomal protein L7/L12; 1.70A {Escherichia coli} SCOP: d.45.1.1 PDB: 1rqs_A 2bcw_B
Probab=99.92  E-value=6.9e-26  Score=175.54  Aligned_cols=74  Identities=64%  Similarity=0.887  Sum_probs=70.7

Q ss_pred             CCCCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHCCCHHHHHHHHHHHHHCCCEEEEC
Q ss_conf             2222243115777437755433578776776599889999998637977660999899999999999748579939
Q gi|254780144|r   51 AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR  126 (126)
Q Consensus        51 ~~~EKt~fdV~L~~~~~~~~Ki~vIK~vR~it~LgLkEAK~lVe~~P~~ike~v~keeAE~ik~~Le~aGa~VeiK  126 (126)
                      +++|||+|||+|++|++  +||+|||+||++|||||+|||+|||++|++|++|++|+|||++|++|+++||+|+||
T Consensus         1 aaeEkt~f~V~L~~~~~--~Ki~vIK~VR~itglgLkeAK~lVe~~P~~ike~v~keeAe~ik~~le~aGA~V~lk   74 (74)
T 1ctf_A            1 AAEEKTEFDVILKAAGA--NKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVEVK   74 (74)
T ss_dssp             ------CEEEEEEECGG--GHHHHHHHHHHHHCCCHHHHHHHHHTCSEEEEEEECHHHHHHHHHHHHHHTCEEEEC
T ss_pred             CCCCCCEEEEEEEECCC--CHHHHHHHHHHHCCCCHHHHHHHHHCCCHHHHCCCCHHHHHHHHHHHHHCCCEEEEC
T ss_conf             98656554899831785--414799999876599999999998718899973899999999999999859889849