BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P
[Candidatus Liberibacter asiaticus str. psy62]
         (126 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|38195607|gb|AAR13470.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|94548940|gb|ABF38967.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           asiaticus]
 gi|157704383|gb|ABV68882.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           asiaticus]
 gi|254039821|gb|ACT56617.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|255957551|dbj|BAH96614.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957847|dbj|BAH96821.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957857|dbj|BAH96830.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957867|dbj|BAH96839.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957877|dbj|BAH96848.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957887|dbj|BAH96857.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957897|dbj|BAH96866.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957907|dbj|BAH96875.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957917|dbj|BAH96884.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957927|dbj|BAH96893.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957937|dbj|BAH96902.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957947|dbj|BAH96911.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957957|dbj|BAH96920.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957967|dbj|BAH96929.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957977|dbj|BAH96938.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957987|dbj|BAH96947.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957997|dbj|BAH96956.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958007|dbj|BAH96965.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958017|dbj|BAH96974.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958027|dbj|BAH96983.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958037|dbj|BAH96992.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958047|dbj|BAH97001.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958057|dbj|BAH97010.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958067|dbj|BAH97019.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958077|dbj|BAH97028.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958087|dbj|BAH97037.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958097|dbj|BAH97046.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958107|dbj|BAH97055.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958117|dbj|BAH97064.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958127|dbj|BAH97073.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|283362137|dbj|BAI65924.1| ribosomal protein L12P [Candidatus Liberibacter asiaticus]
 gi|283362147|dbj|BAI65933.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362157|dbj|BAI65942.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362167|dbj|BAI65951.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362177|dbj|BAI65960.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362187|dbj|BAI65969.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362197|dbj|BAI65978.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362207|dbj|BAI65987.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362217|dbj|BAI65996.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362227|dbj|BAI66005.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362237|dbj|BAI66014.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
          Length = 126

 Score =  237 bits (605), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG
Sbjct: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120

Query: 121 ATVELR 126
           ATVELR
Sbjct: 121 ATVELR 126


>gi|548775|sp|P36247|RL7_LIBAS RecName: Full=50S ribosomal protein L7/L12
 gi|144459|gb|AAA23108.1| ribosomal protein L12 [Candidatus Liberibacter asiaticus]
 gi|739026|prf||2002224E ribosomal protein L12
          Length = 122

 Score =  229 bits (585), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG
Sbjct: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120

Query: 121 AT 122
           AT
Sbjct: 121 AT 122


>gi|730573|sp|P41189|RL7_LIBAF RecName: Full=50S ribosomal protein L7/L12
 gi|507768|gb|AAA19556.1| ribosomal protein L12 [Candidatus Liberibacter africanus]
          Length = 125

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 114/126 (90%), Gaps = 1/126 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTL++AAELSKRLE+EWGVSA+APV+VVA  A E+ +A +EKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLLQAAELSKRLEEEWGVSAAAPVAVVASAAGESAAAVAEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L+GF D KKKI+VIKEVRAIT+LGLKEAK+ VESAPKSLKTG+SKDEA E+KKKLE AG
Sbjct: 61  FLEGF-DAKKKISVIKEVRAITELGLKEAKDFVESAPKSLKTGVSKDEAEELKKKLEAAG 119

Query: 121 ATVELR 126
           AT+ LR
Sbjct: 120 ATIILR 125


>gi|14195176|sp|Q9L5W4|RL7_LIBAC RecName: Full=50S ribosomal protein L7/L12
 gi|7716607|gb|AAF68453.1| RplL [Candidatus Liberibacter africanus subsp. capensis]
          Length = 124

 Score =  146 bits (369), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 108/126 (85%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+IESIVEKLSSLTLI+AAELSKRLE+EWGVSASAPV+ VAP       A +EKTEFEV
Sbjct: 1   MSDIESIVEKLSSLTLIQAAELSKRLEEEWGVSASAPVAAVAPAVXXD-VAVAEKTEFEV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L+ FD  K KI+VIKEVR+ITDLGLKEAKELVE+  KSL+TG+SKDEANE+KKKLE AG
Sbjct: 60  FLESFD-AKSKISVIKEVRSITDLGLKEAKELVEALLKSLRTGVSKDEANELKKKLEAAG 118

Query: 121 ATVELR 126
           AT+ LR
Sbjct: 119 ATISLR 124


>gi|194293715|gb|ACF39953.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           solanacearum]
          Length = 124

 Score =  142 bits (359), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 109/126 (86%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFN-ATSKINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVELR 126
           AT+++R
Sbjct: 119 ATIDIR 124


>gi|289546830|gb|ADD10123.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           solanacearum]
          Length = 127

 Score =  142 bits (358), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 4   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATES-VAVAEKTEFDV 62

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 63  VLTGFN-ATSKINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 121

Query: 121 ATVELR 126
           AT+++R
Sbjct: 122 ATIDIR 127


>gi|315122746|ref|YP_004063235.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496148|gb|ADR52747.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 124

 Score =  142 bits (357), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFN-ATSKINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVELR 126
           AT+++R
Sbjct: 119 ATIDIR 124


>gi|218683242|gb|ACL00660.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. CA DP-1]
 gi|247797366|gb|ACT09142.1| 50S ribosomal protein L12 [Candidatus Liberibacter solanacearum]
 gi|247797369|gb|ACT09144.1| 50S ribosomal protein L12 [Candidatus Liberibacter solanacearum]
          Length = 123

 Score =  140 bits (352), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFN-ATSKINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVEL 125
           AT+++
Sbjct: 119 ATIDI 123


>gi|218683246|gb|ACL00662.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. Burns]
 gi|218683250|gb|ACL00664.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. Saltillo
           9-08]
 gi|269838641|gb|ACZ48686.1| 50S ribosomal protein L12 [Candidatus Liberibacter solanacearum]
          Length = 123

 Score =  139 bits (349), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 106/125 (84%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFN-ATSKINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVEL 125
           AT+++
Sbjct: 119 ATIDI 123


>gi|256427010|gb|ACU81078.1| 50S ribosomal protein L12 [Candidatus Liberibacter psyllaurous]
          Length = 119

 Score =  135 bits (341), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 89/121 (73%), Positives = 104/121 (85%), Gaps = 2/121 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFN-ATSKINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 A 121
           A
Sbjct: 119 A 119


>gi|153005083|ref|YP_001379408.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. Fw109-5]
 gi|166222132|sp|A7HCH8|RL7_ANADF RecName: Full=50S ribosomal protein L7/L12
 gi|152028656|gb|ABS26424.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. Fw109-5]
          Length = 125

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++ +IV++LS LT++EAA+L K+LE++WGVSA+APV V       A +A   EKTEF 
Sbjct: 1   MADLNTIVDQLSGLTVMEAADLVKKLEEKWGVSAAAPVMVAGGAGGAAAAAPVEEKTEFN 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE APK +K G+ K EA+E+KKKLE A
Sbjct: 61  VVLA--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKEVKVGIPKAEADELKKKLEAA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEIK 125


>gi|197253676|gb|ACH54173.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           solanacearum]
 gi|197709092|gb|ACH72644.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           solanacearum]
          Length = 109

 Score =  122 bits (306), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/111 (72%), Positives = 95/111 (85%), Gaps = 2/111 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATES-VAVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           VL GF +   KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E
Sbjct: 60  VLTGF-NATSKINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEE 109


>gi|332185597|ref|ZP_08387345.1| ribosomal protein L7/L12 [Sphingomonas sp. S17]
 gi|332014575|gb|EGI56632.1| ribosomal protein L7/L12 [Sphingomonas sp. S17]
          Length = 124

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/126 (59%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ ++V++LS LT++EAAELSK LE++WGVSA+A V+        A  AA EKTEF+V
Sbjct: 1   MADLNALVDQLSELTVLEAAELSKMLEEKWGVSAAAAVAAAPAAGGAAAPAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGL EAK LVE APK +K G++KDEA ++KK+LE+AG
Sbjct: 61  ILTG--DGGKKINVIKEVRAITGLGLTEAKALVEGAPKPVKEGIAKDEAEKIKKQLEEAG 118

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 119 ATVELK 124


>gi|163796060|ref|ZP_02190022.1| Ribosomal protein L7/L12 [alpha proteobacterium BAL199]
 gi|159178519|gb|EDP63059.1| Ribosomal protein L7/L12 [alpha proteobacterium BAL199]
          Length = 123

 Score =  121 bits (303), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 104/126 (82%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV++ A  A  A  AA EKT+F+V
Sbjct: 1   MADLAKLVDELSTLTVLEAAELSKMLEEKWGVSAAAPVAMAAAPADAA-PAAEEKTDFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L    D  KKI VIKEVRAIT LGLKEAK+LVE+APKS+K G SKDEA ++KK+LEDAG
Sbjct: 60  ILATVGD--KKINVIKEVRAITGLGLKEAKDLVEAAPKSVKDGASKDEAAKIKKQLEDAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|329114223|ref|ZP_08242985.1| 50S ribosomal protein L7/L12 [Acetobacter pomorum DM001]
 gi|326696299|gb|EGE47978.1| 50S ribosomal protein L7/L12 [Acetobacter pomorum DM001]
          Length = 124

 Score =  120 bits (302), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 101/126 (80%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A EKTEF V
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPGAAAAPAEEKTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA+++KK LEDAG
Sbjct: 61  VLASAGD--KKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVSKDEADKIKKALEDAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|15604015|ref|NP_220530.1| 50S ribosomal protein L7/L12 [Rickettsia prowazekii str. Madrid E]
 gi|6226011|sp|Q9ZE21|RL7_RICPR RecName: Full=50S ribosomal protein L7/L12
 gi|3860706|emb|CAA14607.1| 50S RIBOSOMAL PROTEIN L7/L12 (rplL) [Rickettsia prowazekii]
 gi|292571733|gb|ADE29648.1| 50S ribosomal protein L7/L12 [Rickettsia prowazekii Rp22]
          Length = 125

 Score =  120 bits (301), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 94/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+AP++V  A VAA    A +EKTEFE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPITVASAGVAAPLAEAVTEKTEFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KK+ VIK V+ IT LGL EAK+LV+ APKS+K  + K EA E+K KLE A
Sbjct: 61  VVLTATGD--KKVEVIKIVKDITGLGLIEAKKLVDEAPKSIKNNVKKAEAEEIKSKLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|330993837|ref|ZP_08317769.1| 50S ribosomal protein L7/L12 [Gluconacetobacter sp. SXCC-1]
 gi|329759105|gb|EGG75617.1| 50S ribosomal protein L7/L12 [Gluconacetobacter sp. SXCC-1]
          Length = 124

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A EKTEF+V
Sbjct: 1   MADLNKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPGAAAAPAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKE+RAIT LGLKEAK+LVE APK++K G SKDEA ++KK LED G
Sbjct: 61  VLAKAGD--KKINVIKEIRAITGLGLKEAKDLVEGAPKTIKEGASKDEAEKIKKTLEDNG 118

Query: 121 ATVELR 126
           A+VE++
Sbjct: 119 ASVEIK 124


>gi|86158016|ref|YP_464801.1| 50S ribosomal protein L12P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|109893745|sp|Q2II87|RL7_ANADE RecName: Full=50S ribosomal protein L7/L12
 gi|85774527|gb|ABC81364.1| LSU ribosomal protein L12P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 124

 Score =  120 bits (300), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 74/126 (58%), Positives = 95/126 (75%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ +IVE+LS LT++EAAEL K+LE++WGVSA+A   ++A   A A +   EKTEF V
Sbjct: 1   MADLNAIVEQLSGLTIMEAAELVKQLEEKWGVSAAAAPVMMAGGPAAAAAPVEEKTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRAIT LGLKEAK+LVE APK +K G++K EA E+KKKLE AG
Sbjct: 61  VLA--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKEVKAGVAKAEAEELKKKLEAAG 118

Query: 121 ATVELR 126
           A VE++
Sbjct: 119 AKVEVK 124


>gi|254505210|ref|ZP_05117361.1| ribosomal protein L7/L12 [Labrenzia alexandrii DFL-11]
 gi|222441281|gb|EEE47960.1| ribosomal protein L7/L12 [Labrenzia alexandrii DFL-11]
          Length = 124

 Score =  119 bits (298), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 83/126 (65%), Positives = 104/126 (82%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++E +VE+LS+LT++EAAELSK LE++WGVSA+APV+V A       +AA EKTEF+V
Sbjct: 1   MADLEKLVEELSALTVMEAAELSKLLEEKWGVSAAAPVAVAAAAGGGEAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKEVRAIT LGLKEAKELVESAPK++K  +SKDEA E+KKKLE+AG
Sbjct: 61  VLASAGD--KKINVIKEVRAITGLGLKEAKELVESAPKAVKEAVSKDEAEELKKKLEEAG 118

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 119 ASVELK 124


>gi|326386253|ref|ZP_08207877.1| 50S ribosomal protein L7/L12 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209478|gb|EGD60271.1| 50S ribosomal protein L7/L12 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 124

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I ++VE+LS LT++EAA+L+K LE+ WGVSA+A V+V A  A EA  AA EKTEF+V
Sbjct: 1   MADIAALVEELSKLTVLEAADLAKALEEAWGVSAAAAVAVAAAPAGEAAPAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G+SK EA ++KKK+E+AG
Sbjct: 61  ILTG--DGGKKIQVIKEVRAITSLGLTEAKALVEGAPKAIKEGVSKAEAEDIKKKIEEAG 118

Query: 121 ATVELR 126
            TVE++
Sbjct: 119 GTVEIK 124


>gi|258542020|ref|YP_003187453.1| 50S ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-01]
 gi|256633098|dbj|BAH99073.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636155|dbj|BAI02124.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639210|dbj|BAI05172.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642264|dbj|BAI08219.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645319|dbj|BAI11267.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648374|dbj|BAI14315.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651427|dbj|BAI17361.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654418|dbj|BAI20345.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-12]
          Length = 124

 Score =  117 bits (294), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A EKTEF V
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPGAAAAPAEEKTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA+++KK LE AG
Sbjct: 61  VLASAGD--KKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVSKDEADKIKKALEGAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|300022533|ref|YP_003755144.1| ribosomal protein L7/L12 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524354|gb|ADJ22823.1| ribosomal protein L7/L12 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 125

 Score =  117 bits (292), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           MS IE IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A A +A +E +TEF 
Sbjct: 1   MSKIEKIVDDLSSLTVLEAAELAKALEEKWGVSAAAAVAVAAAPGAGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK   D  KKI VIKEVRAIT LGLKEAK+LVE+  K++K G+SKDEA ++KK+LED 
Sbjct: 61  VILKSGGD--KKINVIKEVRAITGLGLKEAKDLVEAGGKTVKEGVSKDEAQKLKKQLEDQ 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEVK 125


>gi|119713233|gb|ABL97299.1| ribosomal protein L7/L12 [uncultured marine bacterium HF10_12C08]
          Length = 126

 Score =  117 bits (292), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 83/128 (64%), Positives = 101/128 (78%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++++ IV++LS LT+IEAAELSK LE++WGVSA+APV+V A  AA +G  A+  EK EF
Sbjct: 1   MADLQQIVDQLSDLTVIEAAELSKMLEEKWGVSAAAPVAVAAAGAAPSGDTAATEEKDEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            +VL    D  KKI VIKEVR IT LGLKEAK+LVE APK LKTG+SKDEAN  K+KLE 
Sbjct: 61  TIVLAAAGD--KKINVIKEVRTITGLGLKEAKDLVEGAPKELKTGVSKDEANGFKEKLEA 118

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 119 AGATVELK 126


>gi|307946276|ref|ZP_07661611.1| ribosomal protein L7/L12 [Roseibium sp. TrichSKD4]
 gi|307769940|gb|EFO29166.1| ribosomal protein L7/L12 [Roseibium sp. TrichSKD4]
          Length = 125

 Score =  116 bits (291), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 104/127 (81%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++E +VE+LS+LT++EAAELSK LE++WGVSA+APV+V A        AA+E KTEF+
Sbjct: 1   MADLEKLVEELSTLTVMEAAELSKLLEEKWGVSAAAPVAVAAVAGGADAGAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAKELVESAPK++K  +SKDEA E+KKKLE+A
Sbjct: 61  VVLASAGD--KKINVIKEVRAITGLGLKEAKELVESAPKAVKEAVSKDEAEELKKKLEEA 118

Query: 120 GATVELR 126
           GA+VEL+
Sbjct: 119 GASVELK 125


>gi|83312240|ref|YP_422504.1| 50S ribosomal protein L7/L12 [Magnetospirillum magneticum AMB-1]
 gi|109893772|sp|Q2W2I0|RL7_MAGMM RecName: Full=50S ribosomal protein L7/L12
 gi|82947081|dbj|BAE51945.1| Ribosomal protein L7/L12 [Magnetospirillum magneticum AMB-1]
          Length = 124

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 103/126 (81%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V+ LS+LT++EAAELSK LE++WGVSA+APV+V A  A  A  AA E+TEF+V
Sbjct: 1   MADLAKLVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAAGAAAPAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D  +KKI VIKEVRAIT LGLKEAK+LVE+APKS+K G+SKDEA ++KK LE+AG
Sbjct: 61  ILT--DAGEKKINVIKEVRAITGLGLKEAKDLVEAAPKSVKDGVSKDEAEKIKKVLEEAG 118

Query: 121 ATVELR 126
           A V+++
Sbjct: 119 AKVQVK 124


>gi|239832131|ref|ZP_04680460.1| ribosomal protein L7/L12 [Ochrobactrum intermedium LMG 3301]
 gi|254719299|ref|ZP_05181110.1| 50S ribosomal protein L7/L12 [Brucella sp. 83/13]
 gi|265984300|ref|ZP_06097035.1| ribosomal protein L7/L12 [Brucella sp. 83/13]
 gi|306838944|ref|ZP_07471769.1| ribosomal protein L7/L12 [Brucella sp. NF 2653]
 gi|306840289|ref|ZP_07473062.1| ribosomal protein L7/L12 [Brucella sp. BO2]
 gi|306844149|ref|ZP_07476743.1| ribosomal protein L7/L12 [Brucella sp. BO1]
 gi|239824398|gb|EEQ95966.1| ribosomal protein L7/L12 [Ochrobactrum intermedium LMG 3301]
 gi|264662892|gb|EEZ33153.1| ribosomal protein L7/L12 [Brucella sp. 83/13]
 gi|306275592|gb|EFM57324.1| ribosomal protein L7/L12 [Brucella sp. BO1]
 gi|306289744|gb|EFM60930.1| ribosomal protein L7/L12 [Brucella sp. BO2]
 gi|306405977|gb|EFM62231.1| ribosomal protein L7/L12 [Brucella sp. NF 2653]
          Length = 124

 Score =  116 bits (291), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 79/126 (62%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|284444293|gb|ADB85802.1| truncated 50S ribosomal protein L12 [Candidatus Liberibacter
           solanacearum]
 gi|284444295|gb|ADB85803.1| truncated 50S ribosomal protein L12 [Candidatus Liberibacter
           solanacearum]
          Length = 104

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/103 (71%), Positives = 86/103 (83%), Gaps = 1/103 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP   V+  AA    + +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAVAVSASAATESVSVAEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
           VL GF +   KI VIKEVRAIT+LGLKEAKELVES+PKSLK G
Sbjct: 61  VLTGF-NATSKINVIKEVRAITNLGLKEAKELVESSPKSLKGG 102


>gi|148560420|ref|YP_001259163.1| 50S ribosomal protein L7/L12 [Brucella ovis ATCC 25840]
 gi|166222141|sp|A5VR16|RL7_BRUO2 RecName: Full=50S ribosomal protein L7/L12
 gi|148371677|gb|ABQ61656.1| ribosomal protein L7/L12 [Brucella ovis ATCC 25840]
          Length = 124

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRA+T LGLKEAK+LVE APK++K G+SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRALTGLGLKEAKDLVEGAPKAVKEGVSKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|94495393|ref|ZP_01301973.1| ribosomal protein L7/L12 [Sphingomonas sp. SKA58]
 gi|94424781|gb|EAT09802.1| ribosomal protein L7/L12 [Sphingomonas sp. SKA58]
          Length = 125

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/127 (60%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I ++V++LS+LT++EAAELSK LE++WGVSA+A V+V  P A    +AA E K EF+
Sbjct: 1   MADINALVDQLSALTVLEAAELSKALEEKWGVSAAAAVAVAGPAAGAPAAAAEEVKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G++K+EA ++KK+LE+A
Sbjct: 61  VVLTG--DGGKKINVIKEVRAITGLGLTEAKALVEGAPKAVKEGVNKEEAEKLKKQLEEA 118

Query: 120 GATVELR 126
           GATVEL+
Sbjct: 119 GATVELK 125


>gi|307293949|ref|ZP_07573793.1| ribosomal protein L7/L12 [Sphingobium chlorophenolicum L-1]
 gi|306880100|gb|EFN11317.1| ribosomal protein L7/L12 [Sphingobium chlorophenolicum L-1]
          Length = 126

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 98/128 (76%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS--ASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I ++V++LS+LT++EAAELSK LE++WGVS  A+  V+  A  AA A  A   K EF
Sbjct: 1   MADINALVDQLSALTVLEAAELSKALEEKWGVSAAAAVAVAAPAGGAAGAAPAEEAKDEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G+ KDEA ++KK+LE+
Sbjct: 61  DVVLTG--DGGKKINVIKEVRAITGLGLTEAKALVEGAPKAVKEGVGKDEAEKLKKQLEE 118

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 119 AGATVELK 126


>gi|304391366|ref|ZP_07373308.1| ribosomal protein L7/L12 [Ahrensia sp. R2A130]
 gi|303295595|gb|EFL89953.1| ribosomal protein L7/L12 [Ahrensia sp. R2A130]
          Length = 122

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/126 (58%), Positives = 95/126 (75%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LS+LT++EAAELS  LE+ WGVSA+AP +      A    A  EK EF+V
Sbjct: 1   MADLKKIVDDLSALTVMEAAELSTMLEEHWGVSAAAPAAAAVAGPAA--EAVEEKDEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA E+KK+LE AG
Sbjct: 59  ILTGAGD--KKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGISKGEAEEVKKQLEGAG 116

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 117 ASVELK 122


>gi|294012920|ref|YP_003546380.1| ribosomal protein L7/L12 [Sphingobium japonicum UT26S]
 gi|292676250|dbj|BAI97768.1| ribosomal protein L7/L12 [Sphingobium japonicum UT26S]
          Length = 126

 Score =  116 bits (290), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS--ASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I ++V++LS+LT++EAAELSK LE++WGVS  A+  V+  A   A A  A   K EF
Sbjct: 1   MADINALVDQLSALTVLEAAELSKALEEKWGVSAAAAVAVAAPAGGGAGAAPAEEAKDEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G+ KDEA ++KK+LE+
Sbjct: 61  DVVLTG--DGGKKINVIKEVRAITGLGLTEAKALVEGAPKAVKEGVGKDEAEKIKKQLEE 118

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 119 AGATVELK 126


>gi|17987031|ref|NP_539665.1| 50S ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. 16M]
 gi|23502122|ref|NP_698249.1| 50S ribosomal protein L7/L12 [Brucella suis 1330]
 gi|62290155|ref|YP_221948.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 1 str. 9-941]
 gi|82700077|ref|YP_414651.1| 50S ribosomal protein L7/L12 [Brucella melitensis biovar Abortus
           2308]
 gi|161619200|ref|YP_001593087.1| 50S ribosomal protein L7/L12 [Brucella canis ATCC 23365]
 gi|163843509|ref|YP_001627913.1| 50S ribosomal protein L7/L12 [Brucella suis ATCC 23445]
 gi|189024391|ref|YP_001935159.1| Ribosomal protein L7/L12 [Brucella abortus S19]
 gi|225627713|ref|ZP_03785750.1| ribosomal protein L7/L12 [Brucella ceti str. Cudo]
 gi|225852741|ref|YP_002732974.1| 50S ribosomal protein L7/L12 [Brucella melitensis ATCC 23457]
 gi|237815663|ref|ZP_04594660.1| ribosomal protein L7/L12 [Brucella abortus str. 2308 A]
 gi|254689461|ref|ZP_05152715.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 6 str. 870]
 gi|254693946|ref|ZP_05155774.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 3 str. Tulya]
 gi|254697598|ref|ZP_05159426.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701983|ref|ZP_05163811.1| 50S ribosomal protein L7/L12 [Brucella suis bv. 5 str. 513]
 gi|254704526|ref|ZP_05166354.1| 50S ribosomal protein L7/L12 [Brucella suis bv. 3 str. 686]
 gi|254706578|ref|ZP_05168406.1| 50S ribosomal protein L7/L12 [Brucella pinnipedialis M163/99/10]
 gi|254710312|ref|ZP_05172123.1| 50S ribosomal protein L7/L12 [Brucella pinnipedialis B2/94]
 gi|254714309|ref|ZP_05176120.1| 50S ribosomal protein L7/L12 [Brucella ceti M644/93/1]
 gi|254717746|ref|ZP_05179557.1| 50S ribosomal protein L7/L12 [Brucella ceti M13/05/1]
 gi|254730490|ref|ZP_05189068.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 4 str. 292]
 gi|256031806|ref|ZP_05445420.1| 50S ribosomal protein L7/L12 [Brucella pinnipedialis M292/94/1]
 gi|256044891|ref|ZP_05447795.1| 50S ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061323|ref|ZP_05451471.1| 50S ribosomal protein L7/L12 [Brucella neotomae 5K33]
 gi|256113799|ref|ZP_05454599.1| 50S ribosomal protein L7/L12 [Brucella melitensis bv. 3 str. Ether]
 gi|256159979|ref|ZP_05457694.1| 50S ribosomal protein L7/L12 [Brucella ceti M490/95/1]
 gi|256255207|ref|ZP_05460743.1| 50S ribosomal protein L7/L12 [Brucella ceti B1/94]
 gi|256257707|ref|ZP_05463243.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 9 str. C68]
 gi|256263772|ref|ZP_05466304.1| ribosomal protein L7/L12 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369667|ref|YP_003107177.1| 50S ribosomal protein L7/L12 [Brucella microti CCM 4915]
 gi|260168940|ref|ZP_05755751.1| 50S ribosomal protein L7/L12 [Brucella sp. F5/99]
 gi|260546700|ref|ZP_05822439.1| ribosomal protein L7/L12 [Brucella abortus NCTC 8038]
 gi|260565507|ref|ZP_05835991.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. 16M]
 gi|260566230|ref|ZP_05836700.1| ribosomal protein L7/L12 [Brucella suis bv. 4 str. 40]
 gi|260754985|ref|ZP_05867333.1| ribosomal protein L7/L12 [Brucella abortus bv. 6 str. 870]
 gi|260758201|ref|ZP_05870549.1| ribosomal protein L7/L12 [Brucella abortus bv. 4 str. 292]
 gi|260762028|ref|ZP_05874371.1| ribosomal protein L7/L12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883993|ref|ZP_05895607.1| ribosomal protein L7/L12 [Brucella abortus bv. 9 str. C68]
 gi|261214239|ref|ZP_05928520.1| ribosomal protein L7/L12 [Brucella abortus bv. 3 str. Tulya]
 gi|261219590|ref|ZP_05933871.1| ribosomal protein L7/L12 [Brucella ceti M13/05/1]
 gi|261222403|ref|ZP_05936684.1| ribosomal protein L7/L12 [Brucella ceti B1/94]
 gi|261314037|ref|ZP_05953234.1| ribosomal protein L7/L12 [Brucella pinnipedialis M163/99/10]
 gi|261317876|ref|ZP_05957073.1| ribosomal protein L7/L12 [Brucella pinnipedialis B2/94]
 gi|261322085|ref|ZP_05961282.1| ribosomal protein L7/L12 [Brucella ceti M644/93/1]
 gi|261325328|ref|ZP_05964525.1| ribosomal protein L7/L12 [Brucella neotomae 5K33]
 gi|261752551|ref|ZP_05996260.1| ribosomal protein L7/L12 [Brucella suis bv. 5 str. 513]
 gi|261755210|ref|ZP_05998919.1| ribosomal protein L7/L12 [Brucella suis bv. 3 str. 686]
 gi|261758433|ref|ZP_06002142.1| ribosomal protein L7/L12 [Brucella sp. F5/99]
 gi|265988905|ref|ZP_06101462.1| ribosomal protein L7/L12 [Brucella pinnipedialis M292/94/1]
 gi|265991319|ref|ZP_06103876.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995156|ref|ZP_06107713.1| ribosomal protein L7/L12 [Brucella melitensis bv. 3 str. Ether]
 gi|265998369|ref|ZP_06110926.1| ribosomal protein L7/L12 [Brucella ceti M490/95/1]
 gi|294852580|ref|ZP_06793253.1| 50S ribosomal protein L7/L12 [Brucella sp. NVSL 07-0026]
 gi|297248549|ref|ZP_06932267.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 5 str. B3196]
 gi|61233341|sp|P0A468|RL7_BRUME RecName: Full=50S ribosomal protein L7/L12
 gi|61233343|sp|P0A469|RL7_BRUSU RecName: Full=50S ribosomal protein L7/L12
 gi|61233348|sp|P0A470|RL7_BRUAB RecName: Full=50S ribosomal protein L7/L12
 gi|109893749|sp|Q2YM14|RL7_BRUA2 RecName: Full=50S ribosomal protein L7/L12
 gi|189042982|sp|A9M5R1|RL7_BRUC2 RecName: Full=50S ribosomal protein L7/L12
 gi|189042983|sp|B0CH42|RL7_BRUSI RecName: Full=50S ribosomal protein L7/L12
 gi|226733649|sp|B2S688|RL7_BRUA1 RecName: Full=50S ribosomal protein L7/L12
 gi|254806266|sp|C0RJL2|RL7_BRUMB RecName: Full=50S ribosomal protein L7/L12
 gi|304271|gb|AAA19863.1| ribosomal protein L7/L12 [Brucella abortus]
 gi|450254|gb|AAA56790.1| ribosomal protein L7/L12 [Brucella melitensis]
 gi|17982685|gb|AAL51929.1| lsu ribosomal protein l12p (l7/l12) [Brucella melitensis bv. 1 str.
           16M]
 gi|23348083|gb|AAN30164.1| ribosomal protein L7/L12 [Brucella suis 1330]
 gi|62196287|gb|AAX74587.1| RplL, ribosomal protein L7/L12 [Brucella abortus bv. 1 str. 9-941]
 gi|82616178|emb|CAJ11221.1| Ribosomal protein L7/L12 [Brucella melitensis biovar Abortus 2308]
 gi|121078805|gb|ABM47417.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. M5]
 gi|161336011|gb|ABX62316.1| ribosomal protein L7/L12 [Brucella canis ATCC 23365]
 gi|163674232|gb|ABY38343.1| ribosomal protein L7/L12 [Brucella suis ATCC 23445]
 gi|189019963|gb|ACD72685.1| Ribosomal protein L7/L12 [Brucella abortus S19]
 gi|225617718|gb|EEH14763.1| ribosomal protein L7/L12 [Brucella ceti str. Cudo]
 gi|225641106|gb|ACO01020.1| ribosomal protein L7/L12 [Brucella melitensis ATCC 23457]
 gi|237788961|gb|EEP63172.1| ribosomal protein L7/L12 [Brucella abortus str. 2308 A]
 gi|255999829|gb|ACU48228.1| 50S ribosomal protein L7/L12 [Brucella microti CCM 4915]
 gi|260095750|gb|EEW79627.1| ribosomal protein L7/L12 [Brucella abortus NCTC 8038]
 gi|260151575|gb|EEW86669.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. 16M]
 gi|260155748|gb|EEW90828.1| ribosomal protein L7/L12 [Brucella suis bv. 4 str. 40]
 gi|260668519|gb|EEX55459.1| ribosomal protein L7/L12 [Brucella abortus bv. 4 str. 292]
 gi|260672460|gb|EEX59281.1| ribosomal protein L7/L12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675093|gb|EEX61914.1| ribosomal protein L7/L12 [Brucella abortus bv. 6 str. 870]
 gi|260873521|gb|EEX80590.1| ribosomal protein L7/L12 [Brucella abortus bv. 9 str. C68]
 gi|260915846|gb|EEX82707.1| ribosomal protein L7/L12 [Brucella abortus bv. 3 str. Tulya]
 gi|260920987|gb|EEX87640.1| ribosomal protein L7/L12 [Brucella ceti B1/94]
 gi|260924679|gb|EEX91247.1| ribosomal protein L7/L12 [Brucella ceti M13/05/1]
 gi|261294775|gb|EEX98271.1| ribosomal protein L7/L12 [Brucella ceti M644/93/1]
 gi|261297099|gb|EEY00596.1| ribosomal protein L7/L12 [Brucella pinnipedialis B2/94]
 gi|261301308|gb|EEY04805.1| ribosomal protein L7/L12 [Brucella neotomae 5K33]
 gi|261303063|gb|EEY06560.1| ribosomal protein L7/L12 [Brucella pinnipedialis M163/99/10]
 gi|261738417|gb|EEY26413.1| ribosomal protein L7/L12 [Brucella sp. F5/99]
 gi|261742304|gb|EEY30230.1| ribosomal protein L7/L12 [Brucella suis bv. 5 str. 513]
 gi|261744963|gb|EEY32889.1| ribosomal protein L7/L12 [Brucella suis bv. 3 str. 686]
 gi|262552837|gb|EEZ08827.1| ribosomal protein L7/L12 [Brucella ceti M490/95/1]
 gi|262766269|gb|EEZ12058.1| ribosomal protein L7/L12 [Brucella melitensis bv. 3 str. Ether]
 gi|263002103|gb|EEZ14678.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093883|gb|EEZ17834.1| ribosomal protein L7/L12 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661102|gb|EEZ31363.1| ribosomal protein L7/L12 [Brucella pinnipedialis M292/94/1]
 gi|294821169|gb|EFG38168.1| 50S ribosomal protein L7/L12 [Brucella sp. NVSL 07-0026]
 gi|297175718|gb|EFH35065.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 5 str. B3196]
 gi|326409266|gb|ADZ66331.1| Ribosomal protein L7/L12 [Brucella melitensis M28]
 gi|326538974|gb|ADZ87189.1| ribosomal protein L7/L12 [Brucella melitensis M5-90]
          Length = 124

