BLAST/PSIBLAST alignment of GI: 254780144 and GI: 315122746 at iteration 1
>gi|315122746|ref|YP_004063235.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124
>gi|313496148|gb|ADR52747.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 124
 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFN-ATSKINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVELR 126
           AT+++R
Sbjct: 119 ATIDIR 124