HHsearch results for GI: 254780144 and protein with PDBid: 1rqt_A

>1rqt_A L8, 50S ribosomal protein L7/L12; protein L7/L12,ribosome,; NMR {Escherichia coli} SCOP: a.108.1.1
Probab=97.75  E-value=2.3e-05  Score=51.90  Aligned_cols=32  Identities=31%  Similarity=0.672  Sum_probs=30.3

Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             99999996099999999999999993787100
Q gi|254780144|r    5 ESIVEKLSSLTLIEAAELSKRLEKEWGVSASA   36 (126)
Q Consensus         5 ~~ive~i~~LTllE~~eLv~~leekfgv~~~~   36 (126)
                      ++|++.|.+||++++.||+..+|+||||++++
T Consensus         5 e~ILeaia~mSVmdvveLisaMEeKFGVs~~~   36 (37)
T 1rqt_A            5 DQIIEAVAAMSVMDVVELISAMEEKFGVSAAA   36 (37)
T ss_dssp             HHHHHHHTTSCHHHHHHHHHHHHHHTTCCCSC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             99999998832999999999999984877467