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRA+T LGLKEAK+LVE APK++K G SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|153009276|ref|YP_001370491.1| 50S ribosomal protein L7/L12 [Ochrobactrum anthropi ATCC 49188]
 gi|166222187|sp|A6X0A8|RL7_OCHA4 RecName: Full=50S ribosomal protein L7/L12
 gi|151561164|gb|ABS14662.1| ribosomal protein L7/L12 [Ochrobactrum anthropi ATCC 49188]
          Length = 124

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IV+ LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|148556378|ref|YP_001263960.1| 50S ribosomal protein L7/L12 [Sphingomonas wittichii RW1]
 gi|166222214|sp|A5VC06|RL7_SPHWW RecName: Full=50S ribosomal protein L7/L12
 gi|148501568|gb|ABQ69822.1| LSU ribosomal protein L12P [Sphingomonas wittichii RW1]
          Length = 126

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 100/128 (78%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           M++++ +V+ LS+LT++EAAELSK LE++WGVSA+A V+V AP       A +   K EF
Sbjct: 1   MADLQKLVDDLSALTVLEAAELSKLLEEKWGVSAAAAVAVAAPAGGAGAGAPAAEVKDEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L G  D  KKI VIKEVRAIT LGL EAK LVESAPK++K G++KDEA ++KK+LE+
Sbjct: 61  DVILTG--DGGKKINVIKEVRAITGLGLTEAKTLVESAPKAVKEGVNKDEAEKLKKQLEE 118

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 119 AGATVELK 126


>gi|217979964|ref|YP_002364111.1| 50S ribosomal protein L7/L12 [Methylocella silvestris BL2]
 gi|254806384|sp|B8EMS0|RL7_METSB RecName: Full=50S ribosomal protein L7/L12
 gi|217505340|gb|ACK52749.1| ribosomal protein L7/L12 [Methylocella silvestris BL2]
          Length = 126

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/128 (61%), Positives = 101/128 (78%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+A V+V A  AA A +AA   E+TEF
Sbjct: 1   MANLEKIVEDLSTLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGAAAAAPAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F D  KKI VIKEVRA+T LGLKEAK+LVE+APK +K G++K+EA ++K  LE 
Sbjct: 61  TVVLAAFGD--KKIEVIKEVRAVTGLGLKEAKDLVEAAPKPVKEGVTKEEAEKIKAALEK 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|209964029|ref|YP_002296944.1| ribosomal protein L7 [Rhodospirillum centenum SW]
 gi|226733728|sp|B6IRP5|RL7_RHOCS RecName: Full=50S ribosomal protein L7/L12
 gi|209957495|gb|ACI98131.1| ribosomal protein L7 [Rhodospirillum centenum SW]
          Length = 126

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/128 (61%), Positives = 103/128 (80%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           MS +E +VE LS+LT++EAAELSK LE++WGVSA+APV+V A  AA A +AA   E+TEF
Sbjct: 1   MSKLEKLVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAPAAAAAAAAPVEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V+L   D   KKI VIKEVRAIT+LGLKEAK+LVE APK++K G +KDEA ++KK+LE+
Sbjct: 61  TVIL--VDGGDKKINVIKEVRAITNLGLKEAKDLVEGAPKTVKEGATKDEAAKIKKQLEE 118

Query: 119 AGATVELR 126
           AGA V+++
Sbjct: 119 AGAKVDIK 126


>gi|92117083|ref|YP_576812.1| 50S ribosomal protein L7/L12 [Nitrobacter hamburgensis X14]
 gi|123387125|sp|Q1QN45|RL7_NITHX RecName: Full=50S ribosomal protein L7/L12
 gi|91799977|gb|ABE62352.1| LSU ribosomal protein L12P [Nitrobacter hamburgensis X14]
          Length = 124

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 99/126 (78%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V A   A A +AA E+TEF V
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGAAAAAEEQTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 61  VLAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKLKAQLEKAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|316933511|ref|YP_004108493.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris DX-1]
 gi|315601225|gb|ADU43760.1| ribosomal protein L7/L12 [Rhodopseudomonas palustris DX-1]
          Length = 124

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A  A  A + A EKT+F V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAAPAGGAAAPAEEKTDFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKEVRAIT LGLKEAK+LVE APK LK G++K+EA ++K +LE AG
Sbjct: 61  VLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVNKEEAEKIKAQLEKAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|296282027|ref|ZP_06860025.1| ribosomal protein L7/L12 [Citromicrobium bathyomarinum JL354]
          Length = 124

 Score =  114 bits (285), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 94/126 (74%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  +VE+LS LT++EAA+L+K LE+EWGVSA+A V+V  P A     AA EK EF+V
Sbjct: 1   MADIAKLVEELSKLTVLEAADLAKALEEEWGVSAAAAVAVAGPAAGGDAPAAEEKDEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGL EAK LVE APK LK G++K EA E+K K+E AG
Sbjct: 61  ILTG--DGGKKIQVIKEVRAITGLGLTEAKALVEGAPKPLKEGVNKAEAEEVKSKIEAAG 118

Query: 121 ATVELR 126
            TVEL+
Sbjct: 119 GTVELK 124


>gi|296116739|ref|ZP_06835347.1| 50S ribosomal protein L7/L12 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976707|gb|EFG83477.1| 50S ribosomal protein L7/L12 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 123

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 103/126 (81%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  AA A +AA EKTEF+V
Sbjct: 1   MADLNKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAAAPA-AAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA ++KK LED G
Sbjct: 60  VLAKAGD--KKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVSKDEAEKIKKTLEDNG 117

Query: 121 ATVELR 126
           A+VE++
Sbjct: 118 ASVEIK 123


>gi|5802237|gb|AAD51621.1|AF169147_2 ribosomal protein L7/L12 [Brucella abortus]
          Length = 124

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 97/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRA+T LGLKEAK+LVE APK++K G S DEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASNDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|158520718|ref|YP_001528588.1| ribosomal protein L7/L12 [Desulfococcus oleovorans Hxd3]
 gi|226733675|sp|A8ZV50|RL7_DESOH RecName: Full=50S ribosomal protein L7/L12
 gi|158509544|gb|ABW66511.1| ribosomal protein L7/L12 [Desulfococcus oleovorans Hxd3]
          Length = 128

 Score =  114 bits (284), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 98/131 (74%), Gaps = 8/131 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA---PVAAEAGSAASEK 55
           M++I  + +++ ++++T++E +EL   LE+++GVSA+APV+++A   P   +AG AA EK
Sbjct: 1   MADITKQDVIDFIANMTVLELSELITELEEKFGVSAAAPVAMMAGGMPAGGDAG-AAEEK 59

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+VVL    D  KKI VIKEVRAIT LGLKEAK LVE APK +K G+ KDEA ++K +
Sbjct: 60  TEFDVVLLTSGD--KKIQVIKEVRAITGLGLKEAKALVEEAPKPVKEGVPKDEAEKLKAQ 117

Query: 116 LEDAGATVELR 126
           LE AGA VE++
Sbjct: 118 LEGAGAQVEIK 128


>gi|37912998|gb|AAR05327.1| ribosomal protein L7/L12 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 126

 Score =  113 bits (283), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 84/128 (65%), Positives = 101/128 (78%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++++ IV++LS LT+IEAAELSK LE +WGVSA+APV+V A  AA +G AA+  EK EF
Sbjct: 1   MADLQQIVDQLSDLTVIEAAELSKMLEDKWGVSAAAPVAVAAAGAAPSGDAAAAEEKDEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            +VL    D  KKI VIKEVR IT LGLKEAK+LVE APK LKTG+SKDEAN  K+KLE 
Sbjct: 61  TIVLAAAGD--KKINVIKEVRTITGLGLKEAKDLVEGAPKELKTGVSKDEANGFKEKLEA 118

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 119 AGATVELK 126


>gi|58038862|ref|YP_190826.1| 50S ribosomal protein L7/L12 [Gluconobacter oxydans 621H]
 gi|81557180|sp|Q5FTX6|RL7_GLUOX RecName: Full=50S ribosomal protein L7/L12
 gi|58001276|gb|AAW60170.1| LSU ribosomal protein L12P (L7/L12) [Gluconobacter oxydans 621H]
          Length = 125

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE+LS+LT++EAAELSK LE++WGVSA+APV+V A  A  A +A +E +TEF 
Sbjct: 1   MADLAKIVEELSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAAAGGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   KKI VIKEVR IT LGLKEAK+LVE APK++K G SKDEA ++KK LEDA
Sbjct: 61  VVLA--DAGDKKINVIKEVRGITGLGLKEAKDLVEGAPKTVKEGASKDEAAKIKKALEDA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEVK 125


>gi|144900872|emb|CAM77736.1| 50S ribosomal protein L7/L12 [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 124

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 102/126 (80%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A   A A  AA E+TEFEV
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAAAPAAEEQTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +  +KKI VIKEVRAIT LGLKEAK+LVE APK++K G+SKDEA ++KK LE+AG
Sbjct: 61  VLT--EAGEKKINVIKEVRAITGLGLKEAKDLVEGAPKTVKDGVSKDEAEKIKKVLEEAG 118

Query: 121 ATVELR 126
           A V ++
Sbjct: 119 AKVAVK 124


>gi|209884798|ref|YP_002288655.1| ribosomal protein L7/L12 [Oligotropha carboxidovorans OM5]
 gi|226733714|sp|B6JER8|RL7_OLICO RecName: Full=50S ribosomal protein L7/L12
 gi|209872994|gb|ACI92790.1| ribosomal protein L7/L12 [Oligotropha carboxidovorans OM5]
          Length = 125

 Score =  113 bits (283), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A AG A +E KTEF+
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAAAGGAPAEEKTEFQ 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK LK G++KDEA ++K  LE A
Sbjct: 61  VVLAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVAKDEAEKIKAALEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|254470413|ref|ZP_05083817.1| ribosomal protein L7/L12 [Pseudovibrio sp. JE062]
 gi|211960724|gb|EEA95920.1| ribosomal protein L7/L12 [Pseudovibrio sp. JE062]
          Length = 123

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 103/126 (81%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE+LS+LT++EAAELSK LE+EWGVSA+APV+V A    EA +AA EKTEF+V
Sbjct: 1   MADLAKIVEELSALTVMEAAELSKMLEEEWGVSAAAPVAVAAVAGGEA-AAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D   KKI VIKEVRAIT LGLKEAKELVE APK +K G++KDEA E+KKKLE+AG
Sbjct: 60  VLA--DAGAKKINVIKEVRAITGLGLKEAKELVEGAPKPVKEGVAKDEAEELKKKLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|103487185|ref|YP_616746.1| 50S ribosomal protein L7/L12 [Sphingopyxis alaskensis RB2256]
 gi|122984980|sp|Q1GSF9|RL7_SPHAL RecName: Full=50S ribosomal protein L7/L12
 gi|98977262|gb|ABF53413.1| LSU ribosomal protein L12P [Sphingopyxis alaskensis RB2256]
          Length = 125

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+A V+V AP  A A + A+E K EF+
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAAVAVAAPGGAGAAAPAAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L G  D   KI VIKEVRAIT LGL EAK LVE APK++K G SK EA E+KKKLE A
Sbjct: 61  VILTG--DGGNKINVIKEVRAITGLGLGEAKALVEGAPKAVKEGASKAEAEELKKKLEAA 118

Query: 120 GATVELR 126
           GATVEL+
Sbjct: 119 GATVELK 125


>gi|328543348|ref|YP_004303457.1| 50S ribosomal protein L7/L12 [Polymorphum gilvum SL003B-26A1]
 gi|326413093|gb|ADZ70156.1| 50S ribosomal protein L7/L12 [Polymorphum gilvum SL003B-26A1]
          Length = 126

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/128 (61%), Positives = 101/128 (78%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  A    +A +E  KTEF
Sbjct: 1   MADLAKLVDELSALTVMEAAELSKLLEEKWGVSAAAPVAVAAVAAGGGAAAPAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL    D  KKI VIKEVRAIT LGLKEAKELVE APK++K  +SK EA E+KKKLE+
Sbjct: 61  DVVLADAGD--KKINVIKEVRAITGLGLKEAKELVEGAPKTVKEQVSKAEAEELKKKLEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|91977664|ref|YP_570323.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris BisB5]
 gi|123735286|sp|Q134R7|RL7_RHOPS RecName: Full=50S ribosomal protein L7/L12
 gi|91684120|gb|ABE40422.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris BisB5]
          Length = 123

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (77%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A A +A  EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAAA-AAVEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 60  VLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPIKEGVNKDEAEKLKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|118591194|ref|ZP_01548593.1| 50S ribosomal protein L7/L12 [Stappia aggregata IAM 12614]
 gi|118436270|gb|EAV42912.1| 50S ribosomal protein L7/L12 [Stappia aggregata IAM 12614]
          Length = 125

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 104/127 (81%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++E +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  A    +AA+E KTEF+
Sbjct: 1   MADLEKLVDELSALTVMEAAELSKLLEEKWGVSAAAPVAVAAVAAGGGDAAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L    D  KKI VIKEVRAIT LGLKEAKELVE APK +K G+ KDEA E+KKKLE+A
Sbjct: 61  VILASAGD--KKINVIKEVRAITGLGLKEAKELVEGAPKPVKEGVGKDEAEELKKKLEEA 118

Query: 120 GATVELR 126
           GA+VEL+
Sbjct: 119 GASVELK 125


>gi|110634170|ref|YP_674378.1| 50S ribosomal protein L7/L12 [Mesorhizobium sp. BNC1]
 gi|123353587|sp|Q11HB2|RL7_MESSB RecName: Full=50S ribosomal protein L7/L12
 gi|110285154|gb|ABG63213.1| LSU ribosomal protein L12P [Chelativorans sp. BNC1]
          Length = 125

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 101/127 (79%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A A +AA+E KTEF+
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKMLEEKWGVSAAAPVAVAAAGGAAAPAAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLA--DAGAQKINVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKIKAQLEGA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|15639232|ref|NP_218680.1| 50S ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025473|ref|YP_001933245.1| 50S ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum
           SS14]
 gi|6094098|sp|O83268|RL7_TREPA RecName: Full=50S ribosomal protein L7/L12
 gi|226734489|sp|B2S2I7|RL7_TREPS RecName: Full=50S ribosomal protein L7/L12
 gi|3322510|gb|AAC65228.1| ribosomal protein L7/L12 (rplL) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018048|gb|ACD70666.1| ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum SS14]
 gi|291059643|gb|ADD72378.1| ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum str.
           Chicago]
          Length = 129

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E I+E +   T++E +EL K +E+E+GV+A+ PV+ VA        AA E+TEF V
Sbjct: 4   LSN-EQIIEAIRGKTILELSELIKAVEEEFGVTAAVPVAPVAEGGGAGSVAAEEQTEFTV 62

Query: 61  VLKGFDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VLKG  +P KKIAVIKEVR  I+ LGLKEAK+LVE APK+LK  +SK+EA ++K+ +  A
Sbjct: 63  VLKGLAEPGKKIAVIKEVRNVISGLGLKEAKDLVEGAPKTLKENVSKEEAAKIKESMTAA 122

Query: 120 GATVEL 125
           GA +E+
Sbjct: 123 GALIEI 128


>gi|87198056|ref|YP_495313.1| 50S ribosomal protein L7/L12 [Novosphingobium aromaticivorans DSM
           12444]
 gi|109893777|sp|Q2GCD1|RL7_NOVAD RecName: Full=50S ribosomal protein L7/L12
 gi|87133737|gb|ABD24479.1| LSU ribosomal protein L12P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 123

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  +VE+LS LT++EAA+L+K LE+ WGVSA+A V+V A  AA A  AA EKTEF+V
Sbjct: 1   MADIAKLVEELSKLTVLEAADLAKALEEAWGVSAAAAVAVAAAPAAAA-EAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT+LGL EAK LVE APK++K G+SK EA ++KKK+E+AG
Sbjct: 60  ILTG--DGGKKIQVIKEVRAITNLGLTEAKALVEGAPKAIKEGVSKAEAEDIKKKIEEAG 117

Query: 121 ATVELR 126
            TVE++
Sbjct: 118 GTVEVK 123


>gi|51473338|ref|YP_067095.1| 50S ribosomal protein L7/L12 [Rickettsia typhi str. Wilmington]
 gi|81610830|sp|Q68XM9|RL7_RICTY RecName: Full=50S ribosomal protein L7/L12
 gi|51459650|gb|AAU03613.1| 50S ribosomal protein L7/L12 [Rickettsia typhi str. Wilmington]
          Length = 125

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M+++  I E+LSSLTL++AAEL K LE +WGVSA  P++V  A VA     A +EKTEFE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKILEAKWGVSAVTPIAVASAGVADPVAEAVAEKTEFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KK+ VIK ++ IT LGL EAK+LV+ APK +K+ L K EA E+K KLE  
Sbjct: 61  VVLTATGD--KKVEVIKIIKDITGLGLIEAKKLVDEAPKPIKSNLKKAEAEEIKNKLEAT 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|90994530|ref|YP_537020.1| ribosomal protein L12 [Porphyra yezoensis]
 gi|122232138|sp|Q1XDE8|RK12_PORYE RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|90819094|dbj|BAE92463.1| 50S ribosomal protein L12 [Porphyra yezoensis]
          Length = 129

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 4/125 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           + +E+I+E+L SL L+EAAEL   +E+ + V ASA    + +  P +A A +   EKTEF
Sbjct: 3   TKVENILEELKSLNLLEAAELVNTIEETFDVDASAASGGMMMATPTSAPASAEVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+    PKK I+V+K VR +T LGLKEAK+LVES PK LK G SKD+A  MKK+LED
Sbjct: 63  DVVLEEVPAPKK-ISVLKVVRPLTGLGLKEAKDLVESTPKVLKEGASKDDAETMKKQLED 121

Query: 119 AGATV 123
           AGATV
Sbjct: 122 AGATV 126


>gi|115525597|ref|YP_782508.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris BisA53]
 gi|122295398|sp|Q07KK6|RL7_RHOP5 RecName: Full=50S ribosomal protein L7/L12
 gi|115519544|gb|ABJ07528.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris BisA53]
          Length = 123

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V  P AA A + A EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAGPAAAAA-APAEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 60  VLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKVKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|83594028|ref|YP_427780.1| 50S ribosomal protein L7/L12 [Rhodospirillum rubrum ATCC 11170]
 gi|109893794|sp|Q2RQV2|RL7_RHORT RecName: Full=50S ribosomal protein L7/L12
 gi|83576942|gb|ABC23493.1| LSU ribosomal protein L12P [Rhodospirillum rubrum ATCC 11170]
          Length = 123

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  A  A +   EKTEF+V
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAAEAA-APVEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   KKI VIKEVRAIT+LGLKEAK+LVE APK +K  +SKDEA  +KKKLE+AG
Sbjct: 60  IL--VDAGDKKINVIKEVRAITNLGLKEAKDLVEGAPKPVKEAVSKDEAASIKKKLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|15965100|ref|NP_385453.1| 50S ribosomal protein L7/L12 [Sinorhizobium meliloti 1021]
 gi|307314835|ref|ZP_07594428.1| ribosomal protein L7/L12 [Sinorhizobium meliloti BL225C]
 gi|307322134|ref|ZP_07601508.1| ribosomal protein L7/L12 [Sinorhizobium meliloti AK83]
 gi|20978567|sp|Q92QH8|RL7_RHIME RecName: Full=50S ribosomal protein L7/L12
 gi|15074280|emb|CAC45926.1| Probable 50S ribosomal protein L7/L12 (L8) [Sinorhizobium meliloti
           1021]
 gi|306892219|gb|EFN23031.1| ribosomal protein L7/L12 [Sinorhizobium meliloti AK83]
 gi|306898949|gb|EFN29596.1| ribosomal protein L7/L12 [Sinorhizobium meliloti BL225C]
          Length = 126

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 98/128 (76%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A   +A    EKTEF
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAGAAAPVEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLED
Sbjct: 61  DVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLED 118

Query: 119 AGATVELR 126
           AGA V+++
Sbjct: 119 AGAKVDVK 126


>gi|296444413|ref|ZP_06886378.1| ribosomal protein L7/L12 [Methylosinus trichosporium OB3b]
 gi|296258060|gb|EFH05122.1| ribosomal protein L7/L12 [Methylosinus trichosporium OB3b]
          Length = 126

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 95/128 (74%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+A V+V A   A   +AA   EKTEF
Sbjct: 1   MANLEKIVEDLSALTVLEAAELAKMLEEKWGVSAAAAVAVAAAPGAGGAAAAPVEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V+L    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G+ KDEA ++K  LE 
Sbjct: 61  NVILAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVGKDEAEKIKATLEK 118

Query: 119 AGATVELR 126
            GA VEL+
Sbjct: 119 VGAKVELK 126


>gi|284928827|ref|YP_003421349.1| 50S ribosomal protein L12P [cyanobacterium UCYN-A]
 gi|284809286|gb|ADB94991.1| LSU ribosomal protein L12P [cyanobacterium UCYN-A]
          Length = 131

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/132 (57%), Positives = 97/132 (73%), Gaps = 7/132 (5%)

Query: 1   MSNI-ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----VVAPVAAEAGSAASE 54
           MSNI + I+EKL SL+L+EA+EL K++E+ + VSASAPV           AA AG AA E
Sbjct: 1   MSNITDEIIEKLKSLSLLEASELVKQIEEVFDVSASAPVGGMMMGAPVAAAAGAGEAAEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L+ F    KKIA++K VR IT LGLKEAK+LVES PKSLK G +KD+A  +KK
Sbjct: 61  KTEFDVILEEFP-SDKKIAILKVVRTITGLGLKEAKDLVESTPKSLKEGTTKDDAESIKK 119

Query: 115 KLEDAGATVELR 126
           +LEDAGA V ++
Sbjct: 120 QLEDAGAKVTIK 131


>gi|11465805|ref|NP_053949.1| ribosomal protein L12 [Porphyra purpurea]
 gi|1710409|sp|P51339|RK12_PORPU RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|1276805|gb|AAC08225.1| 50S ribosomal protein L12 [Porphyra purpurea]
          Length = 129

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           + +E+I+E+L SL L+EAAEL K++E+ + V ASA    V + AP +A A S   EKTEF
Sbjct: 3   TKVENILEELKSLNLLEAAELVKQIEETFDVDASAASGGVMMAAPSSAPAASDVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+    PKK IAV+K VR++T LGLKEAK+LVESAPK+LK G SKD+A  MKK+LED
Sbjct: 63  DVVLEEVPAPKK-IAVLKVVRSLTGLGLKEAKDLVESAPKTLKEGASKDDAEAMKKQLED 121

Query: 119 AGATVELR 126
           AGATV ++
Sbjct: 122 AGATVGVK 129


>gi|190891346|ref|YP_001977888.1| 50S ribosomal protein L7/L12 [Rhizobium etli CIAT 652]
 gi|226733726|sp|B3PW58|RL7_RHIE6 RecName: Full=50S ribosomal protein L7/L12
 gi|190696625|gb|ACE90710.1| 50S ribosomal protein L7/L12 [Rhizobium etli CIAT 652]
 gi|327194524|gb|EGE61382.1| 50S ribosomal protein L7/L12 [Rhizobium etli CNPAF512]
          Length = 127

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 99/129 (76%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A      G+AA    EKTE
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGGAGGAAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLE
Sbjct: 61  FDVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLE 118

Query: 118 DAGATVELR 126
           DAGA  +++
Sbjct: 119 DAGAKADVK 127


>gi|86357296|ref|YP_469188.1| 50S ribosomal protein L7/L12 [Rhizobium etli CFN 42]
 gi|109893790|sp|Q2K9M5|RL7_RHIEC RecName: Full=50S ribosomal protein L7/L12
 gi|86281398|gb|ABC90461.1| 50S ribosomal protein L7/L12 [Rhizobium etli CFN 42]
          Length = 127

 Score =  111 bits (277), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 100/129 (77%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A  G+AA    EKTE
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGGAAGGAAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLE
Sbjct: 61  FDVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLE 118

Query: 118 DAGATVELR 126
           DAGA  +++
Sbjct: 119 DAGAKADVK 127


>gi|90424948|ref|YP_533318.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris BisB18]
 gi|109893793|sp|Q211D7|RL7_RHOPB RecName: Full=50S ribosomal protein L7/L12
 gi|90106962|gb|ABD88999.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris BisB18]
          Length = 123

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V  P AA A + A EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAGPAAAAA-APAEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    +  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA+++K +LE AG
Sbjct: 60  VLAAAGE--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEADKIKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|304321429|ref|YP_003855072.1| 50S ribosomal protein L7/L12 [Parvularcula bermudensis HTCC2503]
 gi|303300331|gb|ADM09930.1| ribosomal protein L7/L12 [Parvularcula bermudensis HTCC2503]
          Length = 127

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 92/129 (71%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV--APVAAEAGSAASE-KTE 57
           M++I+++ E++  LTL+EA EL   L+ E+G+  +    VV   PV  + G  A+E KTE
Sbjct: 1   MADIKALAEQIVGLTLLEAKELQDLLKDEYGIEPATGGGVVMAGPVGGDGGGDAAEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L    D  KKI VIKEVR IT LGLKEAKELVE APK +K G+SKDEA E+KKKLE
Sbjct: 61  FDVILTSAGD--KKINVIKEVRGITGLGLKEAKELVEGAPKPVKEGVSKDEAEELKKKLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAGVELK 127


>gi|218672630|ref|ZP_03522299.1| 50S ribosomal protein L7/L12 [Rhizobium etli GR56]
          Length = 125

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +   E KTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGGPAGPAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLEDA
Sbjct: 61  VILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|154253169|ref|YP_001413993.1| 50S ribosomal protein L7/L12 [Parvibaculum lavamentivorans DS-1]
 gi|171769621|sp|A7HWQ3|RL7_PARL1 RecName: Full=50S ribosomal protein L7/L12
 gi|154157119|gb|ABS64336.1| ribosomal protein L7/L12 [Parvibaculum lavamentivorans DS-1]
          Length = 123

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 79/126 (62%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A  AA A +AA E+TEF+V
Sbjct: 1   MTDLAKIVEDLSNLTVLEAAELSKMLEEKWGVSAAAPVAVAAAGAAPA-AAAEEQTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L    D  KKI VIKEVRAIT LGLKEAK+LVE APK++K   SKDEA ++K +LE AG
Sbjct: 60  ILAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKTVKEAASKDEAAKIKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|85375711|ref|YP_459773.1| ribosomal protein L7/L12 [Erythrobacter litoralis HTCC2594]
 gi|123004981|sp|Q2N5R5|RL7_ERYLH RecName: Full=50S ribosomal protein L7/L12
 gi|84788794|gb|ABC64976.1| ribosomal protein L7/L12 [Erythrobacter litoralis HTCC2594]
          Length = 125

 Score =  111 bits (277), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I+++VE+LS LT++EAAEL+K LE+EWGVSA+A V+V  P      +A +E K EF+
Sbjct: 1   MADIKALVEELSKLTVLEAAELAKALEEEWGVSAAAAVAVAGPAGGGDAAAPAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L G  D  KKI VIKEVRAIT LGL EAK LVE APK +K G++K EA E+K K+E A
Sbjct: 61  VILTG--DGGKKIQVIKEVRAITGLGLTEAKGLVEGAPKPIKEGVNKAEAEEIKGKIEAA 118

Query: 120 GATVELR 126
           G TVEL+
Sbjct: 119 GGTVELK 125


>gi|218462359|ref|ZP_03502450.1| 50S ribosomal protein L7/L12 [Rhizobium etli Kim 5]
          Length = 126

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +A    EKTEF
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAGGAGAAAPVEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLED
Sbjct: 61  DVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLED 118

Query: 119 AGATVELR 126
           AGA  +++
Sbjct: 119 AGAKADVK 126


>gi|163759406|ref|ZP_02166492.1| putative 50S ribosomal protein L7/L12 (L8) [Hoeflea phototrophica
           DFL-43]
 gi|162283810|gb|EDQ34095.1| putative 50S ribosomal protein L7/L12 (L8) [Hoeflea phototrophica
           DFL-43]
          Length = 125

 Score =  110 bits (276), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 101/127 (79%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A+E KTEF+
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKMLEEKWGVSAAAPVAVAAAGGGAAPAEAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVR+IT LGLKEAK+LVE+APK++K G+SK EA ++KKKLEDA
Sbjct: 61  VILA--EAGANKINVIKEVRSITGLGLKEAKDLVEAAPKAVKEGISKGEAEDLKKKLEDA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEVK 125


>gi|148260946|ref|YP_001235073.1| 50S ribosomal protein L7/L12 [Acidiphilium cryptum JF-5]
 gi|326404344|ref|YP_004284426.1| 50S ribosomal protein L7/L12 [Acidiphilium multivorum AIU301]
 gi|166222127|sp|A5FZX2|RL7_ACICJ RecName: Full=50S ribosomal protein L7/L12
 gi|146402627|gb|ABQ31154.1| LSU ribosomal protein L12P [Acidiphilium cryptum JF-5]
 gi|325051206|dbj|BAJ81544.1| 50S ribosomal protein L7/L12 [Acidiphilium multivorum AIU301]
          Length = 127

