BLAST/PSIBLAST alignment of GI: 254780144 and GI: 14195176 at iteration 1
>gi|14195176|sp|Q9L5W4|RL7_LIBAC RecName: Full=50S ribosomal protein L7/L12 Length = 124
>gi|7716607|gb|AAF68453.1| RplL [Candidatus Liberibacter africanus subsp. capensis] Length = 124
 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (85%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+IESIVEKLSSLTLI+AAELSKRLE+EWGVSASAPV+ VAP       A +EKTEFEV
Sbjct: 1   MSDIESIVEKLSSLTLIQAAELSKRLEEEWGVSASAPVAAVAPAVXXD-VAVAEKTEFEV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L+ FD  K KI+VIKEVR+ITDLGLKEAKELVE+  KSL+TG+SKDEANE+KKKLE AG
Sbjct: 60  FLESFD-AKSKISVIKEVRSITDLGLKEAKELVEALLKSLRTGVSKDEANELKKKLEAAG 118

Query: 121 ATVELR 126
           AT+ LR
Sbjct: 119 ATISLR 124