HHSEARCH alignment of GI: 254780144 and SCOP domain: d2gyc31

Alignment
>d2gyc31 a.108.1.1 (3:2-48) Ribosomal protein L7/12, oligomerisation (N-terminal) domain {Escherichia coli [TaxId: 562]}
Probab=98.31  E-value=2.1e-07  Score=62.70  Aligned_cols=40  Identities=33%  Similarity=0.599  Sum_probs=35.6

Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             9999999609999999999999999378710001223554
Q gi|254780144|r    5 ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPV   44 (126)
Q Consensus         5 ~~ive~i~~LTllE~~eLv~~leekfgv~~~~~~~~~~~~   44 (126)
                      ++|++.|.+||++|+.||++.+|+||||++++++++++++
T Consensus         4 e~Ileaia~MSVmdvveLi~amEEKFGVsaaa~va~~~~p   43 (47)
T d2gyc31           4 DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGP   43 (47)
T ss_dssp             HHHHHHHHHSCHHHHHHHHHHHHHHTCTTTTHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHCCCCCCCCC
T ss_conf             8999999972399999999999998584321100135775


SCOP domain information

class: All alpha proteins
fold: Ribosomal protein L7/12, oligomerisation (N-terminal) domain
superfamily: Ribosomal protein L7/12, oligomerisation (N-terminal) domain
family: Ribosomal protein L7/12, oligomerisation (N-terminal) domain
domain: Ribosomal protein L7/12, oligomerisation (N-terminal) domain
species: Escherichia coli [TaxId: 562]