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 101/126 (80%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M+++ ++VE+LSSLT++EAAELSK LE++WGVSA+APV+V A   A  G+AA+   EKTE
Sbjct: 1   MADLANLVEQLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPAGGGAAAAPVEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LK   D  KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++KK LE
Sbjct: 61  FNVILKSSGD--KKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKVLE 118

Query: 118 DAGATV 123
           + GA+V
Sbjct: 119 EQGASV 124


>gi|323137106|ref|ZP_08072185.1| ribosomal protein L7/L12 [Methylocystis sp. ATCC 49242]
 gi|322397464|gb|EFX99986.1| ribosomal protein L7/L12 [Methylocystis sp. ATCC 49242]
          Length = 126

 Score =  110 bits (275), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 95/128 (74%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+A V+V A   A   +A +  EKTEF
Sbjct: 1   MANLEKIVEDLSALTVLEAAELAKMLEEKWGVSAAAAVAVAAAPGAGGAAAPAAEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V+L    D  KKI VIKEVRAIT LGLKEAK+LVE APK LK G SK+EA ++K  LE 
Sbjct: 61  NVILASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGASKEEAEKIKATLEK 118

Query: 119 AGATVELR 126
            GA +EL+
Sbjct: 119 VGAKIELK 126


>gi|86749404|ref|YP_485900.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris HaA2]
 gi|109893792|sp|Q2IXS1|RL7_RHOP2 RecName: Full=50S ribosomal protein L7/L12
 gi|86572432|gb|ABD06989.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris HaA2]
          Length = 123

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 75/126 (59%), Positives = 99/126 (78%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A A +A  EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAAA-AAVEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++K+EA+++K +LE AG
Sbjct: 60  MLAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKEEADKLKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|154247291|ref|YP_001418249.1| 50S ribosomal protein L7/L12 [Xanthobacter autotrophicus Py2]
 gi|226734495|sp|A7IKP9|RL7_XANP2 RecName: Full=50S ribosomal protein L7/L12
 gi|154161376|gb|ABS68592.1| ribosomal protein L7/L12 [Xanthobacter autotrophicus Py2]
          Length = 124

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 74/126 (58%), Positives = 97/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LSSLT++EAAEL+K LE++WGVSA+A V+V A  A  A +A  E+TEF V
Sbjct: 1   MADLTKLVDELSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPAGAAAAAVEEQTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    +  KKI VIKEVRAIT LGLKEAK+LVE APK +K  +SKDEA ++K +LE AG
Sbjct: 61  VLAAAGE--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEAVSKDEAEKLKAQLEKAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|23012509|ref|ZP_00052576.1| COG0222: Ribosomal protein L7/L12 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 125

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 103/127 (81%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  +V+ LS+LT++EAAELSK LE++WGVSA+APV+V A   A A + A+E +TEF+
Sbjct: 1   MADLAKLVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAGAAAPAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D  +KKI VIKEVRAIT LGLKE K+LVE+APKS+K G+SKDEA ++KK LE+A
Sbjct: 61  VILT--DAGEKKINVIKEVRAITGLGLKEVKDLVEAAPKSVKDGVSKDEAEKIKKVLEEA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVQVK 125


>gi|148256403|ref|YP_001240988.1| 50S ribosomal protein L7/L12 [Bradyrhizobium sp. BTAi1]
 gi|166222139|sp|A5ELN8|RL7_BRASB RecName: Full=50S ribosomal protein L7/L12
 gi|146408576|gb|ABQ37082.1| LSU ribosomal protein L12P [Bradyrhizobium sp. BTAi1]
          Length = 125

 Score =  110 bits (274), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 77/127 (60%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V AP A  A +A +E KTEF 
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAPGAGGAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKIKGQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|39936332|ref|NP_948608.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris CGA009]
 gi|192292058|ref|YP_001992663.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris TIE-1]
 gi|81562130|sp|Q6N4R8|RL7_RHOPA RecName: Full=50S ribosomal protein L7/L12; AltName:
           Full=RRP-L7/L12
 gi|226733729|sp|B3QC01|RL7_RHOPT RecName: Full=50S ribosomal protein L7/L12
 gi|39650187|emb|CAE28710.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris CGA009]
 gi|192285807|gb|ACF02188.1| ribosomal protein L7/L12 [Rhodopseudomonas palustris TIE-1]
          Length = 125

 Score =  110 bits (274), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A   +A +E KTEF 
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK LK G++K+EA ++K +LE A
Sbjct: 61  VVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVNKEEAEKVKAQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|294085950|ref|YP_003552710.1| 50S ribosomal protein L7/L12 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665525|gb|ADE40626.1| 50S ribosomal protein L7/L12 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 126

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 95/128 (74%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           M++I  I E LS+LT++EAAEL+  LE++WGVSA+A    +A  A    +  +   KTEF
Sbjct: 1   MADIAKIAEDLSNLTVLEAAELATMLEEKWGVSAAAAPMAMAMPAGGGDAGGAAEAKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL        KI VIKEVRAIT LGLKEAK+LVE+APK++K G+S+DEANE+K KLE+
Sbjct: 61  DVVLTAA--GASKINVIKEVRAITGLGLKEAKDLVEAAPKAVKEGVSEDEANEIKGKLEE 118

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 119 AGASVEVK 126


>gi|114327210|ref|YP_744367.1| 50S ribosomal protein L7/L12 [Granulibacter bethesdensis CGDNIH1]
 gi|122327809|sp|Q0BUQ8|RL7_GRABC RecName: Full=50S ribosomal protein L7/L12
 gi|114315384|gb|ABI61444.1| LSU ribosomal protein L12P (L7/L12) [Granulibacter bethesdensis
           CGDNIH1]
          Length = 125

 Score =  110 bits (274), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++ ++VE+LSSLT++EAAELSK LE++WGVSA+APV+V A  AA A +A +E +TEF 
Sbjct: 1   MADLSNLVEQLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAPAAGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L    D  KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++KK LE+ 
Sbjct: 61  VILAKAGD--KKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKVLEEQ 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAAVEIK 125


>gi|298490345|ref|YP_003720522.1| 50S ribosomal protein L7/L12 ['Nostoc azollae' 0708]
 gi|298232263|gb|ADI63399.1| ribosomal protein L7/L12 ['Nostoc azollae' 0708]
          Length = 129

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 92/125 (73%), Gaps = 4/125 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEFEVV 61
           + I+E+L SLTL+EA+EL K++E+ +GVSA+AP   + ++AP  A A     EKTEF+ +
Sbjct: 6   DQILEQLKSLTLLEASELVKQIEEAFGVSAAAPAGGMMMMAPPGAPAAEVVEEKTEFDAI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      KKIAV+K VR IT LGLKEAK+LVE+APK +K G++KD A ++KK++ +AG 
Sbjct: 66  LEAVPA-DKKIAVLKIVREITGLGLKEAKDLVEAAPKPVKEGIAKDAAEDIKKRIAEAGG 124

Query: 122 TVELR 126
           TV ++
Sbjct: 125 TVVIK 129


>gi|150396198|ref|YP_001326665.1| 50S ribosomal protein L7/L12 [Sinorhizobium medicae WSM419]
 gi|166222213|sp|A6U850|RL7_SINMW RecName: Full=50S ribosomal protein L7/L12
 gi|150027713|gb|ABR59830.1| ribosomal protein L7/L12 [Sinorhizobium medicae WSM419]
          Length = 125

 Score =  109 bits (273), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A A +   E KTEF+
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAPVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VILT--EAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|75675541|ref|YP_317962.1| 50S ribosomal protein L7/L12 [Nitrobacter winogradskyi Nb-255]
 gi|109893776|sp|Q3SSY1|RL7_NITWN RecName: Full=50S ribosomal protein L7/L12
 gi|74420411|gb|ABA04610.1| LSU ribosomal protein L12P [Nitrobacter winogradskyi Nb-255]
          Length = 125

 Score =  109 bits (272), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V A   A  G+ A+E KTEF 
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGGAPAAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKIKAQLEKA 118

Query: 120 GATVELR 126
           G  VEL+
Sbjct: 119 GGKVELK 125


>gi|146340045|ref|YP_001205093.1| 50S ribosomal protein L7/L12 [Bradyrhizobium sp. ORS278]
 gi|166222140|sp|A4YSI0|RL7_BRASO RecName: Full=50S ribosomal protein L7/L12
 gi|146192851|emb|CAL76856.1| 50S ribosomal subunit protein L7/L12 [Bradyrhizobium sp. ORS278]
          Length = 125

 Score =  109 bits (272), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V AP    A +A +E KTEF 
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAPGGGGAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++K+EA ++K +LE A
Sbjct: 61  VVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKEEAEKIKGQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|220921890|ref|YP_002497191.1| 50S ribosomal protein L7/L12 [Methylobacterium nodulans ORS 2060]
 gi|254806383|sp|B8IS76|RL7_METNO RecName: Full=50S ribosomal protein L7/L12
 gi|219946496|gb|ACL56888.1| ribosomal protein L7/L12 [Methylobacterium nodulans ORS 2060]
          Length = 126

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 98/128 (76%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  +V+ LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +A +  EKTEF
Sbjct: 1   MADLAKLVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAGPAAGGAAAPAVEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL G  D  KKI VIKEVRAIT LGLKEAK+LVE APK +K  ++KDEA ++K +LE 
Sbjct: 61  TVVLAGAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKESVAKDEAEKIKAQLEK 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|27380522|ref|NP_772051.1| 50S ribosomal protein L7/L12 [Bradyrhizobium japonicum USDA 110]
 gi|81736391|sp|Q89J73|RL7_BRAJA RecName: Full=50S ribosomal protein L7/L12
 gi|27353686|dbj|BAC50676.1| 50S ribosomal protein L7/L12 [Bradyrhizobium japonicum USDA 110]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V  P    A +A +E KTEF 
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAGPAGGGAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    +  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLASAGE--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKIKVQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|85709555|ref|ZP_01040620.1| 50S ribosomal protein L7/L12 [Erythrobacter sp. NAP1]
 gi|85688265|gb|EAQ28269.1| 50S ribosomal protein L7/L12 [Erythrobacter sp. NAP1]
          Length = 125

 Score =  108 bits (271), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I  +VE+LS LT++EAAEL+  LE+EWGVSA+A V+V  P       A +E K EF+
Sbjct: 1   MADIAKLVEELSKLTVLEAAELATALEEEWGVSAAAAVAVAGPAGGGDAGAPAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L G  D  KKI VIKEVRAIT LGL EAK LVE APK LK G++K EA E+K K+E A
Sbjct: 61  VILTG--DGGKKIQVIKEVRAITGLGLTEAKGLVEGAPKPLKEGVNKAEAEEIKGKIEAA 118

Query: 120 GATVELR 126
           G TVEL+
Sbjct: 119 GGTVELK 125


>gi|288957412|ref|YP_003447753.1| large subunit ribosomal protein L7/L12 [Azospirillum sp. B510]
 gi|288909720|dbj|BAI71209.1| large subunit ribosomal protein L7/L12 [Azospirillum sp. B510]
          Length = 125

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ +V+ LS+LT++EAAELSK LE++WGVSA+APV+V A   A A +A  E +TEF 
Sbjct: 1   MADLQKLVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGPAAAAAAPVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G +KDEA ++KK+LE+A
Sbjct: 61  VILADAGD--KKINVIKEVRAITGLGLKEAKDLVEGAPKPVKEGATKDEAAKIKKQLEEA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDIK 125


>gi|56551624|ref|YP_162464.1| 50S ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761251|ref|ZP_04759339.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752784|ref|YP_003225677.1| 50S ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|81598288|sp|Q5NPK7|RL7_ZYMMO RecName: Full=50S ribosomal protein L7/L12
 gi|56543198|gb|AAV89352.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374158|gb|EER63655.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552147|gb|ACV75093.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 123

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/126 (62%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSASA V+V A  AA   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSASAAVAVAAAPAAGG-AAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKE+RAIT LGL +AK LVE APK +K G++KDEA ++KK+LE AG
Sbjct: 60  ILTG--DGGKKINVIKEIRAITGLGLTDAKALVEGAPKPVKEGVAKDEAEKLKKQLEAAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|162149181|ref|YP_001603642.1| 50S ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545075|ref|YP_002277304.1| 50S ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|189042997|sp|A9H3S4|RL7_GLUDA RecName: Full=50S ribosomal protein L7/L12
 gi|161787758|emb|CAP57354.1| 50S ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209532752|gb|ACI52689.1| ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 125

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  AA A +A +E +TEF 
Sbjct: 1   MADLTKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAPAAGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++KK LED 
Sbjct: 61  VVLAKAGD--KKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKLLEDN 118

Query: 120 GATVELR 126
           GA+VE++
Sbjct: 119 GASVEVK 125


>gi|222148356|ref|YP_002549313.1| 50S ribosomal protein L7/L12 [Agrobacterium vitis S4]
 gi|254806253|sp|B9JVM7|RL7_AGRVS RecName: Full=50S ribosomal protein L7/L12
 gi|221735344|gb|ACM36307.1| 50S ribosomal protein L7/L12 [Agrobacterium vitis S4]
          Length = 124

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A     A     EKTEF+V
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGGAAAVVEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDAG
Sbjct: 61  ILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDAG 118

Query: 121 ATVELR 126
           A V+++
Sbjct: 119 AKVDVK 124


>gi|319899057|ref|YP_004159150.1| 50S ribosomal protein L7/L12 [Bartonella clarridgeiae 73]
 gi|319403021|emb|CBI76576.1| 50S ribosomal protein L7/L12 [Bartonella clarridgeiae 73]
          Length = 122

 Score =  108 bits (270), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A  AA    AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVAAVSAAA--PAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G+SKDEA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGISKDEAEKIKTQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|11467613|ref|NP_050665.1| ribosomal protein L12 [Guillardia theta]
 gi|6093978|sp|O78414|RK12_GUITH RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|3602938|gb|AAC35599.1| ribosomal protein L12 [Guillardia theta]
          Length = 129

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/131 (49%), Positives = 96/131 (73%), Gaps = 7/131 (5%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS----AASEKT 56
           M+ +++I+++L  LTL+EAA+L K++E+ + VSA+A  + +  VAA AG+    A  EKT
Sbjct: 1   MNKVQNIIDQLKDLTLLEAADLVKQIEETFNVSATAAAAPINMVAATAGAGSAEAVEEKT 60

Query: 57  EFEVVLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           EF+++L+  D P  KKIAV+K VR +T LGLKEAK+LVE+APK +K G+SK +A   KK+
Sbjct: 61  EFDLILE--DVPADKKIAVLKVVRGLTGLGLKEAKDLVEAAPKPIKEGMSKADAEAGKKQ 118

Query: 116 LEDAGATVELR 126
           LE+AGA   L+
Sbjct: 119 LEEAGAKATLK 129


>gi|170738711|ref|YP_001767366.1| 50S ribosomal protein L7/L12 [Methylobacterium sp. 4-46]
 gi|226733709|sp|B0UHX7|RL7_METS4 RecName: Full=50S ribosomal protein L7/L12
 gi|168192985|gb|ACA14932.1| ribosomal protein L7/L12 [Methylobacterium sp. 4-46]
          Length = 126

 Score =  108 bits (270), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 98/128 (76%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  +V+ LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +A +  E+TEF
Sbjct: 1   MADLAKLVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAGPAAGGAAAPAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G+SKD+A ++K +LE 
Sbjct: 61  TVVLAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVSKDDAAKLKAQLEK 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|149071971|ref|YP_001293478.1| ribosomal protein L12 [Rhodomonas salina]
 gi|134302922|gb|ABO70726.1| ribosomal protein L12 [Rhodomonas salina]
          Length = 129

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 94/130 (72%), Gaps = 5/130 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV----APVAAEAGSAASEKT 56
           MS ++ I+E+L +LTL+EA+EL K++E+ + VSA+A  + +     P A  A  AA EKT
Sbjct: 1   MSKVDEIIEQLKTLTLLEASELVKQIEETFDVSATAAAAPMAMAMVPGAGGAQEAAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF++VL+      KKIAV+K VR IT LGLKEAK+LVESAPKS+K G SKD+A   KK+L
Sbjct: 61  EFDLVLEEVP-ADKKIAVLKVVRGITGLGLKEAKDLVESAPKSIKEGASKDDAEAAKKQL 119

Query: 117 EDAGATVELR 126
           E+AGA V L+
Sbjct: 120 EEAGAKVSLK 129


>gi|90417771|ref|ZP_01225683.1| ribosomal protein L7/L12 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337443|gb|EAS51094.1| ribosomal protein L7/L12 [Aurantimonas manganoxydans SI85-9A1]
          Length = 124

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A        AA E+TEF V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAGGGAPAEAAEEQTEFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       +KI VIKEVRAIT LGLKEAK+LV++APK +K G+ K EA+++K +LE AG
Sbjct: 61  ILASA--GAQKINVIKEVRAITGLGLKEAKDLVDNAPKPVKEGVDKAEADKIKDQLEKAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|197122677|ref|YP_002134628.1| 50S ribosomal protein L7/L12 [Anaeromyxobacter sp. K]
 gi|220917460|ref|YP_002492764.1| ribosomal protein L7/L12 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226733636|sp|B4UDT3|RL7_ANASK RecName: Full=50S ribosomal protein L7/L12
 gi|254806254|sp|B8JB71|RL7_ANAD2 RecName: Full=50S ribosomal protein L7/L12
 gi|196172526|gb|ACG73499.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. K]
 gi|219955314|gb|ACL65698.1| ribosomal protein L7/L12 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 125

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++ +IVE+LS LT++EAAEL K+LE++WGVSA+A   +VA     A +A   EKTEF 
Sbjct: 1   MADLNAIVEQLSGLTIMEAAELVKQLEEKWGVSAAAAPVMVAAGGGAAAAAPVEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE APK +K G++K E+ E+KKKLE A
Sbjct: 61  VVL--VDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKEVKAGVAKAESEELKKKLEAA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEVK 125


>gi|188583687|ref|YP_001927132.1| 50S ribosomal protein L7/L12 [Methylobacterium populi BJ001]
 gi|226733707|sp|B1ZGR9|RL7_METPB RecName: Full=50S ribosomal protein L7/L12
 gi|179347185|gb|ACB82597.1| ribosomal protein L7/L12 [Methylobacterium populi BJ001]
          Length = 126

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 96/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  A    +A +  E+TEF
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAGGGAAAPAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K  ++KDEA ++K +LE 
Sbjct: 61  TVVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKESVAKDEAEKLKAQLEK 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|283794932|ref|YP_003359285.1| ribosomal protein L12 [Cryptomonas paramecium]
 gi|253981904|gb|ACT46821.1| ribosomal protein L12 [Cryptomonas paramecium]
          Length = 129

 Score =  107 bits (267), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTEF 58
           + +  ++E+L SLTL+E AEL K++E  + VSA  P + +A ++A A      + EKTEF
Sbjct: 3   TKVNEVLEQLKSLTLVETAELIKQIETTFNVSACLPTNTIAAISAPATQKLQESEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            +VL+G     KKIA++K VR +T LGLKEAK+LVES PK++K  ++KDE    KK+LE+
Sbjct: 63  NLVLEGVP-ADKKIAILKVVRTLTGLGLKEAKDLVESTPKNIKENVTKDEVQAAKKQLEE 121

Query: 119 AGATVELR 126
           AGA V ++
Sbjct: 122 AGAKVTIK 129


>gi|298291426|ref|YP_003693365.1| ribosomal protein L7/L12 [Starkeya novella DSM 506]
 gi|296927937|gb|ADH88746.1| ribosomal protein L7/L12 [Starkeya novella DSM 506]
          Length = 127

 Score =  107 bits (266), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 100/129 (77%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M+++  +V++LS+LT++EAAEL+K LE++WGVSA+A V+V A   A  G+AA    E+TE
Sbjct: 1   MADLSKLVDELSNLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAAGGAAAPAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F VVL    D  KKI VIKEVRAIT LGLKEAK+LVE+APK +K G+SKDEA ++K ++E
Sbjct: 61  FTVVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEAAPKPIKEGVSKDEAEKIKAQVE 118

Query: 118 DAGATVELR 126
            AGA VEL+
Sbjct: 119 KAGAKVELK 127


>gi|319408382|emb|CBI82037.1| 50S ribosomal protein L7/L12 [Bartonella schoenbuchensis R1]
          Length = 123

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A     A  AA EKT+F+V
Sbjct: 1   MADLTKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGGGAA-PAAEEKTDFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D   +KI VIKEVRA+T LGLKEAK+LVE APKS+K G+SKDEA ++K +LE AG
Sbjct: 60  VL--VDGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKSIKEGVSKDEAEKIKTQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|114764155|ref|ZP_01443393.1| ribosomal protein L7/L12 [Pelagibaca bermudensis HTCC2601]
 gi|114543307|gb|EAU46323.1| ribosomal protein L7/L12 [Roseovarius sp. HTCC2601]
          Length = 126

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++++ E++  LTL+EA EL   L+ E+G+  +A   V +  P      +A  EKTEF
Sbjct: 1   MADLKALAEQIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGGEAAAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK   D  KKI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA E+KKKLE+
Sbjct: 61  DVILKSAGD--KKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEEIKKKLEE 118

Query: 119 AGATVELR 126
           AGA +EL+
Sbjct: 119 AGAEIELK 126


>gi|86137184|ref|ZP_01055762.1| ribosomal protein L7/L12 [Roseobacter sp. MED193]
 gi|85826508|gb|EAQ46705.1| ribosomal protein L7/L12 [Roseobacter sp. MED193]
          Length = 123

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 86/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E +  LTL+EA EL   L+ E+G+  +A  +VV       G AA EKTEF+V
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMATGDAGGEAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+SKDEA E+K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVSKDEAEEVKGKLEAAG 117

Query: 121 ATVEL 125
           A VE+
Sbjct: 118 AEVEV 122


>gi|182678329|ref|YP_001832475.1| 50S ribosomal protein L7/L12 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|226733642|sp|B2IK54|RL7_BEII9 RecName: Full=50S ribosomal protein L7/L12
 gi|182634212|gb|ACB94986.1| ribosomal protein L7/L12 [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 126

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +AA   E+TEF
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGGAAAAPVEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL    D  KKI VIKEVR +T LGLKEAK+LVE+APK +K G+SK+EA ++K  LE 
Sbjct: 61  TVVLAAVGD--KKIEVIKEVRGVTGLGLKEAKDLVEAAPKPVKEGVSKEEAEKIKAALEK 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|126732288|ref|ZP_01748088.1| ribosomal protein L7/L12 [Sagittula stellata E-37]
 gi|126707157|gb|EBA06223.1| ribosomal protein L7/L12 [Sagittula stellata E-37]
          Length = 126

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 93/128 (72%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++++ E++ +LTL+EA EL   L+ E+G+  +A   V +  P     G+A  EKTEF
Sbjct: 1   MADLKALAEQIVNLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGDAGGAAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK   D  KKI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA E+KKKLE+
Sbjct: 61  DVILKSAGD--KKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEELKKKLEE 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAEVEIK 126


>gi|150020401|ref|YP_001305755.1| 50S ribosomal protein L7/L12 [Thermosipho melanesiensis BI429]
 gi|166990991|sp|A6LKB9|RL7_THEM4 RecName: Full=50S ribosomal protein L7/L12
 gi|149792922|gb|ABR30370.1| ribosomal protein L7/L12 [Thermosipho melanesiensis BI429]
          Length = 129

 Score =  107 bits (266), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 75/132 (56%), Positives = 92/132 (69%), Gaps = 9/132 (6%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M  +E IV ++  LT+ E AEL K LE ++GVSASAPV +  PVA  A    +   EKTE
Sbjct: 1   MEKLEQIVNEIEQLTVAELAELVKMLEDKFGVSASAPV-MAMPVAGAAAGGGAAAEEKTE 59

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESA--PKS-LKTGLSKDEANEMKK 114
           F+VVLK F    KKI VIK VR IT LGLKEAK+LVE A  P + +K G++KDEA E+KK
Sbjct: 60  FDVVLKSFG--AKKINVIKVVREITGLGLKEAKDLVEKAGTPDAVIKQGVNKDEAEEIKK 117

Query: 115 KLEDAGATVELR 126
           KLE+AGA VEL+
Sbjct: 118 KLEEAGAEVELK 129


>gi|262277087|ref|ZP_06054880.1| ribosomal protein L7/L12 [alpha proteobacterium HIMB114]
 gi|262224190|gb|EEY74649.1| ribosomal protein L7/L12 [alpha proteobacterium HIMB114]
          Length = 123

 Score =  106 bits (264), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IV++LS+L+++EAAELSK LE +WGV+A+APV+  A  AA   + A EK EF V
Sbjct: 1   MADLNKIVDELSTLSVVEAAELSKLLEDKWGVTAAAPVAAAAAPAAGG-APAEEKDEFSV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D   KI VIKEVRA T LGLKEAK+LVE APK LK G++K +A E+KKK E AG
Sbjct: 60  VLSAAGD--NKIGVIKEVRAFTGLGLKEAKDLVEGAPKELKAGVNKKDAEEVKKKFEAAG 117

Query: 121 ATVELR 126
           A +EL+
Sbjct: 118 AKIELK 123


>gi|260469683|ref|ZP_05813845.1| ribosomal protein L7/L12 [Mesorhizobium opportunistum WSM2075]
 gi|259028542|gb|EEW29856.1| ribosomal protein L7/L12 [Mesorhizobium opportunistum WSM2075]
          Length = 125

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LS LT++EAAELSK LE++WGVSA+APV+V A   A A +A  E KTEF+
Sbjct: 1   MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAAPVEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE+APK +K G+SK +A++ K +LE A
Sbjct: 61  VVLT--DAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEGVSKADADKFKAQLEAA 118

Query: 120 GATVELR 126
           GA V+L+
Sbjct: 119 GAKVDLK 125


>gi|13470541|ref|NP_102109.1| 50S ribosomal protein L7/L12 [Mesorhizobium loti MAFF303099]
 gi|20978569|sp|Q98N67|RL7_RHILO RecName: Full=50S ribosomal protein L7/L12
 gi|14021282|dbj|BAB47895.1| 50S ribosomal protein L7/L12 [Mesorhizobium loti MAFF303099]
          Length = 125

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LS LT++EAAELSK LE++WGVSA+APV+V A   A A +A +E KTEF+
Sbjct: 1   MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAAPAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE+APK +K G+SK +A++ K +LE A
Sbjct: 61  VVLT--DAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEGVSKADADKFKAQLEAA 118

Query: 120 GATVELR 126
           GA V+L+
Sbjct: 119 GAKVDLK 125


>gi|295107383|emb|CBL04926.1| LSU ribosomal protein L12P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 125

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/122 (59%), Positives = 95/122 (77%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A   AE G+AA EKT+F+VVL+G
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAAAPAEGGAAAEEKTDFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KIAVIK VR IT LGLKEAKELVE APK ++ G++KD+A E+K KLE+AGA V 
Sbjct: 66  FGD--NKIAVIKVVREITSLGLKEAKELVEGAPKPIQEGVAKDKAEEIKAKLEEAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|332182023|gb|AEE17711.1| 50S ribosomal protein L7/L12 [Treponema brennaborense DSM 12168]
          Length = 126

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 65/121 (53%), Positives = 94/121 (77%), Gaps = 2/121 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++S+T++EA+EL K +E+++GV+A+APV +VA   A   +AA E+TEF V L+ 
Sbjct: 7   DQILDAIASMTVLEASELVKAMEEKFGVTAAAPV-MVAGAGAAPAAAAEEQTEFNVSLES 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKIAVIK VRA+T LGLKEAK+LVE APK LK G+SKDEA ++KK++E+AG  V+
Sbjct: 66  AD-ASKKIAVIKAVRAVTGLGLKEAKDLVEGAPKPLKEGVSKDEAAKIKKEVEEAGGVVK 124

Query: 125 L 125
           +
Sbjct: 125 I 125


>gi|121601836|ref|YP_988880.1| 50S ribosomal protein L7/L12 [Bartonella bacilliformis KC583]
 gi|166222137|sp|A1USC7|RL7_BARBK RecName: Full=50S ribosomal protein L7/L12
 gi|120614013|gb|ABM44614.1| ribosomal protein L7/L12 [Bartonella bacilliformis KC583]
          Length = 123

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A  +A A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGSAAA-PAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G+SKDEA ++K +LE AG
Sbjct: 60  VL--VDGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGVSKDEAEKIKAQLEAAG 117

Query: 121 ATVELR 126
           A +EL+
Sbjct: 118 AKIELK 123


>gi|254456000|ref|ZP_05069429.1| ribosomal protein L7/L12 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083002|gb|EDZ60428.1| ribosomal protein L7/L12 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 121

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 92/126 (73%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M ++  I+E LSSLT+ EAAELSK+LE++WGV+   P++  AP AA   + A +K +F +
Sbjct: 1   MPDLNKIIEDLSSLTVAEAAELSKQLEEKWGVT---PMAAAAPAAAGGAAPAEDKDDFTI 57

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L      +KKI VIKEVRA T LGLKEAK+LVE APK +K+G++K EA E+K KLE AG
Sbjct: 58  ML--VSAGEKKINVIKEVRAATSLGLKEAKDLVEGAPKEVKSGVNKKEAEEIKAKLEAAG 115

Query: 121 ATVELR 126
           A VEL+
Sbjct: 116 AKVELK 121


>gi|307243165|ref|ZP_07525338.1| ribosomal protein L7/L12 [Peptostreptococcus stomatis DSM 17678]
 gi|306493426|gb|EFM65406.1| ribosomal protein L7/L12 [Peptostreptococcus stomatis DSM 17678]
          Length = 122

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 92/124 (74%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E + ++ ++E  EL K  E+++GVSASAPV +VA  A  A +   EK+EF+V+L
Sbjct: 2   TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPV-MVAGAAGGAAAGGEEKSEFDVIL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                 K  + VIKEVRAIT LGLKEAKE+V++APKS+K G+SK+EA ++K+KLE AGAT
Sbjct: 61  ASAGSSK--VGVIKEVRAITGLGLKEAKEVVDNAPKSVKEGVSKEEAEQIKEKLEAAGAT 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|189345744|ref|YP_001942273.1| 50S ribosomal protein L7/L12 [Chlorobium limicola DSM 245]
 gi|226733657|sp|B3EER1|RL7_CHLL2 RecName: Full=50S ribosomal protein L7/L12
 gi|189339891|gb|ACD89294.1| ribosomal protein L7/L12 [Chlorobium limicola DSM 245]
          Length = 125

 Score =  104 bits (260), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
           +IE++VE++  LTL EA+EL K LE+++GVSA+  +      AA AG A +  EKTEF+V
Sbjct: 2   SIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAIVAGIASAAPAGDAPAQEEKTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    +   KI VIK VRA+T LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+D G
Sbjct: 62  VLTSAGE--SKINVIKVVRALTGLGLKEAKDLVDGAPKTVKEAVSKDEAEKIAKELKDVG 119

Query: 121 ATVELR 126
           A VEL+
Sbjct: 120 AGVELK 125


>gi|15889251|ref|NP_354932.1| 50S ribosomal protein L7/L12 [Agrobacterium tumefaciens str. C58]
 gi|24212246|sp|Q8UE07|RL7_AGRT5 RecName: Full=50S ribosomal protein L7/L12
 gi|15157081|gb|AAK87717.1| 50S ribosomal protein L7/L12 [Agrobacterium tumefaciens str. C58]
          Length = 125

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A A +A  E KTEF+
Sbjct: 1   MADLAKIVEDLSTLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAGAAAAVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VVL--VDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|289422421|ref|ZP_06424264.1| ribosomal protein L7/L12 [Peptostreptococcus anaerobius 653-L]
 gi|289156993|gb|EFD05615.1| ribosomal protein L7/L12 [Peptostreptococcus anaerobius 653-L]
          Length = 121

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E + ++ ++E  EL K  E+++GVSASAPV V    A    +A  EKTEF+V+L
Sbjct: 2   TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVAGGAAGG--AAGEEKTEFDVIL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                 K  + VIKEVRAIT LGLKEAKE+V++APK++K G+SK+EA ++K+KLE AGAT
Sbjct: 60  ASAGSSK--VGVIKEVRAITGLGLKEAKEVVDNAPKAVKEGVSKEEAEQIKEKLEAAGAT 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|319783307|ref|YP_004142783.1| ribosomal protein L7/L12 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169195|gb|ADV12733.1| ribosomal protein L7/L12 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 125

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LS LT++EAAELSK LE++WGVSA+APV+V A   A A +A +E KTEF+
Sbjct: 1   MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAAPAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE+APK +K  +SK +A++ K +LE A
Sbjct: 61  VVLT--DAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEAVSKADADKFKAQLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|319654858|ref|ZP_08008933.1| 50S ribosomal protein L7/L12 [Bacillus sp. 2_A_57_CT2]
 gi|317393421|gb|EFV74184.1| 50S ribosomal protein L7/L12 [Bacillus sp. 2_A_57_CT2]
          Length = 121

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 92/122 (75%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  +L K +E+E+GV+A+APV+V+    A  G AA+EKTEF+VVL  
Sbjct: 4   EQIIEAVKNMTVLELNDLVKAIEEEFGVTAAAPVAVMG--GAAGGDAAAEKTEFDVVLAS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +KI VIK VR IT LGLKEAKELV++ PK+LK G+SK+EA E+K KLE+ GA VE
Sbjct: 62  AGD--QKIKVIKVVREITGLGLKEAKELVDNTPKALKEGVSKEEAEEVKAKLEEVGAGVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|67924345|ref|ZP_00517777.1| Ribosomal protein L7/L12 [Crocosphaera watsonii WH 8501]
 gi|67853801|gb|EAM49128.1| Ribosomal protein L7/L12 [Crocosphaera watsonii WH 8501]
          Length = 133

 Score =  104 bits (259), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 90/129 (69%), Gaps = 8/129 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-------VSVVAPVAAEAGSAASEKTE 57
           + I+EKL SLTL+EA+EL K++E+ +GVSASAP           A     A  A  EKTE
Sbjct: 6   DEILEKLKSLTLLEASELVKQIEEAFGVSASAPSGGMMMMAPGGAAPGGAAAEAEEEKTE 65

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+      KKIA++K VRAIT LGLKEAK++VESAPK +K G  KD+A E+KKKLE
Sbjct: 66  FDVVLEEVPG-DKKIAILKVVRAITGLGLKEAKDMVESAPKPIKEGTGKDDAEEIKKKLE 124

Query: 118 DAGATVELR 126
           +AGA V ++
Sbjct: 125 EAGAKVSVK 133


>gi|299135269|ref|ZP_07028460.1| ribosomal protein L7/L12 [Afipia sp. 1NLS2]
 gi|298590246|gb|EFI50450.1| ribosomal protein L7/L12 [Afipia sp. 1NLS2]
          Length = 125

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A  G+AA+E KTEF+
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGGAAAAEEKTEFQ 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK LK G++KDEA ++K  LE  
Sbjct: 61  VVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVAKDEAEKIKATLEKV 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|296315355|ref|ZP_06865296.1| ribosomal protein L7/L12 [Neisseria polysaccharea ATCC 43768]
 gi|296837684|gb|EFH21622.1| ribosomal protein L7/L12 [Neisseria polysaccharea ATCC 43768]
          Length = 122

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 90/122 (73%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++GVSA+A V+V   V   A  AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKFGVSAAA-VAVTGSVGPAA--AAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 63  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|291334052|gb|ADD93725.1| ribosomal protein L7/L12 [uncultured marine bacterium
           MedDCM-OCT-S05-C114]
          Length = 130

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/132 (57%), Positives = 93/132 (70%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----E 54
           MS+I  + +VE LSS ++IE A+L K LE++WGVSA+AP +V     A  G A      E
Sbjct: 1   MSDITKDQVVEWLSSQSVIEVADLVKELEEKWGVSAAAPAAVAVAAPAGGGDAGGAAAEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           K+EF+VVL  F     KIAVIKEVRAIT LGLKEAKELVE APK +K G+SKDEA E+ K
Sbjct: 61  KSEFDVVLTEFGG--NKIAVIKEVRAITGLGLKEAKELVEGAPKPVKEGVSKDEAEEISK 118

Query: 115 KLEDAGATVELR 126
           KLE AGA  E++
Sbjct: 119 KLEAAGAKAEIK 130


>gi|114704475|ref|ZP_01437383.1| 50S ribosomal protein L7/L12 [Fulvimarina pelagi HTCC2506]
 gi|114539260|gb|EAU42380.1| 50S ribosomal protein L7/L12 [Fulvimarina pelagi HTCC2506]
          Length = 126

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS--APVSVVAPVAAEAGSAASEKTEF 58
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+    V+  A  A  A  A  E+TEF
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAGAAGAAGGAAEAEEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL   +    KI VIKEVR +T LGLKEAK+LV++APK +K G+ KDEAN++K++LE 
Sbjct: 61  TVVLA--EAGSSKINVIKEVRGLTGLGLKEAKDLVDNAPKPIKEGVDKDEANKIKEQLEK 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|325293347|ref|YP_004279211.1| 50S ribosomal protein L7/L12 [Agrobacterium sp. H13-3]
 gi|325061200|gb|ADY64891.1| 50S ribosomal protein L7/L12 [Agrobacterium sp. H13-3]
          Length = 125

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A A +   E KTEF+
Sbjct: 1   MADLAKIVEDLSTLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAGAAAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VIL--VDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|85706809|ref|ZP_01037900.1| ribosomal protein L7/L12 [Roseovarius sp. 217]
 gi|85668602|gb|EAQ23472.1| ribosomal protein L7/L12 [Roseovarius sp. 217]
          Length = 126

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 61/128 (47%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL   L+ E+G+  +A   V +  P     GS A E+TEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGDAGGSDAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       KI VIKEVRAIT LGLKEAK+LV++  K++K  +SKDEA+++K KLE 
Sbjct: 61  DVILKSA--GASKINVIKEVRAITGLGLKEAKDLVDAGGKAVKEQVSKDEADDIKAKLEA 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAEVEIK 126


>gi|315499737|ref|YP_004088540.1| ribosomal protein l7/l12 [Asticcacaulis excentricus CB 48]
 gi|315417749|gb|ADU14389.1| ribosomal protein L7/L12 [Asticcacaulis excentricus CB 48]
          Length = 128

 Score =  103 bits (258), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 74/130 (56%), Positives = 96/130 (73%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           MS +E +V  LS+LT++EAAELSK LE +WGVSA+APV+V A     A + A    E+TE
Sbjct: 1   MSKLEQLVADLSALTVLEAAELSKLLEDKWGVSAAAPVAVAAVAGGAAAAPAEAVEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F VVL   D   KKI VIKE+R I ++LGLKEAK+LVE AP+++K  +SK EA ++KKKL
Sbjct: 61  FTVVL--VDGGDKKINVIKEIRGIRSELGLKEAKDLVEGAPQTVKENVSKQEAADIKKKL 118

Query: 117 EDAGATVELR 126
           EDAGA VE++
Sbjct: 119 EDAGAKVEVK 128


>gi|260425427|ref|ZP_05779407.1| ribosomal protein L7/L12 [Citreicella sp. SE45]
 gi|260423367|gb|EEX16617.1| ribosomal protein L7/L12 [Citreicella sp. SE45]
          Length = 126

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++++ E++  LTL+EA EL   L+ E+G+  +A   V +  P A    +A  EKTEF
Sbjct: 1   MADLKALAEQIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAAGGEAAAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK   D  KKI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA  +KK+LE+
Sbjct: 61  DVILKSAGD--KKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEAIKKQLEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|224178075|ref|YP_002600904.1| ribosomal protein L12 [Pyramimonas parkeae]
 gi|215882742|gb|ACJ71115.1| ribosomal protein L12 [Pyramimonas parkeae]
          Length = 130

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 5/129 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTE 57
           +  ++I+E+L S+TL+EAAEL  ++E+ +GV ASAPV     +AA  G+A+     EKTE
Sbjct: 3   TTTDAIIEQLKSITLLEAAELVSQIEETFGVDASAPVGGGMMMAAAPGAASGAAEEEKTE 62

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L+      K+IAVIK VRA+T LGLKEAK L+ES PK +K G+SKD+A + KK+LE
Sbjct: 63  FDVILEEVPS-DKRIAVIKAVRALTSLGLKEAKSLIESTPKPIKEGVSKDDAEDAKKQLE 121

Query: 118 DAGATVELR 126
           +AG  V ++
Sbjct: 122 EAGGKVSIK 130


>gi|114798365|ref|YP_761537.1| 50S ribosomal protein L7/L12 [Hyphomonas neptunium ATCC 15444]
 gi|123027738|sp|Q0BYA6|RL7_HYPNA RecName: Full=50S ribosomal protein L7/L12
 gi|114738539|gb|ABI76664.1| ribosomal protein L7/L12 [Hyphomonas neptunium ATCC 15444]
          Length = 125

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MANLEKIVEDLSALTVLEAAELAKMLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITD-LGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VL   +   KKI VIK VR +   LGLKEAK+LVE APK++K  +SK +A E+KKK E A
Sbjct: 61  VLT--EAGAKKIEVIKLVREVVPALGLKEAKDLVEGAPKTVKEAVSKADAEELKKKFEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|49474308|ref|YP_032350.1| 50S ribosomal protein L7/L12 [Bartonella quintana str. Toulouse]
 gi|81647015|sp|Q6FZL8|RL7_BARQU RecName: Full=50S ribosomal protein L7/L12
 gi|49239812|emb|CAF26203.1| 50s ribosomal protein l7 /l12 [Bartonella quintana str. Toulouse]
          Length = 123

 Score =  103 bits (258), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LTL+EAAELSK LE++WGVSA+APV+V     A A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTLLEAAELSKLLEEKWGVSAAAPVAVATVAGAAA-PAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SKDEA ++K +LE AG
Sbjct: 60  IL--VDCGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKDEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VE +
Sbjct: 118 AKVEFK 123


>gi|227821747|ref|YP_002825717.1| 50S ribosomal protein L7/L12 [Sinorhizobium fredii NGR234]
 gi|254806390|sp|C3MAX1|RL7_RHISN RecName: Full=50S ribosomal protein L7/L12
 gi|227340746|gb|ACP24964.1| ribosomal protein L7/L12 [Sinorhizobium fredii NGR234]
          Length = 127

 Score =  103 bits (258), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 101/129 (78%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A  G+AA+   EKTE
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAGGAAAAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLE
Sbjct: 61  FDVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLE 118

Query: 118 DAGATVELR 126
           DAGA V+++
Sbjct: 119 DAGAKVDVK 127


>gi|257792071|ref|YP_003182677.1| 50S ribosomal protein L7/L12 [Eggerthella lenta DSM 2243]
 gi|257475968|gb|ACV56288.1| ribosomal protein L7/L12 [Eggerthella lenta DSM 2243]
          Length = 125

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 95/122 (77%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A   AE G+AA EKTEF+VVL+G
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAAAPAEGGAAAEEKTEFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KIAVIK VR IT LGLKEAKELVE APK ++ G++K++A E+K KLE+AGA V 
Sbjct: 66  FGD--NKIAVIKVVREITSLGLKEAKELVEGAPKPIQEGVNKEKAEEIKAKLEEAGAAVT 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|115378456|ref|ZP_01465615.1| ribosomal protein L7/L12 [Stigmatella aurantiaca DW4/3-1]
 gi|310822261|ref|YP_003954619.1| 50S ribosomal protein L7/l12 [Stigmatella aurantiaca DW4/3-1]
 gi|115364518|gb|EAU63594.1| ribosomal protein L7/L12 [Stigmatella aurantiaca DW4/3-1]
 gi|309395333|gb|ADO72792.1| 50S ribosomal protein L7/L12 [Stigmatella aurantiaca DW4/3-1]
          Length = 125

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  I E+LS+LT++EA EL K LE +WGVSA+A      P A  A +A  E KTEF 
Sbjct: 1   MADLNKIAEELSTLTVLEAGELVKLLENKWGVSAAAVAVAAGPAAGAAAAAPVEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   +    KI VIKE+RAIT LGLKEAK+LVE APK++K G+SKD+A + K +L  A
Sbjct: 61  VVLA--NAGANKINVIKEIRAITGLGLKEAKDLVEGAPKNVKEGVSKDDAKKFKDQLTAA 118

Query: 120 GATVELR 126
           GATVE++
Sbjct: 119 GATVEVK 125


>gi|91200659|emb|CAJ73709.1| strongly similar to 50S ribosomal protein L7/L12 [Candidatus
           Kuenenia stuttgartiensis]
          Length = 138

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 92/129 (71%), Gaps = 8/129 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA----PVSVVAPVAAEAGSAASEKTE 57
             I  +++ +S +TL+EA+EL K  EK++GVSASA    PV +  P+A    +   EKT 
Sbjct: 14  GKIAQVLDIVSGMTLLEASELVKAFEKKFGVSASAVAAMPVGM--PMAGAGAAVEEEKTS 71

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK  +    KI VIK VRA T+LGLKEAK+LVE APK++K G++K++A++++K LE
Sbjct: 72  FDVILK--EVGANKIQVIKAVRAETNLGLKEAKDLVEGAPKAVKEGVTKEDADKIRKTLE 129

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 130 EAGAKVEIK 138


>gi|149203669|ref|ZP_01880638.1| ribosomal protein L7/L12 [Roseovarius sp. TM1035]
 gi|149142786|gb|EDM30828.1| ribosomal protein L7/L12 [Roseovarius sp. TM1035]
          Length = 126

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL   L+ E+G+  +A   + +  P     GS A E+TEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAIMMAGPAGDAGGSDAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       KI VIKEVRAIT LGLKEAK+LV++  K++K  +SKDEA+++K KLE 
Sbjct: 61  DVILKSA--GASKINVIKEVRAITGLGLKEAKDLVDAGGKAVKEQVSKDEADDIKAKLEA 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAEVEIK 126


>gi|329850782|ref|ZP_08265627.1| ribosomal protein L7/L12 [Asticcacaulis biprosthecum C19]
 gi|328841097|gb|EGF90668.1| ribosomal protein L7/L12 [Asticcacaulis biprosthecum C19]
          Length = 126

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 76/128 (59%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-AASEKTEFE 59
           MS +E +VE LS+L+++EAAELSK LE +WGVSA+APV+V A     A   A  E+TEF 
Sbjct: 1   MSKLEKLVEDLSALSVLEAAELSKLLEDKWGVSAAAPVAVAAVGGPAAPVEAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           VVL   D   KKI VIKE+R+I TDLGLKEAK+LVE AP+++K  +SK EA ++KKKLED
Sbjct: 61  VVL--TDGGDKKINVIKEIRSIRTDLGLKEAKDLVEGAPQNVKENISKQEAADIKKKLED 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAKVEVK 126


>gi|240850291|ref|YP_002971684.1| 50S ribosomal protein L7/L12 [Bartonella grahamii as4aup]
 gi|240267414|gb|ACS51002.1| 50S ribosomal protein L7/L12 [Bartonella grahamii as4aup]
          Length = 123

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++E IVE LS+LTL+EAAELSK LE++WGVSA+APV+V A   A A  AA EKTEF+V
Sbjct: 1   MADLEKIVEDLSNLTLLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAA-PAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 60  IL--VEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|108796926|ref|YP_636226.1| ribosomal protein L12 [Pseudendoclonium akinetum]
 gi|122245932|sp|Q3ZJ41|RK12_PSEAK RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|56159624|gb|AAV80648.1| ribosomal protein L12 [Pseudendoclonium akinetum]
          Length = 129

 Score =  103 bits (257), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 89/129 (68%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---VVAPVAAEAGS-AASEKT 56
           M+ +E I+++L +LTLIE++EL K++E+ +GV ASAPV    ++AP    AG     EKT
Sbjct: 1   MTTVEQIIDQLKTLTLIESSELVKQIEETFGVDASAPVGGAIMMAPGQESAGQEVVEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+V++K      K+++V+K +R +T LGL EAKE   S PK+LK G+SK+EA E KK L
Sbjct: 61  TFDVIVKDIAS-DKRVSVLKVIRKLTSLGLAEAKEFTVSLPKALKEGISKEEAAEAKKDL 119

Query: 117 EDAGATVEL 125
           E AGA V++
Sbjct: 120 ELAGAVVDI 128


>gi|158336009|ref|YP_001517183.1| 50S ribosomal protein L7/L12 [Acaryochloris marina MBIC11017]
 gi|189042978|sp|B0CAD2|RL7_ACAM1 RecName: Full=50S ribosomal protein L7/L12
 gi|158306250|gb|ABW27867.1| 50S ribosomal protein L7/L12 [Acaryochloris marina MBIC11017]
          Length = 129

 Score =  103 bits (256), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 89/130 (68%), Gaps = 5/130 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV----APVAAEAGSAASEKT 56
           MS  E I+EKL SLTL+EAA+L K++E+ +GVSA+    V+        A  G  A EKT
Sbjct: 1   MSATEEILEKLKSLTLLEAADLVKQIEETFGVSAAPAAGVMMAAPGAGGAAGGEEAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VVL+      KKIAV+K VR +T LGLKEAKE+VES PKS+K G+SK++A E KK L
Sbjct: 61  EFDVVLEEVPS-DKKIAVLKVVRTLTGLGLKEAKEMVESTPKSIKEGVSKEDAEEAKKSL 119

Query: 117 EDAGATVELR 126
           EDAG    L+
Sbjct: 120 EDAGGKASLK 129


>gi|158319534|ref|YP_001512041.1| ribosomal protein L7/L12 [Alkaliphilus oremlandii OhILAs]
 gi|166990980|sp|A8MLD1|RL7_ALKOO RecName: Full=50S ribosomal protein L7/L12
 gi|158139733|gb|ABW18045.1| ribosomal protein L7/L12 [Alkaliphilus oremlandii OhILAs]
          Length = 121

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E + ++ ++E  EL K  E+++GVSASAPV V  PVA  A     E+TEF+VVL
Sbjct: 2   TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVVVGGPVAGAA--VEEEQTEFDVVL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  +    KI VIK VR +T LGLKEAKE V+ APK+LK G+SK+EA ++K KLE+AGA 
Sbjct: 60  E--NAGASKINVIKVVRELTGLGLKEAKEAVDGAPKTLKEGVSKEEAEQIKAKLEEAGAA 117

Query: 123 VELR 126
           V ++
Sbjct: 118 VTVK 121


>gi|268316667|ref|YP_003290386.1| 50S ribosomal protein L7/L12 [Rhodothermus marinus DSM 4252]
 gi|262334201|gb|ACY47998.1| ribosomal protein L7/L12 [Rhodothermus marinus DSM 4252]
          Length = 126

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 69/128 (53%), Positives = 95/128 (74%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++++++ E+L +LT+ EA EL+K LE+E+G+  +A    VA   A    AA+  EKTEF
Sbjct: 1   MADLKALAEQLVNLTIKEANELAKILEEEYGIKPAAAAVAVAAGPAGGDGAAAAEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       KIAVIKEVRAIT LGLKEAKELV+SAPK +K G+SK+EA ++K KLE+
Sbjct: 61  DVILKAAGG--NKIAVIKEVRAITGLGLKEAKELVDSAPKPIKEGVSKEEAEQIKAKLEE 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAEVEIK 126


>gi|258513631|ref|YP_003189853.1| 50S ribosomal protein L7/L12 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777336|gb|ACV61230.1| ribosomal protein L7/L12 [Desulfotomaculum acetoxidans DSM 771]
          Length = 126

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA--ASEKTEF 58
           MS I  I+E +  LT++E +EL K  E+E+GV+A+APV V+A   A   +A    E+TEF
Sbjct: 1   MSKINEILEAVKGLTVLELSELVKAFEEEFGVTAAAPVGVMAAAPAAGAAAAEVEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L    D  KKI VIK VR IT LGLKEAKE+V++APK +K  +SK+EA  MK KL +
Sbjct: 61  DVILTSVGD--KKINVIKVVREITGLGLKEAKEVVDNAPKPIKEKVSKEEAESMKAKLVE 118

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 119 AGASVEIK 126


>gi|71083811|ref|YP_266531.1| 50S ribosomal protein L31 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763153|ref|ZP_01265117.1| probable 50S ribosomal protein L31 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|109893780|sp|Q4FLL1|RL7_PELUB RecName: Full=50S ribosomal protein L7/L12
 gi|71062924|gb|AAZ21927.1| probable 50S ribosomal protein L31 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717566|gb|EAS84217.1| probable 50S ribosomal protein L31 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 121

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 89/126 (70%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M ++  I+E LSSLT++EAAELSK+LE++WGV+A A  +  A       +A   K +F +
Sbjct: 1   MPDLNKIIEDLSSLTVVEAAELSKQLEEKWGVTAMAAAAPAAAAGG---AAEEAKDDFTI 57

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L    D  KKI VIKEVRA T LGLKEAK+LVE APK +K+G++K +A E+K KLE AG
Sbjct: 58  MLISAGD--KKINVIKEVRAATSLGLKEAKDLVEGAPKEVKSGVNKKDAEEIKAKLEAAG 115

Query: 121 ATVELR 126
           A VEL+
Sbjct: 116 AKVELK 121


>gi|163853414|ref|YP_001641457.1| 50S ribosomal protein L7/L12 [Methylobacterium extorquens PA1]
 gi|218532273|ref|YP_002423089.1| 50S ribosomal protein L7/L12 [Methylobacterium chloromethanicum
           CM4]
 gi|240140834|ref|YP_002965314.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           AM1]
 gi|254563343|ref|YP_003070438.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           DM4]
 gi|226733706|sp|A9W8N7|RL7_METEP RecName: Full=50S ribosomal protein L7/L12
 gi|254806382|sp|B7KN44|RL7_METC4 RecName: Full=50S ribosomal protein L7/L12
 gi|163665019|gb|ABY32386.1| ribosomal protein L7/L12 [Methylobacterium extorquens PA1]
 gi|218524576|gb|ACK85161.1| ribosomal protein L7/L12 [Methylobacterium chloromethanicum CM4]
 gi|240010811|gb|ACS42037.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           AM1]
 gi|254270621|emb|CAX26624.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           DM4]
          Length = 125

 Score =  102 bits (255), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/127 (62%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA AG+AA E +TEF 
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGAGAAAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G +KDEA ++K +LE A
Sbjct: 61  VVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGATKDEAEKLKAQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|149185493|ref|ZP_01863809.1| ribosomal protein L7/L12 [Erythrobacter sp. SD-21]
 gi|148830713|gb|EDL49148.1| ribosomal protein L7/L12 [Erythrobacter sp. SD-21]
          Length = 125

 Score =  102 bits (254), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I  +VE+LS LT++EAAEL+K LE+EWGVSA+A V+V  P    AG AA+E K EF+
Sbjct: 1   MADIAKLVEELSKLTVMEAAELAKALEEEWGVSAAAAVAVAGPAGGGAGEAAAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G++K EA E+K K+E A
Sbjct: 61  VVLTG--DGGKKIQVIKEVRAITGLGLTEAKALVEGAPKAIKEGVNKAEAEEIKGKIEAA 118

Query: 120 GATVELR 126
           G TVEL+
Sbjct: 119 GGTVELK 125


>gi|49475397|ref|YP_033438.1| 50S ribosomal protein L7/L12 [Bartonella henselae str. Houston-1]
 gi|81648027|sp|Q6G3X6|RL7_BARHE RecName: Full=50S ribosomal protein L7/L12
 gi|49238203|emb|CAF27413.1| 50S ribosomal protein l7 /l12 [Bartonella henselae str. Houston-1]
          Length = 123

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 97/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A A   A EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAA-PVAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SKDEA ++K +LE AG
Sbjct: 60  IL--VEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKDEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|319405857|emb|CBI79489.1| 50S ribosomal protein L7/L12 [Bartonella sp. AR 15-3]
          Length = 122

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W    SA   V       A  A  EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW--GVSAAAPVAVAAVGTAAPAVEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE  PK +K G SKDEA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGVPKPIKEGASKDEAEKIKAQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|317488688|ref|ZP_07947227.1| ribosomal protein L7/L12 [Eggerthella sp. 1_3_56FAA]
 gi|325831654|ref|ZP_08164871.1| ribosomal protein L7/L12 [Eggerthella sp. HGA1]
 gi|316912204|gb|EFV33774.1| ribosomal protein L7/L12 [Eggerthella sp. 1_3_56FAA]
 gi|325486525|gb|EGC88974.1| ribosomal protein L7/L12 [Eggerthella sp. HGA1]
          Length = 125

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 95/122 (77%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A   AE G+AA EKT+F+VVL+G
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAAAPAEGGAAAEEKTDFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KIAVIK VR IT LGLKEAKE VE APK+++ G++K++A E+K KLE+AGA V 
Sbjct: 66  FGD--NKIAVIKVVREITGLGLKEAKEAVEGAPKAIQEGVNKEKAEEIKAKLEEAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|193213523|ref|YP_001999476.1| 50S ribosomal protein L7/L12 [Chlorobaculum parvum NCIB 8327]
 gi|226733658|sp|B3QQS3|RL7_CHLP8 RecName: Full=50S ribosomal protein L7/L12
 gi|193087000|gb|ACF12276.1| ribosomal protein L7/L12 [Chlorobaculum parvum NCIB 8327]
          Length = 126

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 93/129 (72%), Gaps = 6/129 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           MS+IE++VE++  LTL EA+EL K LE+++GVSA AP  V   +AA     A+    KTE
Sbjct: 1   MSSIETLVEEIGKLTLTEASELVKALEEKFGVSA-APAVVAGGMAAAPAGEAAAAEEKTE 59

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVLK      +KI VIK VRAIT LGLKEAKE+V+ APK++K  +SKDEA ++ K+L+
Sbjct: 60  FDVVLKAAG--AQKINVIKVVRAITGLGLKEAKEMVDGAPKTVKEAVSKDEAEKIAKELK 117

Query: 118 DAGATVELR 126
           DAGA VEL 
Sbjct: 118 DAGAEVELN 126


>gi|158422510|ref|YP_001523802.1| 50S ribosomal protein L7/L12 [Azorhizobium caulinodans ORS 571]
 gi|172047837|sp|A8HTY4|RL7_AZOC5 RecName: Full=50S ribosomal protein L7/L12
 gi|158329399|dbj|BAF86884.1| ribosomal protein L7/L12 [Azorhizobium caulinodans ORS 571]
          Length = 125

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 76/127 (59%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  +V++LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +AA E +TEF 
Sbjct: 1   MADLTKLVDELSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPAAGGAAAAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLANAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKLKAQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|11467764|ref|NP_050815.1| ribosomal protein L12 [Nephroselmis olivacea]
 gi|14195158|sp|Q9TL30|RK12_NEPOL RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|5880693|gb|AAD54786.1|AF137379_9 ribosomal protein L12 [Nephroselmis olivacea]
          Length = 128

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 96/130 (73%), Gaps = 6/130 (4%)

Query: 1   MSNI-ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTE 57
           MS I   I+E+L S+TL+EAAEL  ++E+ +GV ASAP +    VAA A SA    E+TE
Sbjct: 1   MSTITNQIIEQLKSMTLLEAAELVSQIEETFGVDASAPAAGAVMVAAAAPSAPVVEEQTE 60

Query: 58  FEVVLKGFDDPK-KKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V++   D P  K+IAVIK VRA+T LGLKEAK+++ES PK++K G+ KDEA ++K++L
Sbjct: 61  FTVMIN--DVPSAKRIAVIKVVRALTGLGLKEAKDMIESVPKAIKEGIGKDEAQQIKQQL 118

Query: 117 EDAGATVELR 126
           E+AGATV ++
Sbjct: 119 EEAGATVTVK 128


>gi|307691685|ref|ZP_07633922.1| 50S ribosomal protein L12P [Ruminococcaceae bacterium D16]
          Length = 125

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 89/124 (71%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I +++E++  LT++E +EL   LE+E+GVSA+A  +  A  AA    AA EKTEF+V+L
Sbjct: 5   KITALIEEVKGLTVLELSELVHALEEEFGVSAAAMAAPAAGGAAA--PAAEEKTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GFD    KI VIK VR IT LGL EAK +VE  PK+LK G+SKDEA E+KKKLE+AGA 
Sbjct: 63  AGFD-AAAKIKVIKAVREITGLGLAEAKGMVEGTPKALKEGVSKDEAEELKKKLEEAGAK 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|222085667|ref|YP_002544197.1| ribosomal protein L7/L12 [Agrobacterium radiobacter K84]
 gi|254806252|sp|B9JDS0|RL7_AGRRK RecName: Full=50S ribosomal protein L7/L12
 gi|221723115|gb|ACM26271.1| ribosomal protein L7/L12 [Agrobacterium radiobacter K84]
          Length = 125

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +   E KTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGGAVAAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIKEVRAIT LGLKEAK+LVE+APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VILT--DAGANKINVIKEVRAITGLGLKEAKDLVEAAPKAVKEAVSKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|116251531|ref|YP_767369.1| 50S ribosomal protein L7/L12 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241204156|ref|YP_002975252.1| 50S ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|123261677|sp|Q1MIF0|RL7_RHIL3 RecName: Full=50S ribosomal protein L7/L12
 gi|115256179|emb|CAK07260.1| putative 50S ribosomal protein L7/L12 (L8) [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|240858046|gb|ACS55713.1| ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 125

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A     A +   E KTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAGGAAAAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVRAIT LGLKEAK+LVE+APK++K G++K EA ++KKKLEDA
Sbjct: 61  VIL--VEAGANKINVIKEVRAITGLGLKEAKDLVEAAPKAVKEGVNKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|108762798|ref|YP_631279.1| 50S ribosomal protein L7/L12 [Myxococcus xanthus DK 1622]
 gi|123247806|sp|Q1D7U4|RL7_MYXXD RecName: Full=50S ribosomal protein L7/L12
 gi|108466678|gb|ABF91863.1| ribosomal protein L7/L12 [Myxococcus xanthus DK 1622]
          Length = 122

 Score =  101 bits (251), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ +IV++LSSLT++EAAEL K+LE +W    SA    VA   A A +   EKTEF V
Sbjct: 1   MADLNAIVDQLSSLTVLEAAELVKQLESKW--GVSAAAVAVAAGPAAAAAPVEEKTEFTV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +    KI VIKE+RAIT LGLKEAK+LVE APK++K G++KD+A ++K +L  AG
Sbjct: 59  VLA--NAGANKINVIKEIRAITGLGLKEAKDLVEGAPKNVKEGVNKDDAKKIKDQLTAAG 116

Query: 121 ATVELR 126
           ATV+++
Sbjct: 117 ATVDIK 122


>gi|319407384|emb|CBI81035.1| 50S ribosomal protein L7/L12 [Bartonella sp. 1-1C]
          Length = 122

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W    SA   V          AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW--GVSAAAPVAVAAVGAVAPAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKAQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|319404383|emb|CBI77986.1| 50S ribosomal protein L7/L12 [Bartonella rochalimae ATCC BAA-1498]
          Length = 122

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/126 (55%), Positives = 89/126 (70%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W    SA   V       A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW--GVSAAAPVAVAAVGAAAPAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKAQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|254485901|ref|ZP_05099106.1| ribosomal protein L7/L12 [Roseobacter sp. GAI101]
 gi|214042770|gb|EEB83408.1| ribosomal protein L7/L12 [Roseobacter sp. GAI101]
          Length = 123

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+AG++A EKTEF+V
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGASAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEEVKAKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|317133012|ref|YP_004092326.1| ribosomal protein L7/L12 [Ethanoligenens harbinense YUAN-3]
 gi|315470991|gb|ADU27595.1| ribosomal protein L7/L12 [Ethanoligenens harbinense YUAN-3]
          Length = 126

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 73/124 (58%), Positives = 93/124 (75%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            +  ++E + +LT++E +EL K LE+E+GVSA+APV+V A  AA A  AA EKTEF+VVL
Sbjct: 5   KVTKLIEDVKALTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGAAPAAEEKTEFDVVL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIK VR IT LGLK+AKELVESAPK++K  + KDEA E+KKK+EDAGA 
Sbjct: 65  T--DIGGSKIGVIKVVREITGLGLKDAKELVESAPKAIKEKVGKDEAEELKKKIEDAGAK 122

Query: 123 VELR 126
           VEL+
Sbjct: 123 VELK 126


>gi|163868088|ref|YP_001609292.1| 50S ribosomal protein L7/L12 [Bartonella tribocorum CIP 105476]
 gi|189042981|sp|A9ISF8|RL7_BART1 RecName: Full=50S ribosomal protein L7/L12
 gi|161017739|emb|CAK01297.1| 50S ribosomal protein L7/L12 [Bartonella tribocorum CIP 105476]
          Length = 123

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 98/126 (77%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LTL+EAAELSK LE++WGVSA+APV+V A   A A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTLLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAA-PAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 60  IL--VEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|282899207|ref|ZP_06307181.1| Ribosomal protein L7/L12 [Cylindrospermopsis raciborskii CS-505]
 gi|281195890|gb|EFA70813.1| Ribosomal protein L7/L12 [Cylindrospermopsis raciborskii CS-505]
          Length = 130

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 94/127 (74%), Gaps = 7/127 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS----AASEKTEFEV 60
           + I+E+L SLTL+EAAEL K++E+ +GVSA+APV  +A +AA  G+       E+TEF+V
Sbjct: 6   DQILEQLKSLTLLEAAELVKQIEEAFGVSAAAPVGGMAVIAAPGGAAAAEVVEEQTEFDV 65

Query: 61  VLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +L+  + P  KKIAV+K VR IT LGLKEAKELVES PK++K G++K+ A ++ KK+ +A
Sbjct: 66  ILQ--EVPADKKIAVLKIVREITGLGLKEAKELVESTPKAVKEGVNKEAAEDISKKITEA 123

Query: 120 GATVELR 126
           G  V ++
Sbjct: 124 GGKVAIK 130


>gi|329890168|ref|ZP_08268511.1| ribosomal protein L7/L12 [Brevundimonas diminuta ATCC 11568]
 gi|328845469|gb|EGF95033.1| ribosomal protein L7/L12 [Brevundimonas diminuta ATCC 11568]
          Length = 126

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 92/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS-APVSVVAPVAAEAGSAASEKTEFE 59
           M+++  IVE+LS+LT++EAAELSK LE++WGVSA+          AAEA  A  E+TEF 
Sbjct: 1   MADLAKIVEELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAEAAPAGEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           VVL   D   KKI VIKEVR + TDLGLKEAK+LVE AP+ +   +SK  A E+KKKLE+
Sbjct: 61  VVL--VDGGDKKINVIKEVRGVRTDLGLKEAKDLVEGAPQPVVENVSKQTAEELKKKLEE 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAKVEIK 126


>gi|189095316|ref|YP_001936329.1| ribosomal protein L12 [Heterosigma akashiwo]
 gi|157694659|gb|ABV65935.1| 50S ribosomal protein L12 [Heterosigma akashiwo]
          Length = 128

 Score =  100 bits (250), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 89/129 (68%), Gaps = 4/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS---APVSVVAPVAAEAGSAASEKTE 57
           MS +++I+E+L +LTL+EA+EL +++E+ + V  S     + V      E  +A  EKTE
Sbjct: 1   MSKVDNIIEELKTLTLLEASELVQKIEETFNVDTSIGGGMMMVAGAAGTETSAAVEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+      KKIA++K VR IT LGLKEAKELV++APK+++ G++K+ A + K  LE
Sbjct: 61  FDVVLENVP-ADKKIAILKVVRTITGLGLKEAKELVDNAPKTIQEGIAKEAAEDAKTLLE 119

Query: 118 DAGATVELR 126
           +AGA + L+
Sbjct: 120 NAGAGIALK 128


>gi|209548926|ref|YP_002280843.1| 50S ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226733727|sp|B5ZYS6|RL7_RHILW RecName: Full=50S ribosomal protein L7/L12
 gi|209534682|gb|ACI54617.1| ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 125

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 72/127 (56%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +   E KTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAGGAGPAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVRAIT LGLKEAK+LVE APK++K G++K EA ++KKKLEDA
Sbjct: 61  VIL--VEAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVNKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|225017236|ref|ZP_03706428.1| hypothetical protein CLOSTMETH_01162 [Clostridium methylpentosum
           DSM 5476]
 gi|224950011|gb|EEG31220.1| hypothetical protein CLOSTMETH_01162 [Clostridium methylpentosum
           DSM 5476]
          Length = 122

 Score =  100 bits (250), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 91/126 (72%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I   +E + +LT++E  EL K +E+E+GVSA+APV +    A     AA+EKTEF+V
Sbjct: 1   MADIAKFIEDIKALTVLELNELVKAIEEEFGVSAAAPVMMAGAAAGG--EAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +    K+ VIK V+ IT LGLKEAKE+V++APK++K G+SK +A EMK KLE AG
Sbjct: 59  ILT--EVGSGKMNVIKAVKEITGLGLKEAKEIVDNAPKAVKEGVSKADAEEMKTKLEGAG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|78187805|ref|YP_375848.1| 50S ribosomal protein L7/L12 [Chlorobium luteolum DSM 273]
 gi|109893779|sp|Q3B1H6|RL7_PELLD RecName: Full=50S ribosomal protein L7/L12
 gi|78167707|gb|ABB24805.1| LSU ribosomal protein L12P [Chlorobium luteolum DSM 273]
          Length = 123

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +IE++VE++  LTL EA+EL K LE+++GVSA+  V      AA A +AA E+TEF+VVL
Sbjct: 2   SIETLVEEIGKLTLTEASELVKSLEEKFGVSAAPAVVAGVAAAAPAAAAAEEQTEFDVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               + K  I VIK VRAIT LGLKEAK++V+ APK++K  +SKDEA ++ K+L+DAGA+
Sbjct: 62  TAAGESK--INVIKVVRAITGLGLKEAKDMVDGAPKTVKEAVSKDEAEKLMKELKDAGAS 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|85715145|ref|ZP_01046129.1| 50S ribosomal protein L7/L12 [Nitrobacter sp. Nb-311A]
 gi|85698060|gb|EAQ35933.1| 50S ribosomal protein L7/L12 [Nitrobacter sp. Nb-311A]
          Length = 126

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 99/128 (77%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V A   A  G+AA+  EKT+F
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGGAAAAAEEKTDF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE 
Sbjct: 61  TVVLAAAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKIKAQLEK 118

Query: 119 AGATVELR 126
           AG  VEL+
Sbjct: 119 AGGKVELK 126


>gi|218960791|ref|YP_001740566.1| 50S ribosomal subunit protein L7/L12 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729448|emb|CAO80359.1| 50S ribosomal subunit protein L7/L12 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 127

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 86/124 (69%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA--GSAASEKTEFEVVL 62
           + +++ +  +T++E +EL K +E+ +GVSASAPV+ V      A  G    E+TEF+V+L
Sbjct: 6   QQVIDLIKEMTVLELSELVKEMEEIFGVSASAPVAAVMSTQGSAAEGGEKEEQTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KKI VIK VR IT LGLKEAK+LV+ APK +   +SK+EA  ++KKLE+AGAT
Sbjct: 66  TSAGD--KKINVIKVVREITKLGLKEAKDLVDGAPKVVSEKVSKEEAESVRKKLEEAGAT 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEVK 127


>gi|15606948|ref|NP_214330.1| ribosomal protein L7/L12 [Aquifex aeolicus VF5]
 gi|61233325|sp|P0A466|RL7_AQUAE RecName: Full=50S ribosomal protein L7/L12
 gi|61233332|sp|P0A467|RL7_AQUPY RecName: Full=50S ribosomal protein L7/L12
 gi|2598990|gb|AAB84039.1| 50S ribosomal protein L7/L12 [Aquifex pyrophilus]
 gi|2984197|gb|AAC07728.1| ribosomal protein L7/L12 [Aquifex aeolicus VF5]
          Length = 128

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 70/126 (55%), Positives = 93/126 (73%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--SEKTEFEV 60
            I+ IVE + +++++E AEL KRLE+E+GVSA+A V+      A AG+ A   EKTEF+V
Sbjct: 5   TIDEIVEAIKNMSVLEVAELVKRLEEEFGVSAAAMVAAAPAAGAAAGAPAQAEEKTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK     K KI VIK VR IT LGLKEAKELV++APK +K G+ K+EA ++KKKLE+AG
Sbjct: 65  ILKS--PGKNKIQVIKVVREITGLGLKEAKELVDNAPKPIKEGVPKEEAEQIKKKLEEAG 122

Query: 121 ATVELR 126
           A VEL+
Sbjct: 123 AEVELK 128


>gi|215400736|ref|YP_002327497.1| ribosomal protein L12 [Vaucheria litorea]
 gi|194441186|gb|ACF70914.1| ribosomal protein L12 [Vaucheria litorea]
          Length = 128

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           I++I+E+L  L+LIEA+EL K++E+ +GV  S+S  + + +PV     +   EKT F+++
Sbjct: 5   IDNIIEELKVLSLIEASELVKQIEETFGVDASSSGAMMISSPVGNIGEAPLEEKTAFDII 64

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      KKI+++K VR+IT LGLKEAK+LVE+ PK +K G+SK E+ E+KK+LE+AGA
Sbjct: 65  LETVP-ADKKISILKIVRSITGLGLKEAKDLVETVPKLIKEGISKSESEELKKQLEEAGA 123

Query: 122 TVELR 126
            V L+
Sbjct: 124 KVILK 128


>gi|239618203|ref|YP_002941525.1| ribosomal protein L7/L12 [Kosmotoga olearia TBF 19.5.1]
 gi|259491650|sp|C5CGE0|RL7_KOSOT RecName: Full=50S ribosomal protein L7/L12
 gi|239507034|gb|ACR80521.1| ribosomal protein L7/L12 [Kosmotoga olearia TBF 19.5.1]
          Length = 128

 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 77/127 (60%), Positives = 93/127 (73%), Gaps = 7/127 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E +++ +  +T+ E AEL K LE+E+GVSASAPV+V A   A  G AA   EKTEF VVL
Sbjct: 4   EELIQAIKEMTVAELAELVKALEEEFGVSASAPVAVAAMPGAAGGQAAQEEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESA--PKS-LKTGLSKDEANEMKKKLEDA 119
           K F D  KKIAVIK VRAIT LGLKEAKELVE A  P + +K G+SK EA E+KK+LE+A
Sbjct: 64  KSFGD--KKIAVIKAVRAITGLGLKEAKELVEKAGSPDAIIKEGISKSEAEEIKKQLEEA 121

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 122 GAEVELK 128


>gi|291166884|gb|EFE28930.1| 50S ribosomal protein L7/L12 [Filifactor alocis ATCC 35896]
          Length = 122

 Score =  100 bits (248), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (72%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+E + ++ ++E  EL K  E+++GVSA+APV +VA  AA  G+A  EK+EF+V+L
Sbjct: 2   NIEQILEAIENMKVLELNELVKAAEEKFGVSAAAPV-MVAGGAAAGGAAVEEKSEFDVIL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    K+ VIK VR IT LGLK+AK+LV+ APK +K G+SK+EA EMK KLE AGA 
Sbjct: 61  A--DAGSSKVGVIKAVREITGLGLKDAKDLVDGAPKPVKEGVSKEEAEEMKAKLEGAGAK 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|170750238|ref|YP_001756498.1| 50S ribosomal protein L7/L12 [Methylobacterium radiotolerans JCM
           2831]
 gi|226733708|sp|B1LY44|RL7_METRJ RecName: Full=50S ribosomal protein L7/L12
 gi|170656760|gb|ACB25815.1| ribosomal protein L7/L12 [Methylobacterium radiotolerans JCM 2831]
          Length = 125

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  +V+ LSSLT++EAA+L+K LE++WGVSA+A V+V A  AA   +AA E +TEF 
Sbjct: 1   MADLAKLVDDLSSLTVLEAADLAKMLEEKWGVSAAAAVAVAAGPAAGGAAAAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKLKAQLEKA 118

Query: 120 GATVELR 126
           GA +EL+
Sbjct: 119 GAKIELK 125


>gi|296533979|ref|ZP_06896496.1| ribosomal protein L7/L12 [Roseomonas cervicalis ATCC 49957]
 gi|296265692|gb|EFH11800.1| ribosomal protein L7/L12 [Roseomonas cervicalis ATCC 49957]
          Length = 126

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 74/128 (57%), Positives = 100/128 (78%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  +V++LSSLT++EAAELSK LE++WGVSA+APV+V A  AA   +A +  E+TEF
Sbjct: 1   MADLAKLVDELSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAPAAGGAAAPAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V+L    D  KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA ++KK LE+
Sbjct: 61  TVILANSGD--KKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVSKDEAEKIKKVLEE 118

Query: 119 AGATVELR 126
            GA VE++
Sbjct: 119 NGAKVEVK 126


>gi|291280156|ref|YP_003496991.1| 50S ribosomal protein L7/L12 [Deferribacter desulfuricans SSM1]
 gi|290754858|dbj|BAI81235.1| 50S ribosomal protein L7/L12 [Deferribacter desulfuricans SSM1]
          Length = 128

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 90/125 (72%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E ++E + +++++E AE  K LE+++GVSA+APV++VA     AG+       KTEF+V+
Sbjct: 6   EQVIEFIENMSVLELAEFVKELEEKFGVSAAAPVAMVAGAPGAAGAGEGGAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+   D  KK+ VIK VR IT LGLKEAK LV+ AP  +K G++K+EA ++K KLE+AGA
Sbjct: 66  LQSAGD--KKVQVIKVVREITGLGLKEAKALVDGAPSPVKEGVAKEEAEQIKAKLEEAGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIK 128


>gi|157777896|gb|ABV70082.1| 50S ribosomal protein L12 [Heterosigma akashiwo]
          Length = 128

 Score =  100 bits (248), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 92/129 (71%), Gaps = 4/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS--APVSVVAPVAAEAGSAA-SEKTE 57
           MS +++I+E+L +LTL+EA+EL +++E+ + V  S    + +VA  A    SAA  EKTE
Sbjct: 1   MSKVDNIIEELKTLTLLEASELVQKIEETFNVDTSIGGGMMMVAGAAGTDTSAAVEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+      KKIA++K VR IT LGLKEAKELV++APK+++ G++K+ A + K  LE
Sbjct: 61  FDVVLENVP-ADKKIAILKVVRTITGLGLKEAKELVDNAPKTIQEGIAKEAAEDAKTLLE 119

Query: 118 DAGATVELR 126
           +AGA + L+
Sbjct: 120 NAGAGIALK 128


>gi|133872299|gb|ABO40219.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           americanus]
          Length = 131

 Score =  100 bits (248), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 94/127 (74%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA----EAGSAASEKTEF 58
           N++SIV++L SLTL++++ELSK+LE++ G+SA++ +S      +    +A S A+E+T+F
Sbjct: 5   NLDSIVDQLCSLTLMQSSELSKKLEEKLGISAASFLSAAPAAQSAPADDAVSKAAEQTDF 64

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL GF D   KIAVIKEVR IT LGLKEAK LV+S PK++K  +SK EA ++K+KL  
Sbjct: 65  NVVLSGFAD-NSKIAVIKEVRTITSLGLKEAKALVKSCPKTIKEAVSKAEAKKIKEKLVA 123

Query: 119 AGATVEL 125
            GA ++L
Sbjct: 124 VGAKIDL 130


>gi|219684536|ref|ZP_03539479.1| ribosomal protein L7/L12 [Borrelia garinii PBr]
 gi|219671898|gb|EED28952.1| ribosomal protein L7/L12 [Borrelia garinii PBr]
          Length = 124

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 84/123 (68%), Gaps = 5/123 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  L     +E  +L   +E+++GV+A+  +S V  VAA  GS  SE +TEF+V+L 
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA--ISAVGGVAASTGSTDSEEQTEFDVILM 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA V
Sbjct: 64  SFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKV 121

Query: 124 ELR 126
           E++
Sbjct: 122 EVK 124


>gi|313892109|ref|ZP_07825704.1| ribosomal protein L7/L12 [Dialister microaerophilus UPII 345-E]
 gi|329121901|ref|ZP_08250515.1| 50S ribosomal protein L7/L12 [Dialister micraerophilus DSM 19965]
 gi|313119464|gb|EFR42661.1| ribosomal protein L7/L12 [Dialister microaerophilus UPII 345-E]
 gi|327467698|gb|EGF13194.1| 50S ribosomal protein L7/L12 [Dialister micraerophilus DSM 19965]
          Length = 123

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +SS++++E +EL K +E+++GVSA+APV+V A  A  AG AA EK+EF+V
Sbjct: 1   MTN-EEILEAISSMSVLELSELVKAIEEKFGVSAAAPVAVAAAAAPAAGEAAEEKSEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D   +KI VIK VR IT LGLK+AK LV+ APK +KTG++K EA EMKKK E  G
Sbjct: 60  ILK--DAGSQKIQVIKVVREITGLGLKDAKGLVDGAPKEVKTGVAKAEAEEMKKKFEAVG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|163745525|ref|ZP_02152885.1| 50S ribosomal protein L7/L12 [Oceanibulbus indolifex HEL-45]
 gi|161382343|gb|EDQ06752.1| 50S ribosomal protein L7/L12 [Oceanibulbus indolifex HEL-45]
          Length = 123

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+ G+A  EKTEF+V
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGGAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEEIKGKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|197104683|ref|YP_002130060.1| 50S ribosomal protein L7/L12 [Phenylobacterium zucineum HLK1]
 gi|226733717|sp|B4R8K4|RL7_PHEZH RecName: Full=50S ribosomal protein L7/L12
 gi|196478103|gb|ACG77631.1| 50S ribosomal protein L7/L12 [Phenylobacterium zucineum HLK1]
          Length = 128

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (73%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS---APVSVVAPVAAEAGSAASEKTE 57
           M+N+E +VE LS+LT++EAAELSK LE++WGVSA+   A  +  A    EA  A  E+TE
Sbjct: 1   MANLEKLVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAPAAGGGEAAPAGEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F VVL    D  KKI VIKEVR +  DLGLKEAK+LVE AP+++K  +SK EA E+KKKL
Sbjct: 61  FTVVLTAGGD--KKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVKENVSKQEAEEIKKKL 118

Query: 117 EDAGATVELR 126
           E+AGA+V+++
Sbjct: 119 EEAGASVQIK 128


>gi|110681146|ref|YP_684153.1| 50S ribosomal protein L7/L12 [Roseobacter denitrificans OCh 114]
 gi|123172019|sp|Q160X6|RL7_ROSDO RecName: Full=50S ribosomal protein L7/L12
 gi|109457262|gb|ABG33467.1| ribosomal protein L7/L12 [Roseobacter denitrificans OCh 114]
          Length = 123

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A+AG+A  EKTEF+V
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       KI VIKEVR IT LGLKEAK+LVE+  K +K G  K EA E+K KLE AG
Sbjct: 61  VLK--SPGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGCDKAEAEEIKGKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|167749114|ref|ZP_02421241.1| hypothetical protein EUBSIR_00058 [Eubacterium siraeum DSM 15702]
 gi|167657913|gb|EDS02043.1| hypothetical protein EUBSIR_00058 [Eubacterium siraeum DSM 15702]
 gi|291556826|emb|CBL33943.1| LSU ribosomal protein L12P [Eubacterium siraeum V10Sc8a]
          Length = 124

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/124 (55%), Positives = 92/124 (74%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I +++E++  L+++E  EL K LE+E+GVSA+A VSV  P A  A +AA EKTEF+VVL
Sbjct: 5   KILAMIEEVKGLSVLELNELVKALEEEFGVSAAA-VSVAGPAAGGA-AAAEEKTEFDVVL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F D K  +AVIK V+ +  LGLKEAKELVE+APK++K G SK EA E+K KLE+AGA 
Sbjct: 63  ASFGDAK--MAVIKAVKDVCGLGLKEAKELVEAAPKAIKEGASKAEAEEIKAKLEEAGAK 120

Query: 123 VELR 126
           +EL+
Sbjct: 121 IELK 124


>gi|163732879|ref|ZP_02140324.1| 50S ribosomal protein L7/L12 [Roseobacter litoralis Och 149]
 gi|161394239|gb|EDQ18563.1| 50S ribosomal protein L7/L12 [Roseobacter litoralis Och 149]
          Length = 123

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A+AG+A  EKTEF+V
Sbjct: 1   MADLKKMAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       KI VIKEVR IT LGLKEAK+LVE+  K +K G  K EA E+K KLE AG
Sbjct: 61  VLK--SPGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGCDKAEAEEIKGKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|21672995|ref|NP_661060.1| 50S ribosomal protein L7/L12 [Chlorobium tepidum TLS]
 gi|25091173|sp|Q8KG16|RL7_CHLTE RecName: Full=50S ribosomal protein L7/L12
 gi|21646057|gb|AAM71402.1| ribosomal protein L7/L12 [Chlorobium tepidum TLS]
          Length = 126

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 91/129 (70%), Gaps = 6/129 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           MS+IE++VE++  LTL EA+EL K LE+++GVSA AP  +   V A     A+    KTE
Sbjct: 1   MSSIETLVEEIGKLTLTEASELVKALEEKFGVSA-APAVMAGAVMAAPAGEAAAAEEKTE 59

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVLK       KI VIK VRAIT LGLKEAK++V+ APK++K  +SKDEA ++ K+L+
Sbjct: 60  FDVVLKSAG--ANKINVIKVVRAITGLGLKEAKDMVDGAPKTVKEAVSKDEAEKIAKELK 117

Query: 118 DAGATVELR 126
           DAGA VEL 
Sbjct: 118 DAGAEVELN 126


>gi|254437630|ref|ZP_05051124.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 307]
 gi|198253076|gb|EDY77390.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 307]
          Length = 127

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 86/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+ G+A  EKTEF+V
Sbjct: 5   MADLKKMAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGGAAEEEKTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       KI VIKEVR IT LGLKEAK+LVE+  K +K G+SK+EA ++K KLE AG
Sbjct: 65  ILK--SPGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVSKEEAEDVKGKLEAAG 121

Query: 121 ATVEL 125
           A VEL
Sbjct: 122 AEVEL 126


>gi|94266151|ref|ZP_01289863.1| Ribosomal protein L7/L12 [delta proteobacterium MLMS-1]
 gi|93453266|gb|EAT03715.1| Ribosomal protein L7/L12 [delta proteobacterium MLMS-1]
          Length = 127

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           + ++E +S+++++E +EL K LE ++GVSA+APV+ VA  AA   +  +   KTEF+V+L
Sbjct: 6   DDVIEFISNMSVLELSELIKELEDKFGVSAAAPVAAVAAPAAGGEAGEAAEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KKI VIKEVRAIT LGLKEAKE+VE AP  +K G+SKDEA E+KKK+E+AG T
Sbjct: 66  ASAGD--KKIGVIKEVRAITSLGLKEAKEMVEGAPNPIKEGVSKDEAEEIKKKIEEAGGT 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEIK 127


>gi|225850727|ref|YP_002730961.1| 50S ribosomal protein L7/L12 [Persephonella marina EX-H1]
 gi|254806387|sp|C0QQL5|RL7_PERMH RecName: Full=50S ribosomal protein L7/L12
 gi|225646362|gb|ACO04548.1| ribosomal protein L7/L12 [Persephonella marina EX-H1]
          Length = 127

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (73%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I E + ++T++E AEL K LE+E+GVSA+A V+        A  AA+E KTEF+V+L+
Sbjct: 7   EEIKEAIKNMTVLELAELVKELEEEFGVSAAAMVAAAPAAGGAAAGAAAEEKTEFDVILQ 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              D  KKI VIK VR IT LGLKEAKELV+SAPK++K G+SK+EA + K KLE+AGATV
Sbjct: 67  SPGD--KKINVIKVVREITGLGLKEAKELVDSAPKAIKEGVSKEEAEQFKAKLEEAGATV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|126697631|ref|YP_001086528.1| 50S ribosomal protein L7/L12 [Clostridium difficile 630]
 gi|254973722|ref|ZP_05270194.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-66c26]
 gi|255091112|ref|ZP_05320590.1| 50S ribosomal protein L7/L12 [Clostridium difficile CIP 107932]
 gi|255099224|ref|ZP_05328201.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-63q42]
 gi|255305006|ref|ZP_05349178.1| 50S ribosomal protein L7/L12 [Clostridium difficile ATCC 43255]
 gi|255312766|ref|ZP_05354349.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-76w55]
 gi|255515526|ref|ZP_05383202.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-97b34]
 gi|255648620|ref|ZP_05395522.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-37x79]
 gi|255654153|ref|ZP_05399562.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-23m63]
 gi|260681837|ref|YP_003213122.1| 50S ribosomal protein L7/L12 [Clostridium difficile CD196]
 gi|260685435|ref|YP_003216568.1| 50S ribosomal protein L7/L12 [Clostridium difficile R20291]
 gi|296449808|ref|ZP_06891576.1| ribosomal protein L7/L12 [Clostridium difficile NAP08]
 gi|296877872|ref|ZP_06901893.1| ribosomal protein L7/L12 [Clostridium difficile NAP07]
 gi|306518743|ref|ZP_07405090.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-32g58]
 gi|123067150|sp|Q18CE7|RL7_CLOD6 RecName: Full=50S ribosomal protein L7/L12
 gi|115249068|emb|CAJ66879.1| 50S ribosomal protein L7/L12 [Clostridium difficile]
 gi|260208000|emb|CBA60170.1| 50S ribosomal protein L7/L12 [Clostridium difficile CD196]
 gi|260211451|emb|CBE01563.1| 50S ribosomal protein L7/L12 [Clostridium difficile R20291]
 gi|296261352|gb|EFH08179.1| ribosomal protein L7/L12 [Clostridium difficile NAP08]
 gi|296431126|gb|EFH16952.1| ribosomal protein L7/L12 [Clostridium difficile NAP07]
          Length = 121

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (70%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E + ++ ++E  EL K  E+++GVSASAPV V    A     AA EKTEF+VVL
Sbjct: 2   TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVAGAAAGG--PAAEEKTEFDVVL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    K+ VIK VR IT LGLKEAKE+V++APK++K G SK+EA+++K+KLE AGA 
Sbjct: 60  T--DVGSSKVGVIKAVREITGLGLKEAKEVVDNAPKTVKEGASKEEADQIKEKLEAAGAK 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|148284107|ref|YP_001248197.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Boryong]
 gi|146739546|emb|CAM79275.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Boryong]
          Length = 129

 Score = 99.4 bits (246), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 86/125 (68%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV-VAPVAAEAGSAASEKTEFEVV 61
           N++  V+ LS+ ++IE  EL+K LE+EWGVS S P ++ VA   A    +  EK EF+V+
Sbjct: 8   NVKKAVDVLSTFSVIELLELTKVLEEEWGVS-SIPSNIPVATAMAPVQESEEEKNEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L     P+KK+ VIK V+ IT L LKEAKE+VESAPK +K  +SK EA ++K +LE+ GA
Sbjct: 67  LATV--PEKKVDVIKIVKNITGLALKEAKEMVESAPKVIKASISKAEAEDIKSQLENVGA 124

Query: 122 TVELR 126
            VEL+
Sbjct: 125 KVELK 129


>gi|288818172|ref|YP_003432520.1| ribosomal protein L7/L12 [Hydrogenobacter thermophilus TK-6]
 gi|288787572|dbj|BAI69319.1| ribosomal protein L7/L12 [Hydrogenobacter thermophilus TK-6]
 gi|308751773|gb|ADO45256.1| ribosomal protein L7/L12 [Hydrogenobacter thermophilus TK-6]
          Length = 127

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFEVVL 62
           I+ IVE + ++TL+E AEL K+LE+++GVSA+   +  A   A   +    EKTEF+V+L
Sbjct: 6   IDEIVEAIGNMTLLEVAELVKKLEEKFGVSAAMVAAAPAAAPAGPAAPAVEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K       KI VIK VR IT LGLKEAK+LVESAPK +K G+SK+EA  +KKKLE+AGA 
Sbjct: 66  KSAG--ANKINVIKVVREITGLGLKEAKDLVESAPKPVKEGVSKEEAENIKKKLEEAGAE 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEIK 127


>gi|254294448|ref|YP_003060471.1| ribosomal protein L7/L12 [Hirschia baltica ATCC 49814]
 gi|254042979|gb|ACT59774.1| ribosomal protein L7/L12 [Hirschia baltica ATCC 49814]
          Length = 125

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/127 (62%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS +E IVE LS+L+++EAAEL+  LE++WGVSA+APV+V A    EA +AA EKTEF+V
Sbjct: 1   MSKLEQIVEDLSALSVMEAAELATLLEEKWGVSAAAPVAVAAAGGGEAAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VLK      KKI VIK VR I + LGLKEAKELVE+APK++K G+ K EA E+KKKLE+A
Sbjct: 61  VLKAAG--AKKINVIKAVREIVSGLGLKEAKELVEAAPKAVKEGVDKAEAEEIKKKLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|119485144|ref|ZP_01619529.1| 50S ribosomal protein L7/L12 [Lyngbya sp. PCC 8106]
 gi|119457372|gb|EAW38497.1| 50S ribosomal protein L7/L12 [Lyngbya sp. PCC 8106]
          Length = 132

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (69%), Gaps = 7/128 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASA---PVSVVAP---VAAEAGSAASEKTEF 58
           + I+E+L SL+L+EA+EL K++E  +GV ASA      ++AP   V + A     EKTEF
Sbjct: 6   DEILEQLKSLSLLEASELVKQIEDAFGVDASAVGGGGMMMAPGVNVPSPATEEVEEKTEF 65

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L  F    KKIA++K VR IT LGLKEAK+LVESAPK +K   SK++A  +KK+LE+
Sbjct: 66  DVILDEFPS-DKKIAILKVVRTITGLGLKEAKDLVESAPKPIKEATSKEDAESVKKQLEE 124

Query: 119 AGATVELR 126
           AGA V ++
Sbjct: 125 AGAKVTVK 132


>gi|307152576|ref|YP_003887960.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 7822]
 gi|306982804|gb|ADN14685.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 7822]
          Length = 129

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 91/125 (72%), Gaps = 4/125 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA---PVAAEAGSAASEKTEFEVV 61
           + I+EKL SLTL+EAAEL K++E+ +GVSA+APV  V    P AA A     EKTEF+V+
Sbjct: 6   DEILEKLKSLTLLEAAELVKQIEEAFGVSAAAPVGGVVMAAPTAAAAAEPEEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      KKIA++K VR IT LGLKEAK+LVES PK +K G +KD+A + KKKLE+AGA
Sbjct: 66  LEEVP-ADKKIAILKVVRTITGLGLKEAKDLVESTPKPIKEGTNKDDAEDTKKKLEEAGA 124

Query: 122 TVELR 126
            V ++
Sbjct: 125 KVSVK 129


>gi|210623169|ref|ZP_03293619.1| hypothetical protein CLOHIR_01569 [Clostridium hiranonis DSM 13275]
 gi|210153782|gb|EEA84788.1| hypothetical protein CLOHIR_01569 [Clostridium hiranonis DSM 13275]
          Length = 121

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E + ++ ++E  EL K  E+++GVSASAPV V         +AA EKTEF+VVL
Sbjct: 2   TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVAGAAGGA--AAAEEKTEFDVVL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIK VR IT LGLKEAKE+V++APK++K G SK+EA ++K+KLE AGA 
Sbjct: 60  A--DAGSSKIGVIKVVREITGLGLKEAKEVVDNAPKTVKEGASKEEAEQIKEKLEAAGAK 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|23004112|ref|ZP_00047613.1| COG0222: Ribosomal protein L7/L12 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 126

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 98/128 (76%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA  G+AA+  E+TEF
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGGGAAAAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL    D  KKI VIKEVRAIT LGLKEAK+LVE APK +K  ++KDEA ++K +LE 
Sbjct: 61  TVVLASAGD--KKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEAVAKDEAEKIKAQLEK 118

Query: 119 AGATVELR 126
           AG  VEL+
Sbjct: 119 AGGKVELK 126


>gi|111115219|ref|YP_709837.1| 50S ribosomal protein L7/L12 [Borrelia afzelii PKo]
 gi|216263895|ref|ZP_03435889.1| ribosomal protein L7/L12 [Borrelia afzelii ACA-1]
 gi|123046997|sp|Q0SNB7|RL7_BORAP RecName: Full=50S ribosomal protein L7/L12
 gi|52694900|gb|AAU85601.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
 gi|52694902|gb|AAU85602.1| 50S ribosomal protein L7/L12 [Borrelia afzelii ACA-1]
 gi|52694904|gb|AAU85603.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
 gi|52694924|gb|AAU85613.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
 gi|110890493|gb|ABH01661.1| ribosomal protein L7/L12 [Borrelia afzelii PKo]
 gi|215979939|gb|EEC20761.1| ribosomal protein L7/L12 [Borrelia afzelii ACA-1]
          Length = 124

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 83/125 (66%), Gaps = 5/125 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           N E I+  L     +E  EL   +E+++GV+A+   SV    AA  GS  SE +TEF+V+
Sbjct: 4   NKEDILTWLEGAKTMEVVELVTAIEEKFGVTAAVATSVGG--AASTGSTDSEEQTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L  F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA
Sbjct: 62  LMSFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGA 119

Query: 122 TVELR 126
            VE++
Sbjct: 120 KVEVK 124


>gi|312115366|ref|YP_004012962.1| ribosomal protein L7/L12 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220495|gb|ADP71863.1| ribosomal protein L7/L12 [Rhodomicrobium vannielii ATCC 17100]
          Length = 127

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 90/125 (72%), Gaps = 4/125 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-PV-AAEAGSAASEKTEFEVV 61
            E + ++LS LT++E +EL K LE +WGVSA+A   V A P+  A A +   EKTEF+V+
Sbjct: 5   FEKLYQELSGLTVLEISELVKLLEDKWGVSAAAAAPVFAGPIPGAAAAAEEEEKTEFDVI 64

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   +   +KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA E+KKK+E AGA
Sbjct: 65  LT--EAGAQKINVIKEVRAITGLGLKEAKDLVEGAPKAIKEAVSKTEAEEIKKKIEAAGA 122

Query: 122 TVELR 126
            V+++
Sbjct: 123 KVDIK 127


>gi|189184702|ref|YP_001938487.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Ikeda]
 gi|189181473|dbj|BAG41253.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Ikeda]
          Length = 129

 Score = 98.6 bits (244), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 86/125 (68%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV-VAPVAAEAGSAASEKTEFEVV 61
           N++  V+ LS+ ++IE  EL+K LE+EWGVS S P ++ VA   A    +  EK EF+V+
Sbjct: 8   NVKKAVDMLSTFSVIELLELTKVLEEEWGVS-SIPSNIPVATAIAPVQESEEEKNEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L     P+KK+ VIK V+ IT L LKEAKE+V+SAPK +K  +SK EA ++K +LE+ GA
Sbjct: 67  LATV--PEKKVDVIKIVKNITGLALKEAKEMVDSAPKVIKASISKAEAEDIKSQLENVGA 124

Query: 122 TVELR 126
            VEL+
Sbjct: 125 KVELK 129


>gi|297170770|gb|ADI21792.1| hypothetical protein [uncultured gamma proteobacterium
           HF0130_22O14]
          Length = 131

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--EAGSAASEKTEFEVVL 62
           E ++E +S +++++  EL   +E+++GV+A+APV+V A  AA   A +A  E+TEFE+VL
Sbjct: 10  EDVLEAISQMSVMDLVELISEMEEKFGVTAAAPVAVAAAPAAGDSAEAAGEEQTEFEIVL 69

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D   KIAVIK VR+IT LGLK+AK+LVE APK LK  +SKDEA EMKK+LE+AGA+
Sbjct: 70  AAAGD--NKIAVIKAVRSITGLGLKDAKDLVEGAPKPLKDSVSKDEAEEMKKQLEEAGAS 127

Query: 123 VELR 126
           VEL+
Sbjct: 128 VELK 131


>gi|149913533|ref|ZP_01902066.1| 50S ribosomal protein L7/L12 [Roseobacter sp. AzwK-3b]
 gi|149812653|gb|EDM72482.1| 50S ribosomal protein L7/L12 [Roseobacter sp. AzwK-3b]
          Length = 126

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (69%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL   L+ E+G+  +A   V +  P      +AA E+TEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGDAGAAAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK     K  I VIKEVRAIT LGLKEAK+LVE+  K++K  +SKDEA E+KKKLE+
Sbjct: 61  DVILKSAGASK--INVIKEVRAITGLGLKEAKDLVEAGGKAVKEQVSKDEAEEIKKKLEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|94971703|ref|YP_593751.1| 50S ribosomal protein L7/L12 [Candidatus Koribacter versatilis
           Ellin345]
 gi|122986008|sp|Q1IHH3|RL7_ACIBL RecName: Full=50S ribosomal protein L7/L12
 gi|94553753|gb|ABF43677.1| LSU ribosomal protein L12P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 126

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA--PVSVVAPVAAEAGSAASEKTEF 58
           M+++  + E++  L+L++AAEL K+LE   GVSA+A  PV V     A A +   EKTEF
Sbjct: 1   MADLAQLEEQIVGLSLLDAAELVKKLESRLGVSAAAAAPVMVAGGGGAAAAAPVEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL        KI VIK VR +T LGLKEAK+LV+ APK++K G+SKDEA  ++KK ++
Sbjct: 61  TVVLTAAG--ANKINVIKAVREVTSLGLKEAKDLVDGAPKTVKEGVSKDEAATIQKKFQE 118

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 119 AGATVEVK 126


>gi|186685899|ref|YP_001869095.1| 50S ribosomal protein L7/L12 [Nostoc punctiforme PCC 73102]
 gi|226733713|sp|B2JA77|RL7_NOSP7 RecName: Full=50S ribosomal protein L7/L12
 gi|186468351|gb|ACC84152.1| ribosomal protein L7/L12 [Nostoc punctiforme PCC 73102]
          Length = 130

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 93/126 (73%), Gaps = 5/126 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTEFEV 60
           + I+E+L +L+L+EA+EL K++E+ +GVSA+APV  +  +A   G+A +    E+TEFEV
Sbjct: 6   DQILEQLKTLSLLEASELVKQIEEAFGVSAAAPVGGMMMMAGPGGAAPAEEAVEQTEFEV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKIAV+K VR +T LGLKEAK+LVE+APK++K G++KD A + KK++E+AG
Sbjct: 66  ILDSVP-ADKKIAVLKIVRELTGLGLKEAKDLVEAAPKAVKEGIAKDAAEDAKKRIEEAG 124

Query: 121 ATVELR 126
             V ++
Sbjct: 125 GKVTIK 130


>gi|170077647|ref|YP_001734285.1| ribosomal protein L7/L12 [Synechococcus sp. PCC 7002]
 gi|226734484|sp|B1XJG9|RL7_SYNP2 RecName: Full=50S ribosomal protein L7/L12
 gi|169885316|gb|ACA99029.1| ribosomal protein L7/L12 [Synechococcus sp. PCC 7002]
          Length = 128

 Score = 98.2 bits (243), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFE 59
           +  + I+EKL SLTL+EAAEL K++E+ +GVSA+APV   V+A   A A     EKTEF+
Sbjct: 3   ATTDEILEKLQSLTLLEAAELVKQIEETFGVSAAAPVGGMVMAAPGAAAAEEVEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L       KKIAV+K VR IT LGLKEAKE+VESAPK +K    K++A  +KK+LEDA
Sbjct: 63  VILDEVP-ADKKIAVLKVVRGITGLGLKEAKEMVESAPKPIKEATGKEDAEAIKKQLEDA 121

Query: 120 GA 121
           GA
Sbjct: 122 GA 123


>gi|52694906|gb|AAU85604.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
          Length = 124

 Score = 98.2 bits (243), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 83/125 (66%), Gaps = 5/125 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           N E I+  L     +E  EL   +E+++GV+A+   SV    AA  GS  SE +TEF+V+
Sbjct: 4   NKEDILTWLEGAKTMEVVELVTAIEEKFGVTAAVATSVGG--AASTGSIDSEEQTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L  F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA
Sbjct: 62  LMSFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGA 119

Query: 122 TVELR 126
            VE++
Sbjct: 120 KVEVK 124


>gi|16330008|ref|NP_440736.1| 50S ribosomal protein L7/L12 [Synechocystis sp. PCC 6803]
 gi|132654|sp|P23349|RL7_SYNY3 RecName: Full=50S ribosomal protein L7/L12
 gi|47476|emb|CAA37318.1| unnamed protein product [Synechocystis sp. PCC 6803]
 gi|1652495|dbj|BAA17416.1| 50S ribosomal protein L12 [Synechocystis sp. PCC 6803]
 gi|227225|prf||1617100B ribosomal protein L12
          Length = 128

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 88/119 (73%), Gaps = 3/119 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFEVVL 62
           + I+E+L SL+L+EA+EL K++E+ +GVSA+APV   V+A  AA    AA EKTEF+V+L
Sbjct: 6   DQILEQLKSLSLLEASELVKQIEEAFGVSAAAPVGGMVMAAAAAAPAEAAEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +      KKIAV+K VR IT LGLKEAKELVES PK++K    KD+A  +KK++E+AG 
Sbjct: 66  EEVP-ADKKIAVLKVVRTITGLGLKEAKELVESTPKAIKEATGKDDAEAIKKQIEEAGG 123


>gi|297170815|gb|ADI21835.1| hypothetical protein [uncultured gamma proteobacterium
           HF0130_25M15]
          Length = 131

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 93/124 (75%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--EAGSAASEKTEFEVVL 62
           E ++E +S +++++  EL   +E+++GV+A+APV+V +  AA   A +A  E+TEFE++L
Sbjct: 10  EDVLEAISQMSVMDLVELISEMEEKFGVTAAAPVAVASAPAAGDSAEAAGEEQTEFEIIL 69

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D   KIAVIK VR+IT LGLK+AK+LVE APK LK  +SKDEA EMKK+LE+AGA+
Sbjct: 70  AAAGD--NKIAVIKAVRSITGLGLKDAKDLVEGAPKPLKDSVSKDEAEEMKKQLEEAGAS 127

Query: 123 VELR 126
           VEL+
Sbjct: 128 VELK 131


>gi|302382917|ref|YP_003818740.1| ribosomal protein L7/L12 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193545|gb|ADL01117.1| ribosomal protein L7/L12 [Brevundimonas subvibrioides ATCC 15264]
          Length = 128

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS---ASAPVSVVAPVAAEAGSAASEKTE 57
           M+++  IV+ LSSLT++EAAELSK LE++WGVS     A        AA    AA E+TE
Sbjct: 1   MADLSKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAMAMPAGGGAAAPAEAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F VVL    D  KKI VIKEVR + +DLGLKEAK+LVE AP+++   +SK  A+E+ KKL
Sbjct: 61  FTVVLVSGGD--KKINVIKEVRGVRSDLGLKEAKDLVEGAPQNVVENVSKQNADEIAKKL 118

Query: 117 EDAGATVELR 126
            +AGATV+++
Sbjct: 119 TEAGATVQIK 128


>gi|254798662|ref|YP_003058321.1| ribosomal protein L12 [Parachlorella kessleri]
 gi|229915610|gb|ACQ90953.1| ribosomal protein L12 [Parachlorella kessleri]
          Length = 131

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 89/125 (71%), Gaps = 8/125 (6%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---VVAPV--AAEAGSAASEKTEFEVV 61
           I+EKL S+TL+EAAEL  ++E+ +GV ASAPV+   + AP+  AA    A  EKT F+++
Sbjct: 8   IIEKLKSITLLEAAELVSQIEETFGVDASAPVAGGFLAAPMESAASQKEAVEEKTTFDII 67

Query: 62  LKGFDDPK-KKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           L+  D P  K+I V+K +R +T L LKEAKE + S PK++K G+SK+EA   K++LE+AG
Sbjct: 68  LE--DVPSDKRIPVLKVIRNLTSLDLKEAKESITSLPKAIKQGISKEEAETAKQQLEEAG 125

Query: 121 ATVEL 125
           A V++
Sbjct: 126 AKVKI 130


>gi|114771280|ref|ZP_01448700.1| ribosomal protein L7/L12 [alpha proteobacterium HTCC2255]
 gi|114548205|gb|EAU51092.1| ribosomal protein L7/L12 [alpha proteobacterium HTCC2255]
          Length = 140

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 90/126 (71%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I+ + E++ +LTL+EA EL   L+ E+G+  +A  +VV   A +  +A  EK EF+V
Sbjct: 18  MADIKKLAEEIVALTLLEAQELKTLLKDEYGIEPAAGGAVVMAAAGDT-AAEEEKDEFDV 76

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK   D  KKI VIKEVR IT LGLKEAK+LVE+  K++K G+SK EA E+KK+LE AG
Sbjct: 77  ILKSAGD--KKINVIKEVRGITGLGLKEAKDLVEAGGKAVKEGVSKSEAEELKKQLEAAG 134

Query: 121 ATVELR 126
           A VEL+
Sbjct: 135 AEVELK 140


>gi|33520001|ref|NP_878833.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia floridanus]
 gi|81666884|sp|Q7VRP6|RL7_BLOFL RecName: Full=50S ribosomal protein L7/L12
 gi|33504347|emb|CAD83240.1| 50S ribosomal subunit protein L7/L12 [Candidatus Blochmannia
           floridanus]
          Length = 126

 Score = 97.8 bits (242), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 85/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSA-SAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           E +++ +S +++++  +L   +EK++GVSA S+ +S V  V  E+ S   E+TEF V+L 
Sbjct: 6   EEVLDAISEMSVMDIMQLISMIEKKFGVSAASSHISSVENVVTESESTQVEQTEFTVILS 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VR+IT LGLKEAK+LVESAP +LK  +SKD+A+ +KK LE  GA+V
Sbjct: 66  SIGG--NKIPVIKAVRSITGLGLKEAKDLVESAPVTLKESVSKDDADNLKKTLESVGASV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|126659908|ref|ZP_01731032.1| 50S ribosomal protein L7/L12 [Cyanothece sp. CCY0110]
 gi|126618772|gb|EAZ89517.1| 50S ribosomal protein L7/L12 [Cyanothece sp. CCY0110]
          Length = 133

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 88/130 (67%), Gaps = 10/130 (7%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-------VSVVAPVAAEAGSAASEKTE 57
           + I+EKL SLTL+EA+EL  ++E+ +GVSASAP               A A     EKTE
Sbjct: 6   DEILEKLKSLTLLEASELVTQIEEAFGVSASAPSGGMMMMAPGAGAPGAAAAEPEEEKTE 65

Query: 58  FEVVLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F+V+L+  D P  KKIA++K VR IT LGLKEAK++VES PK +K G  K++A ++KKKL
Sbjct: 66  FDVILE--DVPGDKKIAILKVVRGITGLGLKEAKDMVESTPKPIKEGTGKEDAEDIKKKL 123

Query: 117 EDAGATVELR 126
           E+AGA V ++
Sbjct: 124 EEAGAKVTVK 133


>gi|16124752|ref|NP_419316.1| 50S ribosomal protein L7/L12 [Caulobacter crescentus CB15]
 gi|221233468|ref|YP_002515904.1| 50S ribosomal protein L7/L12 [Caulobacter crescentus NA1000]
 gi|295688168|ref|YP_003591861.1| 50S 50S ribosomal protein L7/L12 [Caulobacter segnis ATCC 21756]
 gi|20978571|sp|Q9AAU7|RL7_CAUCR RecName: Full=50S ribosomal protein L7/L12
 gi|254806270|sp|B8GZW2|RL7_CAUCN RecName: Full=50S ribosomal protein L7/L12
 gi|13421676|gb|AAK22484.1| ribosomal protein L7/L12 [Caulobacter crescentus CB15]
 gi|220962640|gb|ACL93996.1| LSU ribosomal protein L12P (L7/L12) [Caulobacter crescentus NA1000]
 gi|295430071|gb|ADG09243.1| ribosomal protein L7/L12 [Caulobacter segnis ATCC 21756]
          Length = 127

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 92/129 (71%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS--APVSVVAPVAAEAGSAASEKTEF 58
           MS +E +VE+LS+L+++EAAELSK LE++WGVSA+    V+     AA    AA E+TEF
Sbjct: 1   MSKLEKLVEELSTLSVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAPAEAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
            VVL   D   KKI VIKEVR +  DLGLKEAK+LVE AP+++   +SK +A E+ KKL 
Sbjct: 61  TVVL--VDGGDKKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVVENVSKQQAEEISKKLT 118

Query: 118 DAGATVELR 126
           +AGA ++++
Sbjct: 119 EAGAKIQIK 127


>gi|304315931|ref|YP_003851076.1| ribosomal protein L7/L12 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777433|gb|ADL67992.1| ribosomal protein L7/L12 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 124

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 95/125 (76%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           N E I+E + S+T++E A+L K LE+E+GVSA+APV+V A  AA A +A +E KTEF+V+
Sbjct: 2   NKEEILEAIKSMTVLELADLVKALEEEFGVSAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D   +KI VIK VR +T+LGLKEAK+LVE APK +K G+SKDEAN++K K E+ GA
Sbjct: 62  LT--DVGSEKIKVIKVVREVTNLGLKEAKDLVEGAPKPIKEGVSKDEANQIKAKFEEVGA 119

Query: 122 TVELR 126
            VE++
Sbjct: 120 KVEIK 124


>gi|11467547|ref|NP_043693.1| ribosomal protein L12 [Odontella sinensis]
 gi|1350607|sp|P49550|RK12_ODOSI RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|1185242|emb|CAA91725.1| 50S ribosomal protein L12 [Odontella sinensis]
          Length = 127

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 85/124 (68%), Gaps = 2/124 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           I+ IVE+L +LTL+EA+EL  ++E+ + V ASA V     +A  A     E KTEF+V+L
Sbjct: 5   IDQIVEELKTLTLLEASELVSKIEETFDVDASASVGGGMMMAGPAVVEEVEEKTEFDVML 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KKIAV+K VR++T LGLKEAKELVESAPK ++ G++KD A E KK++EDAG  
Sbjct: 65  DEVP-ADKKIAVLKVVRSLTGLGLKEAKELVESAPKQIQEGVAKDAAEEAKKQIEDAGGK 123

Query: 123 VELR 126
             L+
Sbjct: 124 ASLK 127


>gi|299830334|ref|YP_003734549.1| ribosomal protein L12 [Kryptoperidinium foliaceum]
 gi|297385036|gb|ADI40334.1| ribosomal protein L12 [Kryptoperidinium foliaceum]
          Length = 128

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 3/125 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA--ASEKTEFEVV 61
           I  IVE+L +LTL+EA+EL   +E+ +GV ASA       +AA AG A    EKTEF++ 
Sbjct: 5   INQIVEELKTLTLLEASELVSAIEETFGVDASAAAGGPVMMAAAAGPAEEVEEKTEFDLS 64

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L       KKIAV+K VR IT LGLKEAKELVESAPK ++ G++KD   + KK++E+AG 
Sbjct: 65  LDEVP-ADKKIAVLKVVRGITGLGLKEAKELVESAPKVIQEGVAKDAGEDAKKQIEEAGG 123

Query: 122 TVELR 126
              L+
Sbjct: 124 KASLK 128


>gi|281358736|ref|ZP_06245212.1| ribosomal protein L7/L12 [Victivallis vadensis ATCC BAA-548]
 gi|281314763|gb|EFA98800.1| ribosomal protein L7/L12 [Victivallis vadensis ATCC BAA-548]
          Length = 129

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 94/126 (74%), Gaps = 2/126 (1%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEV 60
           + +E  V  + +LT++E ++L K LE+  GVSA+APV+V A  AA A + A+E KTEF+V
Sbjct: 5   NKMEEFVSYVENLTVLELSKLVKTLEERLGVSAAAPVAVAAAPAAGAAAPAAEEKTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L GFD   KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++K  LE AG
Sbjct: 65  ILAGFD-AAKKIGVIKEIRGITGLGLKEAKDLVEGAPKAIKEGIAKDEAEKLKAALEAAG 123

Query: 121 ATVELR 126
           A VE++
Sbjct: 124 AKVEVK 129


>gi|88812765|ref|ZP_01128011.1| ribosomal protein L7/L12 [Nitrococcus mobilis Nb-231]
 gi|88790003|gb|EAR21124.1| ribosomal protein L7/L12 [Nitrococcus mobilis Nb-231]
          Length = 126

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL   +E+++GV+A+A V+      A A  AA E+TEF+V+L  
Sbjct: 7   EDILETIGNMTVMEVVELIDAMEEKFGVTAAAAVAAAPAAGAGAAEAAEEQTEFDVILSS 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK  RA+T LGLKEAKELVESAP  +K G+ K+EANE+K KLE+AGA+VE
Sbjct: 67  FG--ANKVAVIKAARAVTGLGLKEAKELVESAPVPIKEGIPKEEANEIKGKLEEAGASVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|254454632|ref|ZP_05068069.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 238]
 gi|198269038|gb|EDY93308.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 238]
          Length = 127

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 86/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+ G+A  E+TEF+V
Sbjct: 5   MADLKKMAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGGAAEEEQTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       KI VIKEVR IT LGLKEAK+LVE+  K +K G+SK+EA ++K KLE AG
Sbjct: 65  ILK--SPGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVSKEEAEDVKGKLEAAG 121

Query: 121 ATVEL 125
           A VE+
Sbjct: 122 AEVEV 126


>gi|52694892|gb|AAU85597.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694922|gb|AAU85612.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694926|gb|AAU85614.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694932|gb|AAU85617.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 5/123 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  L     +E  +L   +E+++GV+A+  +S V   AA  GS  SE +TEF+V+L 
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA--ISAVGGGAASTGSTDSEEQTEFDVILM 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA V
Sbjct: 64  SFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKV 121

Query: 124 ELR 126
           E++
Sbjct: 122 EVK 124


>gi|282896123|ref|ZP_06304149.1| Ribosomal protein L7/L12 [Raphidiopsis brookii D9]
 gi|281199041|gb|EFA73916.1| Ribosomal protein L7/L12 [Raphidiopsis brookii D9]
          Length = 129

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 90/126 (71%), Gaps = 6/126 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEFEVV 61
           + I+E+L  LTL+EAAEL K++E+ +GVSA+AP   + V+A   A A     E+TEF VV
Sbjct: 6   DQILEQLKVLTLLEAAELVKQIEEAFGVSAAAPAGGMMVMAAPGAAAAEPVEEQTEFNVV 65

Query: 62  LKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           L+  + P  KKIAV+K VR IT LGLKEAKELVES PK++K G++K+ A E+ KK+ +AG
Sbjct: 66  LE--EVPADKKIAVLKIVREITGLGLKEAKELVESTPKAVKEGVNKESAEEISKKIAEAG 123

Query: 121 ATVELR 126
             V ++
Sbjct: 124 GKVVIK 129


>gi|119356079|ref|YP_910723.1| 50S ribosomal protein L7/L12 [Chlorobium phaeobacteroides DSM 266]
 gi|166222155|sp|A1BD22|RL7_CHLPD RecName: Full=50S ribosomal protein L7/L12
 gi|119353428|gb|ABL64299.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Chlorobium
           phaeobacteroides DSM 266]
          Length = 125

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (73%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
           +IE++VE++  LTL EA+EL K LE+++GVSA+  +      AA AG A +  EKTEF+V
Sbjct: 2   SIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAMMAGVMAAAPAGDAPAQEEKTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    + K  I VIK VRA+T LGLKEAK+LV+ APK++K G+SKDEA ++ K+L+D G
Sbjct: 62  VLTAAGESK--INVIKVVRALTGLGLKEAKDLVDGAPKTVKEGISKDEAEKVAKELKDVG 119

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 120 ASVELK 125


>gi|283954232|ref|ZP_06371756.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 414]
 gi|283794250|gb|EFC32995.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 414]
          Length = 125

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA   +AA+E KTEF+VVL 
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGAAAAAEEKTEFDVVLT 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E+KK+LE+AGA V
Sbjct: 65  --DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEVKKQLEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|145220409|ref|YP_001131118.1| 50S ribosomal protein L7/L12 [Prosthecochloris vibrioformis DSM
           265]
 gi|189043005|sp|A4SGK7|RL7_PROVI RecName: Full=50S ribosomal protein L7/L12
 gi|145206573|gb|ABP37616.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Chlorobium
           phaeovibrioides DSM 265]
          Length = 123

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 92/124 (74%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +IE++VE++  LTL +AA L K LE+++GVSA+  +      AA A +AA E+TEF+VVL
Sbjct: 2   SIETLVEEIGGLTLTDAAALVKALEEKFGVSAAPAMVAGVAAAAPAAAAAEEQTEFDVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VRAIT LGLKEAK+LV+ APK++K  +SK++A ++ K+L+DAGA+
Sbjct: 62  TAAGDSK--INVIKVVRAITGLGLKEAKDLVDGAPKAVKEAVSKEDAEKIVKELKDAGAS 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|51209891|ref|YP_063555.1| ribosomal protein L12 [Gracilaria tenuistipitata var. liui]
 gi|68053124|sp|Q6B905|RK12_GRATL RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|50657645|gb|AAT79630.1| 50S ribosomal protein L12 [Gracilaria tenuistipitata var. liui]
          Length = 131

 Score = 97.1 bits (240), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%), Gaps = 6/128 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSAS---APVSVVAPVAAEAGSAAS--EKTEF 58
           I +I+E L SLTL+EAAEL K++E+ + V AS      ++V P A +  +     EKTEF
Sbjct: 5   ITNIIEDLKSLTLLEAAELIKQIEETFDVDASITSQSQAIVMPTAVDNSNKNEIEEKTEF 64

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +++L+      KKIA++K VR+IT LGLKEAK LVESAPK +K   +K+ + E+K++LE+
Sbjct: 65  DIILEEVP-AAKKIAILKVVRSITGLGLKEAKALVESAPKMIKDNTNKENSEEIKQQLEE 123

Query: 119 AGATVELR 126
           AGA V ++
Sbjct: 124 AGAKVSIK 131


>gi|94676695|ref|YP_588936.1| ribosomal protein L7/L12 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123081478|sp|Q1LSX8|RL7_BAUCH RecName: Full=50S ribosomal protein L7/L12
 gi|94219845|gb|ABF14004.1| ribosomal protein L7/L12 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 121

 Score = 97.1 bits (240), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 85/122 (69%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++ +++++  EL   +E+++GVS+   ++ + P ++ A +   EKTEF+VVL  
Sbjct: 6   EQILEAVAKMSILDITELISMMEQKFGVSS---INTIVPTSSPAETV-EEKTEFDVVLTN 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KIAVIK VR +  LGLKEAK+LVESAP +LK  +SKDEA  +KK LEDAGA+VE
Sbjct: 62  IG--ANKIAVIKAVRGVISLGLKEAKDLVESAPITLKESISKDEAAALKKILEDAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|205372079|ref|ZP_03224896.1| 50S ribosomal protein L7/L12 [Bacillus coahuilensis m4-4]
          Length = 121

 Score = 96.7 bits (239), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 90/122 (73%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E  +L K +E+E+GV+A+APV+V+    A  G AA+E+TEF++VL+ 
Sbjct: 4   EQIIDAIKEMTVLELNDLVKAIEEEFGVTAAAPVAVMG--GAAGGDAAAEQTEFDLVLES 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAKELV++ PK+LK G++K+EA E+K KLE+ GA VE
Sbjct: 62  AG--ASKIKVIKVVREITGLGLKEAKELVDNTPKALKEGIAKEEAEELKAKLEEVGAVVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|164686519|ref|ZP_02210547.1| hypothetical protein CLOBAR_00086 [Clostridium bartlettii DSM
           16795]
 gi|164604388|gb|EDQ97853.1| hypothetical protein CLOBAR_00086 [Clostridium bartlettii DSM
           16795]
          Length = 121

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E +  + + E  EL K  E+++GVSASAPV V         +AA EKTEF+V+L
Sbjct: 2   TIEQILEAIEQMKVTELNELVKAAEEKFGVSASAPVMVAGAAGGA--AAAEEKTEFDVIL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K+ VIK VR +T LGLK+AK+LV++APK+LK G SK+EA ++K+KLE AGA+
Sbjct: 60  A--NAGASKVGVIKAVREVTGLGLKDAKDLVDNAPKALKEGASKEEAEQIKEKLEAAGAS 117

Query: 123 VELR 126
           VEL+
Sbjct: 118 VELK 121


>gi|225164278|ref|ZP_03726549.1| ribosomal protein L7/L12 [Opitutaceae bacterium TAV2]
 gi|224801120|gb|EEG19445.1| ribosomal protein L7/L12 [Opitutaceae bacterium TAV2]
          Length = 124

 Score = 96.7 bits (239), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 89/128 (69%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MSNI  + ++E LS+  ++E A L K LE +WGVSA+A V+     AA   + A EKTEF
Sbjct: 1   MSNITKDQVIEWLSAQPVLELAALVKDLEAKWGVSAAAAVAAAPAAAAA--APAEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L   +    KI VIKEVRAIT LGLKEAK+LVE APK +K G SK +A E+KKKLE 
Sbjct: 59  DVILA--NAGANKIGVIKEVRAITGLGLKEAKDLVEGAPKPVKEGASKADAEEIKKKLEA 116

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 117 AGAKVELK 124


>gi|219685444|ref|ZP_03540262.1| ribosomal protein L7/L12 [Borrelia garinii Far04]
 gi|52694930|gb|AAU85616.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|219673000|gb|EED30021.1| ribosomal protein L7/L12 [Borrelia garinii Far04]
          Length = 124

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 5/123 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  L     +E  +L   +E+++GV+A+  +S V   AA  GS  SE +TEF+V+L 
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA--ISAVGGGAASIGSTDSEEQTEFDVILM 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA V
Sbjct: 64  SFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKV 121

Query: 124 ELR 126
           E++
Sbjct: 122 EVK 124


>gi|126724852|ref|ZP_01740695.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2150]
 gi|126706016|gb|EBA05106.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2150]
          Length = 124

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 89/126 (70%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++ +LTL+EA EL   L+ E+G+  +A  +V+     +AG +A  +TEF+V
Sbjct: 1   MADLKKMAEEIVNLTLLEAQELKTILKDEYGIEPAAGGAVMMAAGGDAGESAEAQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       +KI VIKEVRAIT LGLKEAK+LVE+  K++K G+S+ EA+E+K KLE AG
Sbjct: 61  IL--VAAGAQKIGVIKEVRAITGLGLKEAKDLVEAGGKAVKEGVSQAEADEIKAKLEAAG 118

Query: 121 ATVELR 126
           A V L+
Sbjct: 119 AEVTLK 124


>gi|307267201|ref|ZP_07548707.1| ribosomal protein L7/L12 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917780|gb|EFN48048.1| ribosomal protein L7/L12 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 125

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 95/128 (74%), Gaps = 8/128 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
           N E I+E + ++T++E AEL K LE+E+GVSA+APV+V A  AA   +AA   EKTEF+V
Sbjct: 2   NKEEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGVPAAAPAEEKTEFDV 61

Query: 61  VLK--GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +L+  G D    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+
Sbjct: 62  ILQEVGSD----KIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEE 117

Query: 119 AGATVELR 126
            GA VE++
Sbjct: 118 VGAKVEIK 125


>gi|167036792|ref|YP_001664370.1| ribosomal protein L7/L12 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115214|ref|YP_004185373.1| 50S ribosomal protein L7/L12 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|326390670|ref|ZP_08212225.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus JW 200]
 gi|226734486|sp|B0KCJ1|RL7_THEP3 RecName: Full=50S ribosomal protein L7/L12
 gi|166855626|gb|ABY94034.1| ribosomal protein L7/L12 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928305|gb|ADV78990.1| ribosomal protein L7/L12 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993348|gb|EGD51785.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus JW 200]
          Length = 125

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 96/128 (75%), Gaps = 8/128 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
           N E I+E + ++T++E AEL K LE+E+GVSA+APV+V A  AA A +AA   EKTEF+V
Sbjct: 2   NKEEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGAPAAAPAEEKTEFDV 61

Query: 61  VLK--GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +L+  G D    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+
Sbjct: 62  ILQEVGSD----KIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEE 117

Query: 119 AGATVELR 126
            GA VE++
Sbjct: 118 VGAKVEIK 125


>gi|86606437|ref|YP_475200.1| 50S ribosomal protein L7/L12 [Synechococcus sp. JA-3-3Ab]
 gi|109893808|sp|Q2JTQ2|RL7_SYNJA RecName: Full=50S ribosomal protein L7/L12
 gi|86554979|gb|ABC99937.1| ribosomal protein L7/L12 [Synechococcus sp. JA-3-3Ab]
          Length = 137

 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 93/134 (69%), Gaps = 11/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------VVAPVAAEAGSAA 52
            ++ I+E+L +L+L+EA+EL K +E+ +GVSA+AP              AP  A A    
Sbjct: 5   RVQKILEELKALSLLEASELVKAIEEAFGVSAAAPAGGMVMAAPVAAAAAPAPAAAPEPV 64

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            E+T F+V+L+      KKIAV+K VR +T LGLK+AK+LVE+APK +K G+ K+EANE+
Sbjct: 65  EEQTAFDVILEAVP-ADKKIAVLKVVRELTGLGLKDAKDLVEAAPKPVKEGIPKEEANEI 123

Query: 113 KKKLEDAGATVELR 126
           KKKLE+AGATV+++
Sbjct: 124 KKKLEEAGATVKVK 137


>gi|323705652|ref|ZP_08117226.1| ribosomal protein L7/L12 [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535129|gb|EGB24906.1| ribosomal protein L7/L12 [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 124

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 95/125 (76%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           N E I+E + ++T++E A+L K LE+E+GVSA+APV+V A  AA A +A +E KTEF+V+
Sbjct: 2   NKEEILEAIKNMTVLELADLVKALEEEFGVSAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D   +KI VIK VR +T+LGLKEAK+LVE APK +K G+SKDEAN++K K E+ GA
Sbjct: 62  LS--DVGSEKIKVIKVVREVTNLGLKEAKDLVEGAPKPIKEGVSKDEANQIKAKFEEVGA 119

Query: 122 TVELR 126
            VE++
Sbjct: 120 KVEIK 124


>gi|172035139|ref|YP_001801640.1| 50S ribosomal protein L7/L12 [Cyanothece sp. ATCC 51142]
 gi|254806367|sp|B1X073|RL7_CYAA5 RecName: Full=50S ribosomal protein L7/L12
 gi|171696593|gb|ACB49574.1| 50S ribosomal protein L7/L12 [Cyanothece sp. ATCC 51142]
          Length = 133

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 88/129 (68%), Gaps = 8/129 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-------VSVVAPVAAEAGSAASEKTE 57
           + I+EKL SLTL+EA+EL K++E+ +GVSA+AP           A   A A     EKTE
Sbjct: 6   DEILEKLKSLTLLEASELVKQIEEAFGVSAAAPSGGMMMMAPGAAAPGAAAAEPEEEKTE 65

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L+      KKIA++K VR IT LGLKEAK++VES PK +K G  K++A ++KKKLE
Sbjct: 66  FDVILEEVPG-DKKIAILKVVRGITGLGLKEAKDMVESTPKPIKEGTGKEDAEDIKKKLE 124

Query: 118 DAGATVELR 126
           +AGA V ++
Sbjct: 125 EAGAKVSVK 133


>gi|167629457|ref|YP_001679956.1| 50S ribosomal protein l7/l12 [Heliobacterium modesticaldum Ice1]
 gi|226733693|sp|B0TC46|RL7_HELMI RecName: Full=50S ribosomal protein L7/L12
 gi|167592197|gb|ABZ83945.1| 50S ribosomal protein l7/l12 [Heliobacterium modesticaldum Ice1]
          Length = 125

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 94/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           MS I  I+E +  LT++E AEL K  E+E+GVSA+APV++ A   A A +A +E +TEF+
Sbjct: 1   MSKINEIIEAVKGLTVLELAELVKAFEEEFGVSAAAPVAMAAMPVAAAAAAPAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK   D  KK+ VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +KKKLE++
Sbjct: 61  VILKAAGD--KKVNVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKEEAESIKKKLEES 118

Query: 120 GATVELR 126
           GATVE++
Sbjct: 119 GATVEVK 125


>gi|256420753|ref|YP_003121406.1| 50S ribosomal protein L7/L12 [Chitinophaga pinensis DSM 2588]
 gi|256035661|gb|ACU59205.1| ribosomal protein L7/L12 [Chitinophaga pinensis DSM 2588]
          Length = 124

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E+L  LT+ E  EL+  L+ E+G+  +A   VV+       +AA EKT F V
Sbjct: 1   MADVKALAEQLVGLTVKEVQELADFLKSEYGIEPAAAAVVVSGDNGSGAAAAEEKTAFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  +    K+ V+K V+ +T LGLKEAKELV+ APKSLK G+SK EA ++K KL +AG
Sbjct: 61  ILK--NAGASKLNVVKIVKDLTGLGLKEAKELVDGAPKSLKEGVSKAEAEDLKAKLTEAG 118

Query: 121 ATVELR 126
           A VE++
Sbjct: 119 AEVEIQ 124


>gi|77165795|ref|YP_344320.1| 50S ribosomal protein L7/L12 [Nitrosococcus oceani ATCC 19707]
 gi|254434143|ref|ZP_05047651.1| ribosomal protein L7/L12 [Nitrosococcus oceani AFC27]
 gi|109893775|sp|Q3J8Q6|RL7_NITOC RecName: Full=50S ribosomal protein L7/L12
 gi|76884109|gb|ABA58790.1| LSU ribosomal protein L12P [Nitrosococcus oceani ATCC 19707]
 gi|207090476|gb|EDZ67747.1| ribosomal protein L7/L12 [Nitrosococcus oceani AFC27]
          Length = 126

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 94/123 (76%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E I+E +S++T+++  EL + +E+++GVSA+AP++  AP A     AA+ EKTEF+VVL 
Sbjct: 6   EEILETISNMTVMDVVELIEAMEEKFGVSAAAPIAAAAPAAGAEAGAAAEEKTEFDVVLV 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+ VIK VR+IT LGLKEAK+LVE AP  +K G+SKDEA+E+KK+LE+AGA++
Sbjct: 66  SFGS--NKVQVIKAVRSITSLGLKEAKDLVEGAPSPVKEGISKDEADEIKKQLEEAGASI 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|254418132|ref|ZP_05031856.1| ribosomal protein L7/L12 [Brevundimonas sp. BAL3]
 gi|196184309|gb|EDX79285.1| ribosomal protein L7/L12 [Brevundimonas sp. BAL3]
          Length = 127

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 92/129 (71%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS--ASAPVSVVAPVAAEAGSAASEKTEF 58
           M+++  IVE LS+LT++EAAELSK LE++WGVS  A   +++ A   A    AA E+TEF
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAMAMPAGGGAAPAEAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
            VVL   D   KKI VIKEVR + +DLGLKEAK+LVE AP+++   +SK  A+E+ KKL 
Sbjct: 61  TVVL--IDGGDKKINVIKEVRGVRSDLGLKEAKDLVEGAPQNVVENVSKQAADEVAKKLT 118

Query: 118 DAGATVELR 126
           +AGA V+++
Sbjct: 119 EAGAKVQIK 127


>gi|30468132|ref|NP_849019.1| ribosomal protein L12 [Cyanidioschyzon merolae strain 10D]
 gi|68053206|sp|Q85G10|RK12_CYAME RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|30409232|dbj|BAC76181.1| 50S ribosomal protein L12 [Cyanidioschyzon merolae strain 10D]
          Length = 124

 Score = 95.9 bits (237), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           + I S++E++ SLTL+EAAEL K++E  +G+ ASA  +    V  E  +   EKTEF +V
Sbjct: 3   TKINSLLEEIKSLTLLEAAELVKQMETTFGIDASAVATAAPAVQVE--TKKEEKTEFALV 60

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L       KKI V+K VR IT LGLKEAKELV+S PK+LK GLS  EA ++K +L +AGA
Sbjct: 61  LSQVP-ADKKINVLKVVRTITGLGLKEAKELVDSVPKTLKEGLSASEAEQLKTQLTEAGA 119

Query: 122 TVELR 126
            VEL+
Sbjct: 120 QVELK 124


>gi|206901881|ref|YP_002251085.1| ribosomal protein L7/L12 [Dictyoglomus thermophilum H-6-12]
 gi|226733676|sp|B5YEX7|RL7_DICT6 RecName: Full=50S ribosomal protein L7/L12
 gi|206740984|gb|ACI20042.1| ribosomal protein L7/L12 [Dictyoglomus thermophilum H-6-12]
          Length = 125

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSA-ASEKTEFEV 60
           N E I++ +  + + E  EL K LE+E+GVSA+ PV+ V +PVA  A +A   EKT F+V
Sbjct: 2   NKEEIIQAIKEMKVTELVELVKALEEEFGVSAAMPVAAVGSPVAGAAAAAPVEEKTTFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D    KI V+K VR IT LGLKEAK+LV+S PK +K G+SK EA E+K KLE  G
Sbjct: 62  ILK--DAGANKIKVLKVVREITGLGLKEAKDLVDSTPKPIKEGVSKQEAEEIKAKLEAEG 119

Query: 121 ATVELR 126
           A VE++
Sbjct: 120 AVVEIK 125


>gi|194337662|ref|YP_002019456.1| ribosomal protein L7/L12 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226733715|sp|B4SG12|RL7_PELPB RecName: Full=50S ribosomal protein L7/L12
 gi|194310139|gb|ACF44839.1| ribosomal protein L7/L12 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 124

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           +IE++VE++  LTL EA+EL K LE+++GVSA+         AA   +   E +TEF+VV
Sbjct: 2   SIETLVEEIGKLTLTEASELVKALEEKFGVSAAPVAVAGVAAAAAGDAPVVEEQTEFDVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    + K  I VIK VRAIT LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+DAGA
Sbjct: 62  LTAAGESK--INVIKAVRAITGLGLKEAKDLVDGAPKTVKEAISKDEAEKIAKELKDAGA 119

Query: 122 TVELR 126
           +VE++
Sbjct: 120 SVEVK 124


>gi|194476826|ref|YP_002049005.1| 50S ribosomal protein L7/L12 [Paulinella chromatophora]
 gi|171191833|gb|ACB42795.1| 50S ribosomal protein L7/L12 [Paulinella chromatophora]
          Length = 129

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 84/128 (65%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTEF 58
           +  + I+E L +L+L+EA+EL K++E+ +GVSASA   ++      A     A  E+TEF
Sbjct: 3   TKTDEILESLKTLSLLEASELVKQIEEAFGVSASAGAGIMMAAPVAAGGVADAVEEQTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+ FD    KI V+K VR  T LGL EAK LVESAPK++K G++KDEA  +KK +E 
Sbjct: 63  DVILESFD-AAAKIKVLKAVREATSLGLGEAKALVESAPKAIKEGIAKDEAEALKKAIEA 121

Query: 119 AGATVELR 126
            G  V L+
Sbjct: 122 VGGKVTLK 129


>gi|268678993|ref|YP_003303424.1| ribosomal protein L7/L12 [Sulfurospirillum deleyianum DSM 6946]
 gi|268617024|gb|ACZ11389.1| ribosomal protein L7/L12 [Sulfurospirillum deleyianum DSM 6946]
          Length = 124

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S L+++E ++L K  E+++GVSA APV V    A  A +A  EKTEF+V+LK 
Sbjct: 6   EDVLEYISGLSVLELSQLVKDFEEKFGVSA-APVMVAGAGAGVAAAAVEEKTEFDVILK- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D  +KKI  IK VR IT LGLKEAK+ VE AP ++K G+SK+ A E+KKKLE+AGA  E
Sbjct: 64  -DGGEKKINAIKVVREITGLGLKEAKDAVEGAPTTIKEGVSKELAEEIKKKLEEAGAVAE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|157165629|ref|YP_001466544.1| 50S ribosomal protein L7/L12 [Campylobacter concisus 13826]
 gi|166222149|sp|A7ZCN6|RL7_CAMC1 RecName: Full=50S ribosomal protein L7/L12
 gi|112800033|gb|EAT97377.1| ribosomal protein L7/L12 [Campylobacter concisus 13826]
          Length = 125

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +     VAA   +AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAVAAGGAAAAEEKTEFNIVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 64  VDSGDKKINVIKVVRALTGLGLKEAKDAVEGTPSVLKEGVSKDEAEAAKKELEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|330814207|ref|YP_004358446.1| LSU ribosomal protein L7/L12 (P1/P2) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487302|gb|AEA81707.1| LSU ribosomal protein L7/L12 (P1/P2) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 123

 Score = 95.9 bits (237), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/126 (57%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS LT++EAAELSK LE++WGV+A+APV+V A  AA    AA EKT+F V
Sbjct: 1   MTDLNKIVEDLSKLTVVEAAELSKTLEEKWGVTAAAPVAVAAAGAAGG-EAAEEKTDFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D   KI  IKEVRA T LGLKEAK+LVE+APK LK G++K +A E++KK    G
Sbjct: 60  VLTAAGD--NKIGAIKEVRAFTGLGLKEAKDLVEAAPKELKQGVAKKDAEELQKKFAAIG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|114570353|ref|YP_757033.1| 50S ribosomal protein L12P [Maricaulis maris MCS10]
 gi|122315779|sp|Q0ANP2|RL7_MARMM RecName: Full=50S ribosomal protein L7/L12
 gi|114340815|gb|ABI66095.1| LSU ribosomal protein L12P [Maricaulis maris MCS10]
          Length = 123

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 89/126 (70%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  + ++L +LT++EA EL+  LE E G+ A+A V+V  P       AA EK EF+V
Sbjct: 1   MADVAKLCDELLALTILEAKELNDLLE-EKGIKAAAAVAVAGPAGGGDAPAAEEKDEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL G  D  KKI VIKEVRAIT LGLKEAK+LVE APK++K   SK EA E+K KLE AG
Sbjct: 60  VLTGAGD--KKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAASKTEAEEIKAKLEAAG 117

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 118 ASVELK 123


>gi|258646903|ref|ZP_05734372.1| ribosomal protein L7/L12 [Dialister invisus DSM 15470]
 gi|260404343|gb|EEW97890.1| ribosomal protein L7/L12 [Dialister invisus DSM 15470]
          Length = 123

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 93/122 (76%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +S ++++E +EL K +E+++GVSA+APV+V A   A   +AA EK+EF+V+LK 
Sbjct: 4   EEILNAISEMSVLELSELVKAIEEKFGVSAAAPVAVAAAAPAAGAAAAEEKSEFDVILK- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR IT LGLKEAK LV+ APK +KTG++K EA E+KKKLE+AGATVE
Sbjct: 63  -EAGAQKIQVIKAVREITALGLKEAKALVDGAPKEVKTGVAKAEAEEIKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|114319611|ref|YP_741294.1| 50S ribosomal protein L7/L12 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312462|sp|Q0ABI3|RL7_ALHEH RecName: Full=50S ribosomal protein L7/L12
 gi|114226005|gb|ABI55804.1| LSU ribosomal protein L12P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 125

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  EL + +E+++GV+A+A V+     A     AA E+TEF+VVL  
Sbjct: 6   EEILETISNMTVMEVVELIEEMEEKFGVTAAAAVAAAPAAAGGEAEAAEEQTEFDVVLSS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR IT LGLKEAKE+VE AP  +K G SK+EA E+K KLE+AGA+VE
Sbjct: 66  FGS--NKVAVIKAVRGITGLGLKEAKEVVEGAPSPIKEGASKEEAEEIKAKLEEAGASVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|118474733|ref|YP_892469.1| 50S ribosomal protein L7/L12 [Campylobacter fetus subsp. fetus
           82-40]
 gi|166222151|sp|A0RQI6|RL7_CAMFF RecName: Full=50S ribosomal protein L7/L12
 gi|118413959|gb|ABK82379.1| ribosomal protein L7/L12 [Campylobacter fetus subsp. fetus 82-40]
          Length = 124

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA APV V       A  AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSA-APVMVAGAAGGAAVEAAEEKTEFNIVL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 63  VDAGDKKINVIKVVRALTGLGLKEAKDAVEGTPSVLKEGVSKDEAEAAKKELEEAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|84499872|ref|ZP_00998138.1| ribosomal protein L7/L12 [Oceanicola batsensis HTCC2597]
 gi|84391806|gb|EAQ04074.1| ribosomal protein L7/L12 [Oceanicola batsensis HTCC2597]
          Length = 127

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 89/129 (68%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTE 57
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+        +AG+A  EKTE
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGGDAGAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       KI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA E+K KLE
Sbjct: 61  FDVILK--SAGASKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEEIKGKLE 118

Query: 118 DAGATVELR 126
            AGA +EL+
Sbjct: 119 AAGAEIELK 127


>gi|22297842|ref|NP_681089.1| 50S ribosomal protein L7/L12 [Thermosynechococcus elongatus BP-1]
 gi|81743859|sp|Q8DM25|RL7_THEEB RecName: Full=50S ribosomal protein L7/L12
 gi|22294019|dbj|BAC07851.1| 50S ribosomal protein L12 [Thermosynechococcus elongatus BP-1]
          Length = 132

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 88/126 (69%), Gaps = 7/126 (5%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------VVAPVAAEAGSAASEKTEFEV 60
           I+EKL SLTL+EAAEL K++E+ +GVSA+APV        VA  AA       EKT F+V
Sbjct: 8   ILEKLKSLTLLEAAELVKQIEETFGVSAAAPVGGMMVAAPVAGAAAAPAEEVEEKTAFDV 67

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+      KKIAV+K VR++T LGLKEAKE+VES PK +K G SK++A   KK+LE+AG
Sbjct: 68  ILEEVP-ADKKIAVLKVVRSLTGLGLKEAKEVVESTPKPVKEGASKEDAEAAKKELEEAG 126

Query: 121 ATVELR 126
           A V ++
Sbjct: 127 AKVSIK 132


>gi|256826694|ref|YP_003150653.1| 50S ribosomal protein L12P [Cryptobacterium curtum DSM 15641]
 gi|256582837|gb|ACU93971.1| LSU ribosomal protein L12P [Cryptobacterium curtum DSM 15641]
          Length = 126

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 94/123 (76%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A        AA+E K+EF+VVL+
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAVAGGADAGAAAEEKSEFDVVLE 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GF D   KIAVIK VR +T LGLKEAKELVE APK++K G++K++A+EMK KLE+AGA V
Sbjct: 66  GFGD--NKIAVIKVVRELTGLGLKEAKELVEGAPKAIKEGVAKEQADEMKGKLEEAGAAV 123

Query: 124 ELR 126
            L+
Sbjct: 124 TLK 126


>gi|52694910|gb|AAU85606.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694914|gb|AAU85608.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694928|gb|AAU85615.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694934|gb|AAU85618.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694936|gb|AAU85619.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 83/123 (67%), Gaps = 5/123 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  L     +E  +L   +E+++GV+A+  +S +   AA  G+  SE +TEF+V+L 
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA--ISAIGGGAASTGATDSEEQTEFDVILM 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA V
Sbjct: 64  SFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKV 121

Query: 124 ELR 126
           E++
Sbjct: 122 EVK 124


>gi|116074055|ref|ZP_01471317.1| ribosomal protein L7/L12 [Synechococcus sp. RS9916]
 gi|116069360|gb|EAU75112.1| ribosomal protein L7/L12 [Synechococcus sp. RS9916]
          Length = 129

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTEF 58
           +  + I+E+L +L+L+EA+EL K++E+ +GVSA+A   VV      A   G AA EKTEF
Sbjct: 3   ATTDQILEQLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAPGAAGGGGEAAEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+ FD    KI V+K VR  T LGL +AK LVE+APK++K G SKD+A  +KK +E+
Sbjct: 63  DVVLESFD-ASAKIKVLKAVREATGLGLGDAKALVEAAPKAVKEGASKDDAEALKKAIEE 121

Query: 119 AGATVELR 126
           AG  V L+
Sbjct: 122 AGGKVTLK 129


>gi|224372231|ref|YP_002606603.1| ribosomal protein L7/L12 [Nautilia profundicola AmH]
 gi|254806386|sp|B9L7J5|RL7_NAUPA RecName: Full=50S ribosomal protein L7/L12
 gi|223588832|gb|ACM92568.1| ribosomal protein L7/L12 [Nautilia profundicola AmH]
          Length = 124

 Score = 95.1 bits (235), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 3/125 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
              E I+E + +LT+ E  EL K  E+++ VSA  P  V       AG A  EKTEF+V+
Sbjct: 3   CTFEQILETIENLTVKELNELVKLFEEKFDVSAQ-PTVVAGAAGGAAGGAGEEKTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  D   KKI VIK VR IT  GLKEAKE+V+ AP ++K  +SK+EA E+KK+LE+AGA
Sbjct: 62  LK--DAGAKKINVIKVVRQITGAGLKEAKEIVDGAPSTIKEAVSKEEAEEIKKQLEEAGA 119

Query: 122 TVELR 126
           TVE++
Sbjct: 120 TVEVK 124


>gi|255322045|ref|ZP_05363193.1| ribosomal protein L7/L12 [Campylobacter showae RM3277]
 gi|255300858|gb|EET80127.1| ribosomal protein L7/L12 [Campylobacter showae RM3277]
          Length = 125

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 86/123 (69%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA   + A+E KTEF VVL 
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGAADAAEEKTEFNVVL- 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P  +K G+SKDEA   KK+LE+AGA V
Sbjct: 64  -VDGGDKKINVIKVVRALTGLGLKEAKDAVEQTPSVIKEGVSKDEAEAAKKELEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|157825319|ref|YP_001493039.1| 50S ribosomal protein L7/L12 [Rickettsia akari str. Hartford]
 gi|166222202|sp|A8GMA6|RL7_RICAH RecName: Full=50S ribosomal protein L7/L12
 gi|157799277|gb|ABV74531.1| 50S ribosomal protein L7/L12 [Rickettsia akari str. Hartford]
          Length = 124

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 93/126 (73%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  I E+LSSLTL++AAEL K LE++W VSA+APV+V A  AA A  A +EKTEFE+
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWCVSAAAPVAVAAAGAAPAAEAVAEKTEFEI 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D  KK+ VIK V+ IT LGL EAK+LV+ APK +K+ + K EA E+K KLE AG
Sbjct: 61  VLIAAGD--KKVEVIKAVKDITGLGLIEAKKLVDEAPKLMKSNVKKAEAEEIKGKLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|167039511|ref|YP_001662496.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X514]
 gi|256752778|ref|ZP_05493623.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915238|ref|ZP_07132553.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X561]
 gi|307725162|ref|YP_003904913.1| 50S ribosomal protein L7/L12 [Thermoanaerobacter sp. X513]
 gi|226734487|sp|B0K5G7|RL7_THEPX RecName: Full=50S ribosomal protein L7/L12
 gi|166853751|gb|ABY92160.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X514]
 gi|256748339|gb|EEU61398.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888962|gb|EFK84109.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X561]
 gi|307582223|gb|ADN55622.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X513]
          Length = 125

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 8/126 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+E + ++T++E AEL K LE+E+GVSA+APV+V A  AA A +AA   EKTEF+V+L
Sbjct: 4   EEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGAPAAAPAEEKTEFDVIL 63

Query: 63  K--GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +  G D    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+ G
Sbjct: 64  QEVGSD----KIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEEVG 119

Query: 121 ATVELR 126
           A VE++
Sbjct: 120 AKVEIK 125


>gi|300114744|ref|YP_003761319.1| 50S ribosomal protein L7/l12 [Nitrosococcus watsonii C-113]
 gi|300114756|ref|YP_003761331.1| 50S ribosomal protein L7/l12 [Nitrosococcus watsonii C-113]
 gi|299540681|gb|ADJ28998.1| ribosomal protein L7/L12 [Nitrosococcus watsonii C-113]
 gi|299540693|gb|ADJ29010.1| ribosomal protein L7/L12 [Nitrosococcus watsonii C-113]
          Length = 126

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 93/123 (75%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E I+E +S++T+++  EL + +E+++GVSA+APV+  AP A     AA+ EKTEF+V+L 
Sbjct: 6   EEILETISNMTVMDVVELIEAMEEKFGVSAAAPVAAAAPAAGAEAGAAAEEKTEFDVILA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+ VIK VR+IT LGLKEAKELVE AP  +K G+ KDEA+E+KK+LE+AGA++
Sbjct: 66  SFGS--NKVQVIKAVRSITSLGLKEAKELVEGAPSPIKEGVPKDEADEIKKQLEEAGASI 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|260893759|ref|YP_003239856.1| ribosomal protein L7/L12 [Ammonifex degensii KC4]
 gi|260865900|gb|ACX53006.1| ribosomal protein L7/L12 [Ammonifex degensii KC4]
          Length = 128

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 96/130 (73%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKT 56
           MS +  I+E +  LT++E A+L K LE+E+GV+A+APV+V A  AA A + A+    EKT
Sbjct: 1   MSKVAEIIEAIKGLTVVELADLVKALEEEFGVTAAAPVAVAAAPAAGAAAPAAAPAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L    D  KKI VIK VR IT LGLKEAK+LV++APK +K  +SK+EA  +KKKL
Sbjct: 61  EFDVILTSAGD--KKINVIKVVREITGLGLKEAKDLVDNAPKPVKEKVSKEEAEAIKKKL 118

Query: 117 EDAGATVELR 126
           E+AGATVE++
Sbjct: 119 EEAGATVEIK 128


>gi|269121547|ref|YP_003309724.1| ribosomal protein L7/L12 [Sebaldella termitidis ATCC 33386]
 gi|268615425|gb|ACZ09793.1| ribosomal protein L7/L12 [Sebaldella termitidis ATCC 33386]
          Length = 123

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N +  +E L ++T++E  E+ + +E+ +GVSA  PV+V A   A A +A  EK+EF+V+L
Sbjct: 4   NKDQFIEDLKNMTVLELKEVVEAIEETFGVSAQ-PVAVAAGAGAGA-AAVEEKSEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GF +  KK AVIKEVR IT LGLKEAK+LVE+  K++K G SKDEA ++K +LE AGAT
Sbjct: 62  TGFGE--KKTAVIKEVRTITGLGLKEAKDLVEAGGKAVKEGASKDEAEKIKAQLEAAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|269991321|emb|CAX12505.1| 50S ribosomal protein L12 [Fucus vesiculosus]
          Length = 132

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 91/130 (70%), Gaps = 9/130 (6%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSA----SAPVSVVAP--VAAEAGSAASEKTE 57
           I +++E+L +LTL+EAAEL K +E+ + V A    ++ V ++ P  ++ E  +   EKTE
Sbjct: 5   ISTLIEELKTLTLLEAAELVKSIEETFDVDAPTGGASGVMMMNPGAISTEDNNTVEEKTE 64

Query: 58  FEVVLKGFDDPK-KKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F+V L+  + PK KKIA++K VR++T+LGLKEAKE+VE+ PK +K GL K  A E KK L
Sbjct: 65  FDVSLE--EVPKDKKIAILKVVRSVTELGLKEAKEVVENTPKVIKEGLPKVAAEEAKKLL 122

Query: 117 EDAGATVELR 126
           EDAGA V L+
Sbjct: 123 EDAGAVVILK 132


>gi|73748757|ref|YP_307996.1| 50S ribosomal protein L7/L12 [Dehalococcoides sp. CBDB1]
 gi|109893761|sp|Q3ZXY0|RL7_DEHSC RecName: Full=50S ribosomal protein L7/L12
 gi|73660473|emb|CAI83080.1| ribosomal protein L7 [Dehalococcoides sp. CBDB1]
          Length = 123

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 86/123 (69%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ ++  +  +T+IE +EL K LEKE+GVSA+  V+      A A +A  EKTEF V+LK
Sbjct: 3   IDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAAPTAGGAAAAAAVEEKTEFNVILK 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR +T LGLKEAK++VE+APK++K  +SK+EA+  KK LE AGATV
Sbjct: 63  --DVGANKINVIKAVRELTSLGLKEAKDMVEAAPKAVKENVSKEEADAAKKALEAAGATV 120

Query: 124 ELR 126
           E++
Sbjct: 121 EIK 123


>gi|225849556|ref|YP_002729721.1| 50S ribosomal protein L7/L12 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644121|gb|ACN99171.1| ribosomal protein L7/L12 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 127

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I E + S+T++E A+L K LE+E+GVSA+A V+     A  A + A+E KTEF+V+L 
Sbjct: 7   EEIKEAIKSMTVLELAQLVKDLEEEFGVSAAAMVAAAPAAAGGAAAPAAEEKTEFDVILA 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KI VIK VR IT LGLKEAK+LVE APK +K G+SK+EA ++KKKLE+AGATV
Sbjct: 67  --NPGANKINVIKVVREITGLGLKEAKDLVEGAPKPIKEGVSKEEAEQIKKKLEEAGATV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EIK 127


>gi|85858137|ref|YP_460339.1| 50S ribosomal protein L7/L12 [Syntrophus aciditrophicus SB]
 gi|85721228|gb|ABC76171.1| LSU ribosomal protein L7/L12 [Syntrophus aciditrophicus SB]
          Length = 140

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E +V+ +  +T++E +EL K LE+ +GVSA+APV+V A   A   +AA    KTEF+ +L
Sbjct: 19  EDVVKFIEGMTVLELSELVKELEERFGVSAAAPVAVAAVAGAAGEAAAPAEEKTEFDAIL 78

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GF D  +KI VIK VRAIT LGLKEAK+LVE APK +K  +SKDEA ++KKK+E+ G T
Sbjct: 79  TGFGD--QKIQVIKVVRAITGLGLKEAKDLVEGAPKPIKEAVSKDEAADIKKKIEEVGGT 136

Query: 123 VELR 126
           VE++
Sbjct: 137 VEVK 140


>gi|188996247|ref|YP_001930498.1| ribosomal protein L7/L12 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226734483|sp|B2V7M1|RL7_SULSY RecName: Full=50S ribosomal protein L7/L12
 gi|188931314|gb|ACD65944.1| ribosomal protein L7/L12 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 128

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/124 (54%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I E + S+T++E A+L K LE+E+GVSA+A V+        AG+AA   EKTEF+V+L
Sbjct: 7   EEIKEAIKSMTVLELAQLVKDLEEEFGVSAAAMVAAAPAAGGAAGAAAPAEEKTEFDVIL 66

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR IT LGLKEAK+LV+ APK +K G+SKDEA ++KKKLE+AGAT
Sbjct: 67  T--NAGANKINVIKVVREITGLGLKEAKDLVDGAPKPVKEGVSKDEAEQIKKKLEEAGAT 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEVK 128


>gi|294056236|ref|YP_003549894.1| ribosomal protein L7/L12 [Coraliomargarita akajimensis DSM 45221]
 gi|293615569|gb|ADE55724.1| ribosomal protein L7/L12 [Coraliomargarita akajimensis DSM 45221]
          Length = 128

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 6/130 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKT 56
           MS+I  E ++E LS+ T++E A+L K LE +WGVSA+APV+V A   A  G A +  EK 
Sbjct: 1   MSDITKEQVIEWLSAQTVLEVADLVKELEDKWGVSAAAPVAVAAAGPAAGGDAPAAEEKD 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L   +    KIAVIKEVRAIT LGLKEAKELVESAPK +K G +KDEA E+KKKL
Sbjct: 61  EFDVIL--AEAGGNKIAVIKEVRAITGLGLKEAKELVESAPKPVKEGAAKDEAEEIKKKL 118

Query: 117 EDAGATVELR 126
           E AGA  EL+
Sbjct: 119 EAAGAKAELK 128


>gi|109893807|sp|Q2LQ88|RL7_SYNAS RecName: Full=50S ribosomal protein L7/L12
          Length = 129

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E +V+ +  +T++E +EL K LE+ +GVSA+APV+V A   A   +AA    KTEF+ +L
Sbjct: 8   EDVVKFIEGMTVLELSELVKELEERFGVSAAAPVAVAAVAGAAGEAAAPAEEKTEFDAIL 67

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GF D  +KI VIK VRAIT LGLKEAK+LVE APK +K  +SKDEA ++KKK+E+ G T
Sbjct: 68  TGFGD--QKIQVIKVVRAITGLGLKEAKDLVEGAPKPIKEAVSKDEAADIKKKIEEVGGT 125

Query: 123 VELR 126
           VE++
Sbjct: 126 VEVK 129


>gi|222823478|ref|YP_002575052.1| 50S ribosomal protein L7/L12 [Campylobacter lari RM2100]
 gi|254806269|sp|B9KFG6|RL7_CAMLR RecName: Full=50S ribosomal protein L7/L12
 gi|222538700|gb|ACM63801.1| 50S ribosomal protein L7/L12 [Campylobacter lari RM2100]
          Length = 125

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +   A VA  AG AA EKTEF++VL+ 
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGAAVAGAAGGAAEEKTEFDIVLQ- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SK EA E KK+LE+AGA VE
Sbjct: 65  -DGGDKKINVIKVVRALTGLGLKEAKDAVEQTPSVLKEGVSKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|86608700|ref|YP_477462.1| 50S ribosomal protein L7/L12 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|109893809|sp|Q2JM48|RL7_SYNJB RecName: Full=50S ribosomal protein L7/L12
 gi|86557242|gb|ABD02199.1| ribosomal protein L7/L12 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 136

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 61/133 (45%), Positives = 92/133 (69%), Gaps = 10/133 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---------VVAPVAAEAGSAAS 53
            +  I+E+L +L+L+EA+EL K +E+ +GVSA+AP             A   A A     
Sbjct: 5   RVAKILEELKALSLLEASELVKAIEETFGVSAAAPAGGMVMAAPVAAAAAAPAAAPEPVE 64

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+T F+V+L+      KKIA++K VR +T LGLK+AK+LVE+APK +K G++K+EAN++K
Sbjct: 65  EQTAFDVILEAVP-ADKKIAILKVVRELTGLGLKDAKDLVEAAPKPVKEGVAKEEANDIK 123

Query: 114 KKLEDAGATVELR 126
           KKLE+AGATV+++
Sbjct: 124 KKLEEAGATVKIK 136


>gi|159042822|ref|YP_001531616.1| 50S ribosomal protein L7/L12 [Dinoroseobacter shibae DFL 12]
 gi|157910582|gb|ABV92015.1| 50S ribosomal protein L7/L12 [Dinoroseobacter shibae DFL 12]
          Length = 126

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL   L+ E+G+  +A   V +  P   +AG+AA E+TEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGDAGAAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK      +KI VIKEVRA+T LGLKEAKELVE+  K++K G+ K EA E+K KLE 
Sbjct: 61  DVILKAA--GAQKINVIKEVRALTGLGLKEAKELVEAGGKAVKEGVDKAEAEEIKGKLEA 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|292492413|ref|YP_003527852.1| ribosomal protein L7/L12 [Nitrosococcus halophilus Nc4]
 gi|291581008|gb|ADE15465.1| ribosomal protein L7/L12 [Nitrosococcus halophilus Nc4]
          Length = 127

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 95/124 (76%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+E +S++T+++  EL + +E+++GVSA+APV+ VA  AA A + A+  EKTEF+VV+
Sbjct: 6   EEILETISNMTVMDVVELIEAMEEKFGVSAAAPVAAVAAPAAGAEAGAAAEEKTEFDVVM 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     K+ VIK VR +T LGLKEAKELVE AP ++K G+SKDEA ++KK+LE+AGA+
Sbjct: 66  TSF--GSNKVQVIKAVRGVTGLGLKEAKELVEGAPSAVKEGVSKDEAEDVKKQLEEAGAS 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEVK 127


>gi|315639009|ref|ZP_07894179.1| ribosomal protein L7/L12 [Campylobacter upsaliensis JV21]
 gi|315480921|gb|EFU71555.1| ribosomal protein L7/L12 [Campylobacter upsaliensis JV21]
          Length = 125

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 90/123 (73%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA  G+AA+E KTEF++VL 
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGGAAAAEEKTEFDIVLT 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K +A E KK+LE+AGA V
Sbjct: 65  --DSGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKADAEEAKKQLEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|319957694|ref|YP_004168957.1| LSU ribosomal protein l12p [Nitratifractor salsuginis DSM 16511]
 gi|319420098|gb|ADV47208.1| LSU ribosomal protein L12P [Nitratifractor salsuginis DSM 16511]
          Length = 124

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA A V V A   A  G A  E+TEF+VVL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAQATV-VAAAPGAAGGEAEEEQTEFDVVLT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRA+T LGLKEAK  VE  P  +K G+SK+EA E+KK+ E+AGATVE
Sbjct: 64  -SPGAKKINVIKVVRAVTGLGLKEAKAAVEETPTVIKEGVSKEEAEELKKQFEEAGATVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|110833238|ref|YP_692097.1| 50S ribosomal protein L7/L12 [Alcanivorax borkumensis SK2]
 gi|123345814|sp|Q0VSM3|RL7_ALCBS RecName: Full=50S ribosomal protein L7/L12
 gi|110646349|emb|CAL15825.1| 50S ribosomal protein L7/L12 [Alcanivorax borkumensis SK2]
          Length = 125

 Score = 94.4 bits (233), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  EL + +E+++GV+A+A V+     A    +AA E+TEF+VVL  
Sbjct: 6   EDILGAIADMSVMDLVELIEAMEEKFGVTAAAAVAAAPAAAGGDAAAAEEQTEFDVVLSS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D  KK+ VIK VR +T LGLKEAKELVESAP  +K G +KDEA E+KKK+E+AG T E
Sbjct: 66  FGD--KKVGVIKAVREVTGLGLKEAKELVESAPAPVKEGATKDEAEEIKKKIEEAGGTAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|317123105|ref|YP_004103108.1| 50S ribosomal protein L12P [Thermaerobacter marianensis DSM 12885]
 gi|315593085|gb|ADU52381.1| LSU ribosomal protein L12P [Thermaerobacter marianensis DSM 12885]
          Length = 127

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 96/129 (74%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           MS ++ +++ +  +T++E AEL K+ E+E+GVSA+APV+V AP A  A +A +   EKTE
Sbjct: 1   MSKVQEVLDIVKGMTVLELAELVKKFEEEFGVSAAAPVAVAAPGAPAAAAAPAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LK  D    KI VIK VR +T LGLKEAK+LV++APK LK G+SK+EA ++K KL 
Sbjct: 61  FNVILK--DVGANKIQVIKVVRELTGLGLKEAKDLVDNAPKPLKEGVSKEEAEQIKAKLA 118

Query: 118 DAGATVELR 126
           +AGATVE++
Sbjct: 119 EAGATVEIQ 127


>gi|110639543|ref|YP_679752.1| 50S ribosomal protein L7/L12 [Cytophaga hutchinsonii ATCC 33406]
 gi|122966546|sp|Q11QA4|RL7_CYTH3 RecName: Full=50S ribosomal protein L7/L12
 gi|110282224|gb|ABG60410.1| LSU ribosomal protein L12P [Cytophaga hutchinsonii ATCC 33406]
          Length = 123

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L+ E+G+  +A   VV+    +A +A  EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELASILKDEYGIEPAAAAVVVSG-GGDAAAAVEEKTAFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAK+LV+ APK +K G SKDEA  +KK+LE+AG
Sbjct: 60  ILKSAG--ASKLAVVKLVKDLTGLGLKEAKDLVDGAPKPVKEGASKDEAEAIKKQLEEAG 117

Query: 121 ATVELR 126
           A VE++
Sbjct: 118 AEVEIK 123


>gi|167644756|ref|YP_001682419.1| 50S ribosomal protein L7/L12 [Caulobacter sp. K31]
 gi|189042984|sp|B0SUP3|RL7_CAUSK RecName: Full=50S ribosomal protein L7/L12
 gi|167347186|gb|ABZ69921.1| ribosomal protein L7/L12 [Caulobacter sp. K31]
          Length = 126

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           MS +E +VE+LS+L+++EAA+LSK LE++WGVS A+   +     AA    AA E+TEF 
Sbjct: 1   MSKLEKLVEELSALSVLEAADLSKLLEEKWGVSAAAPVAAAGPAAAAAPAEAAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           VVL    D  KKI VIKEVR +  DLGLKEAK+LVE AP+++   +SK  A E+ KKL +
Sbjct: 61  VVLTAGGD--KKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVVENVSKQVAEEIAKKLTE 118

Query: 119 AGATVELR 126
           AGATV+++
Sbjct: 119 AGATVQVK 126


>gi|108773383|ref|YP_635845.1| ribosomal protein L12 [Oltmannsiellopsis viridis]
 gi|122244722|sp|Q20F00|RK12_OLTVI RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|82541965|gb|ABB82006.1| ribosomal protein L12 [Oltmannsiellopsis viridis]
          Length = 129

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 85/130 (65%), Gaps = 7/130 (5%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSA--ASEKT 56
           MS    I+EKL +LTL+EAAEL  ++E+ +GV ASAPV   +V  V    G+A   +EKT
Sbjct: 1   MSTTSEIIEKLKTLTLLEAAELVSQIEETFGVDASAPVGGGMVMAVGDAGGAAEEVAEKT 60

Query: 57  EFEVVLKGFDDPK-KKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            F+VV++  D P  K++AV+K +R +T LGL E K    S P +L+ G+SK+EA   K +
Sbjct: 61  TFDVVVE--DIPSDKRVAVLKVIRKLTSLGLAEVKAFTNSLPGTLQEGISKEEAETAKTE 118

Query: 116 LEDAGATVEL 125
           LE AGA V++
Sbjct: 119 LEAAGAVVKI 128


>gi|261886296|ref|ZP_06010335.1| 50S ribosomal protein L7/L12 [Campylobacter fetus subsp. venerealis
           str. Azul-94]
          Length = 124

 Score = 94.0 bits (232), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GV A APV V       A  AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVGA-APVMVAGAAGGAAVEAAEEKTEFNIVL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 63  VDAGDKKIHVIKVVRALTGLGLKEAKDAVEGTPSVLKEGVSKDEAEAAKKELEEAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|78188334|ref|YP_378672.1| 50S ribosomal protein L7/L12 [Chlorobium chlorochromatii CaD3]
 gi|109893755|sp|Q3ATP6|RL7_CHLCH RecName: Full=50S ribosomal protein L7/L12
 gi|78170533|gb|ABB27629.1| LSU ribosomal protein L12P [Chlorobium chlorochromatii CaD3]
          Length = 124

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           +IE++VE++  LTL EAA L K LE+++GVSA+         A     AA  E+TEF VV
Sbjct: 2   SIENLVEEIGKLTLTEAAALVKALEEKFGVSAAPVAVAAGVAAPAGDVAAVEEQTEFTVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    + K  I VIK VR+IT LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+DAGA
Sbjct: 62  LVAAGESK--INVIKVVRSITGLGLKEAKDLVDGAPKNVKEAISKDEAEKIAKELKDAGA 119

Query: 122 TVELR 126
           +VE++
Sbjct: 120 SVEVK 124


>gi|296120713|ref|YP_003628491.1| ribosomal protein L7/L12 [Planctomyces limnophilus DSM 3776]
 gi|296013053|gb|ADG66292.1| ribosomal protein L7/L12 [Planctomyces limnophilus DSM 3776]
          Length = 130

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 56/120 (46%), Positives = 82/120 (68%), Gaps = 4/120 (3%)

Query: 9   EKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           +K+ +LTL++A  L+  LE+  G+  +  A V       A   +   EKTEF+V+L GF 
Sbjct: 13  DKIVALTLLQAKALADYLEQVHGIKPAGGAVVMAPGGGGAAPAAPVEEKTEFDVILTGFG 72

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           D   K++VIK VR  T LGLKEAK+LVE APK +KTG+SK++A+++KK+LE +GAT E++
Sbjct: 73  D--NKLSVIKVVRTATGLGLKEAKDLVEGAPKPVKTGISKEDADKLKKELEASGATAEIK 130


>gi|223038912|ref|ZP_03609204.1| ribosomal protein L7/L12 [Campylobacter rectus RM3267]
 gi|222879885|gb|EEF14974.1| ribosomal protein L7/L12 [Campylobacter rectus RM3267]
          Length = 125

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 85/123 (69%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA   + A+E KTEF VVL 
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGAADAAEEKTEFNVVL- 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P  +K G+ KDEA   KK+LE+AGA V
Sbjct: 64  -VDGGDKKINVIKVVRALTGLGLKEAKDAVEQTPSVIKEGIGKDEAEAAKKELEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|167465652|ref|ZP_02330741.1| 50S ribosomal protein L7/L12 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381136|ref|ZP_08055139.1| 50S ribosomal protein L7/L12-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154712|gb|EFX46983.1| 50S ribosomal protein L7/L12-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 122

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T++E  +L K +E+E+GV+A+APV+V+   A  A  AA+E++EF+VVL  
Sbjct: 4   EQILEAIKGMTVLELNDLVKAIEEEFGVTAAAPVAVMGGAAGGA-DAAAEQSEFDVVLT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAKELV++APK++K  + K+EA  ++ KL DAGA VE
Sbjct: 62  -NPGASKINVIKVVREITGLGLKEAKELVDNAPKAIKEKVRKEEAEAIQAKLSDAGANVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|194333131|ref|YP_002014991.1| 50S ribosomal protein L7/L12 [Prosthecochloris aestuarii DSM 271]
 gi|226733720|sp|B4S496|RL7_PROA2 RecName: Full=50S ribosomal protein L7/L12
 gi|194310949|gb|ACF45344.1| ribosomal protein L7/L12 [Prosthecochloris aestuarii DSM 271]
          Length = 126

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 65/128 (50%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEF 58
           M++IE++VE++  L+L EA+EL K LE+++GVSA+  V    +A   A   +A  EKTEF
Sbjct: 1   MASIETLVEEIGKLSLTEASELVKALEEKFGVSAAPAVIAGGMAAAPAGDAAAQEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V LK       KI VIK VR+IT LGLKEAKE+V+ APK +K  +SK+EA ++ K+L+D
Sbjct: 61  DVELKAAG--ANKINVIKVVRSITGLGLKEAKEVVDGAPKVVKEAVSKEEAEKIAKELKD 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|182412058|ref|YP_001817124.1| ribosomal protein L7/L12 [Opitutus terrae PB90-1]
 gi|177839272|gb|ACB73524.1| ribosomal protein L7/L12 [Opitutus terrae PB90-1]
          Length = 129

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/123 (56%), Positives = 89/123 (72%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E ++E LS+ T+++ A L K LE +WGVSA+A V+      A AG+AA+ E+TEF VVLK
Sbjct: 9   EQVIEWLSAQTVLDLAALVKDLEGKWGVSAAAAVAAAPAAGAGAGAAAAIEQTEFTVVLK 68

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KI VIKEVRAIT LGLKEAK+LVE APK +K  ++K EA E+KKKLE AGA V
Sbjct: 69  --EAGANKIGVIKEVRAITGLGLKEAKDLVEGAPKPVKENVAKAEAEEIKKKLEAAGAKV 126

Query: 124 ELR 126
           EL+
Sbjct: 127 ELK 129


>gi|289579154|ref|YP_003477781.1| ribosomal protein L7/L12 [Thermoanaerobacter italicus Ab9]
 gi|289528867|gb|ADD03219.1| ribosomal protein L7/L12 [Thermoanaerobacter italicus Ab9]
          Length = 125

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 91/126 (72%), Gaps = 8/126 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+E + ++T++E A+L K LE+E+GVSA+APV   AP A    + A   EKTEF+V+L
Sbjct: 4   EEILEAIKNMTVLELADLVKALEEEFGVSAAAPVVTAAPTAGAPAAGAPAEEKTEFDVIL 63

Query: 63  K--GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +  G D    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+ G
Sbjct: 64  QEVGSD----KIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEEVG 119

Query: 121 ATVELR 126
           A VE++
Sbjct: 120 AKVEIK 125


>gi|317968190|ref|ZP_07969580.1| 50S ribosomal protein L7/L12 [Synechococcus sp. CB0205]
          Length = 128

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 88/127 (69%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV--APVAAEAGSAASEKTEFE 59
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+A   VV  AP A  A  AA EKTEF+
Sbjct: 3   ATTDQILEQLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAAPAAGGAAEAAEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V L+GFD    KI V+K VR  T LGL EAK LVE AP ++K G++K +A  MKK +E+A
Sbjct: 63  VHLEGFD-AAAKIKVLKAVREATGLGLGEAKALVEGAPCNVKEGVAKADAEAMKKAIEEA 121

Query: 120 GATVELR 126
           G  V L+
Sbjct: 122 GGKVSLK 128


>gi|238927911|ref|ZP_04659671.1| ribosomal protein L7/L12 [Selenomonas flueggei ATCC 43531]
 gi|238884244|gb|EEQ47882.1| ribosomal protein L7/L12 [Selenomonas flueggei ATCC 43531]
          Length = 123

 Score = 94.0 bits (232), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A   A   +   EK+EF VVL
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGGAAPAAGGEEKSEFTVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KKI VIK VR  T LGLKEAKELV+ APK +K  + K EA E+KKKLE+AGAT
Sbjct: 62  AAAGD--KKINVIKAVREATGLGLKEAKELVDGAPKPVKENVGKAEAEELKKKLEEAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|57504728|ref|ZP_00370782.1| ribosomal protein L7/L12 [Campylobacter coli RM2228]
 gi|305433032|ref|ZP_07402188.1| ribosomal protein L7/L12 [Campylobacter coli JV20]
 gi|57019384|gb|EAL56082.1| ribosomal protein L7/L12 [Campylobacter coli RM2228]
 gi|304443733|gb|EFM36390.1| ribosomal protein L7/L12 [Campylobacter coli JV20]
          Length = 125

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 89/123 (72%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA   +AA+E KTEF++VL 
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGAAAAAEEKTEFDIVL- 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K +A E KK+LE+AGA V
Sbjct: 64  -VDGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKADAEEAKKQLEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|297172384|gb|ADI23359.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0770_27O18]
 gi|297181149|gb|ADI17346.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0070_21F08]
          Length = 126

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 88/123 (71%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  ++ +++++  EL + +E+++GV+A+A V+     A     AA+E +TEF+VVL 
Sbjct: 6   EDILSAVADMSVMDLVELIEAMEEKFGVTAAAAVAAAPAAAGGDAGAAAEEQTEFDVVLT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GF D  KK+ VIK VR +T LGLKEAKELVESAP  +K G SKDEA E+KKK+E+AG T 
Sbjct: 66  GFGD--KKVGVIKAVREVTGLGLKEAKELVESAPAPVKEGASKDEAEEIKKKIEEAGGTA 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|313683393|ref|YP_004061131.1| LSU ribosomal protein l12p [Sulfuricurvum kujiense DSM 16994]
 gi|313156253|gb|ADR34931.1| LSU ribosomal protein L12P [Sulfuricurvum kujiense DSM 16994]
          Length = 124

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +S+L+++E +EL K  E+++GVSA  PV+V     A AG+A  EKTEF+V+LK 
Sbjct: 6   QDVLEFISNLSVLELSELVKEFEEKFGVSAQ-PVAVAGGAVAAAGAAEEEKTEFDVILK- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE AP +LK G+SK +A   KK+LE+AGA VE
Sbjct: 64  -DGGDKKINVIKVVRAMTGLGLKEAKDAVEGAPTTLKEGISKQDAEAAKKELEEAGAVVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|149922218|ref|ZP_01910656.1| ribosomal protein L7/L12 [Plesiocystis pacifica SIR-1]
 gi|149816958|gb|EDM76443.1| ribosomal protein L7/L12 [Plesiocystis pacifica SIR-1]
          Length = 127

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ LS+L++++ A+L K LE +WGV A+A  +V+    A A  A  E+TEF+VVLK 
Sbjct: 8   EQVIDFLSNLSVMQMADLVKELEDKWGVEAAAGGAVMVAGPA-AEEAKEEQTEFDVVLKS 66

Query: 65  FDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           F    KKI VIK +RA I+ LGLKEAK LVESAP ++K  +SK+EA E+KK LE+AGA V
Sbjct: 67  FG--AKKINVIKAIRAQISGLGLKEAKSLVESAPVAVKEAVSKEEAEELKKILEEAGAEV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|218246569|ref|YP_002371940.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 8801]
 gi|257059609|ref|YP_003137497.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 8802]
 gi|226733671|sp|B7JWT5|RL7_CYAP8 RecName: Full=50S ribosomal protein L7/L12
 gi|218167047|gb|ACK65784.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 8801]
 gi|256589775|gb|ACV00662.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 8802]
          Length = 132

 Score = 93.6 bits (231), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 91/124 (73%), Gaps = 9/124 (7%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------KTEF 58
           + I+E+L SLTL+EA+EL K++E+ +GVSA+APV     + A  G+A +       KTEF
Sbjct: 6   DQILEQLKSLTLLEASELVKQIEEAFGVSAAAPVGGGMMMMAPGGAAPAAAEPEEEKTEF 65

Query: 59  EVVLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           +VVL+  D P  KKIA++K VRAIT LGLKEAK+LVESAPK +K   +KD+A  +KK+LE
Sbjct: 66  DVVLE--DVPADKKIAILKVVRAITGLGLKEAKDLVESAPKPIKEATNKDDAESIKKQLE 123

Query: 118 DAGA 121
           +AGA
Sbjct: 124 EAGA 127


>gi|116624534|ref|YP_826690.1| 50S ribosomal protein L7/L12 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122252856|sp|Q01VB0|RL7_SOLUE RecName: Full=50S ribosomal protein L7/L12
 gi|116227696|gb|ABJ86405.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 126

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (69%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++ +I +++  LTL+EA++L K LE++ GVSA+A V+  A     A +A +  EKTEF
Sbjct: 1   MADLNAIADQIQGLTLLEASQLVKMLEEKLGVSAAAAVAAPAAGGGAAAAAPAAEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL G      KI VIK VR +T LGLKEAK+LV+ APK +K G+SK+EA  + KK  D
Sbjct: 61  TVVLTGAG--ANKINVIKAVREVTSLGLKEAKDLVDGAPKPIKEGVSKEEAATIAKKFTD 118

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 119 AGATVEVK 126


>gi|153805629|ref|YP_001382214.1| ribosomal protein L12 [Leptosira terrestris]
 gi|134270160|gb|ABO69349.1| ribosomal protein L12 [Leptosira terrestris]
          Length = 133

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 81/126 (64%), Gaps = 8/126 (6%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---VVAPV----AAEAGSAASEKTEFE 59
           I+EKL S+TL+EAAEL   +EK +GV ASAPV+   +  P      A+A     EKT F+
Sbjct: 8   IIEKLKSMTLVEAAELVAEIEKTFGVDASAPVAGGFIGGPSFGAENAQATEVVEEKTTFD 67

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L+   D  K++ V+K +R +T+LGLKEAKE   S PK +K  +SK+EA   K++LE A
Sbjct: 68  VILEQIPD-DKRVPVLKVIRTLTNLGLKEAKEFTTSLPKKIKESVSKEEAETAKQELEKA 126

Query: 120 GATVEL 125
           G  V +
Sbjct: 127 GGKVTI 132


>gi|254428263|ref|ZP_05041970.1| ribosomal protein L7/L12 [Alcanivorax sp. DG881]
 gi|196194432|gb|EDX89391.1| ribosomal protein L7/L12 [Alcanivorax sp. DG881]
          Length = 125

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  EL + +E+++GV+A+A V+     A    +AA E+TEF+VVL G
Sbjct: 6   EDILGAIADMSVMDLVELIEAMEEKFGVTAAAAVAAAPAAAGGEAAAAEEQTEFDVVLTG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D  KK+ VIK VR +T LGLKEAKELVE AP  +K G +KDEA E+KKK+E+AG T E
Sbjct: 66  FGD--KKVGVIKAVREVTGLGLKEAKELVEGAPAPVKEGAAKDEAEEIKKKIEEAGGTAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|154174384|ref|YP_001408642.1| 50S ribosomal protein L7/L12 [Campylobacter curvus 525.92]
 gi|166222150|sp|A7GZK0|RL7_CAMC5 RecName: Full=50S ribosomal protein L7/L12
 gi|112803920|gb|EAU01264.1| ribosomal protein L7/L12 [Campylobacter curvus 525.92]
          Length = 125

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +     VA  A  AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAVAGGAAEAAEEKTEFNLVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 64  VDSGDKKINVIKVVRALTGLGLKEAKDAVEGTPSVLKEGISKDEAEAAKKELEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|315320477|ref|YP_004072533.1| 50S ribosomal protein L7/L12 [Thalassiosira oceanica CCMP1005]
 gi|283568950|gb|ADB27487.1| 50S ribosomal protein L7/L12 [Thalassiosira oceanica CCMP1005]
          Length = 128

 Score = 93.6 bits (231), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 86/129 (66%), Gaps = 6/129 (4%)

Query: 1   MSN-IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTE 57
           MS+ I  IVE+L +LTL+EA+EL   +E+ +GV ASA V   VV   A  A   A EKTE
Sbjct: 1   MSDKINQIVEELKTLTLLEASELVTAIEETFGVDASASVGGGVVMAAAPAAAEEAEEKTE 60

Query: 58  FEVVLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V+L   + P  KKIAV+K VR +T LGLKEAKELVESAPK ++  L KD A + KK++
Sbjct: 61  FNVMLD--EVPADKKIAVLKVVRTLTGLGLKEAKELVESAPKMVQEALGKDAAEDAKKQI 118

Query: 117 EDAGATVEL 125
           E AG  V L
Sbjct: 119 EAAGGKVSL 127


>gi|167772349|ref|ZP_02444402.1| hypothetical protein ANACOL_03726 [Anaerotruncus colihominis DSM
           17241]
 gi|167665452|gb|EDS09582.1| hypothetical protein ANACOL_03726 [Anaerotruncus colihominis DSM
           17241]
          Length = 125

 Score = 93.2 bits (230), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I   VE + +LT++E  EL K +E+E+GVSA+APV +VA  A  A    +EKTEF+V+L 
Sbjct: 6   ILKFVEDIKTLTVLELNELVKAIEEEFGVSAAAPV-MVAGPATAAAGGEAEKTEFDVILA 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  K+ VIK V+ IT LGLKEAK LV+ APK +K G+SK +A ++K KLE+AGATV
Sbjct: 65  SAG--ASKMGVIKLVKEITGLGLKEAKALVDEAPKPVKEGISKADAEDIKAKLEEAGATV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|301059223|ref|ZP_07200160.1| ribosomal protein L7/L12 [delta proteobacterium NaphS2]
 gi|300446658|gb|EFK10486.1| ribosomal protein L7/L12 [delta proteobacterium NaphS2]
          Length = 127

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + +VE +S++T++E +E  K LE+++GVSA+APV++ A         A+E+TEF+VVL  
Sbjct: 8   DDVVEFISNMTVLELSEFVKELEEKFGVSAAAPVAMAAAAPGAPAEEAAEQTEFDVVLTA 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VRAIT LGLKEAK +V+ AP  +K G+ KDEA  +K +LE+AGATVE
Sbjct: 68  VGD--KKIQVIKVVRAITGLGLKEAKGVVDGAPGPVKEGIPKDEAEGIKTQLEEAGATVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|163847744|ref|YP_001635788.1| 50S ribosomal protein L7/L12 [Chloroflexus aurantiacus J-10-fl]
 gi|222525607|ref|YP_002570078.1| 50S ribosomal protein L7/L12 [Chloroflexus sp. Y-400-fl]
 gi|189042985|sp|A9WFP9|RL7_CHLAA RecName: Full=50S ribosomal protein L7/L12
 gi|254806272|sp|B9LI32|RL7_CHLSY RecName: Full=50S ribosomal protein L7/L12
 gi|163669033|gb|ABY35399.1| ribosomal protein L7/L12 [Chloroflexus aurantiacus J-10-fl]
 gi|222449486|gb|ACM53752.1| ribosomal protein L7/L12 [Chloroflexus sp. Y-400-fl]
          Length = 132

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 90/134 (67%), Gaps = 10/134 (7%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA---PVAAEAGSA-----A 52
           MS I+SI+E +  L ++E  EL K++E++WGV+A+APV  +    PVAA    A      
Sbjct: 1   MSKIDSIIEMIEGLNVLELVELKKKMEEKWGVTAAAPVMAMGAAMPVAAAGDGAAAAAPV 60

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKTEF+V+LK  +    KI VIK VR +T LGLKEAK+LVE APK ++ G+SK+EA   
Sbjct: 61  EEKTEFDVILK--EAGPNKIQVIKVVRELTSLGLKEAKDLVEGAPKPVREGVSKEEAEAA 118

Query: 113 KKKLEDAGATVELR 126
           K KL +AGA VE++
Sbjct: 119 KAKLTEAGAVVEIK 132


>gi|318040707|ref|ZP_07972663.1| 50S ribosomal protein L7/L12 [Synechococcus sp. CB0101]
          Length = 128

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 87/127 (68%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV--APVAAEAGSAASEKTEFE 59
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+A   VV  AP A  A  AA EKTEF+
Sbjct: 3   ATTDQILEQLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAAPAAGGAAEAAEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL+ FD    KI V+K VR  T LGL EAK LVE AP ++K G SK +A  MKK +E+A
Sbjct: 63  VVLESFD-AAAKIKVLKAVREATGLGLGEAKALVEGAPCAVKEGASKADAEAMKKAIEEA 121

Query: 120 GATVELR 126
           G  V L+
Sbjct: 122 GGKVALK 128


>gi|262197200|ref|YP_003268409.1| ribosomal protein L7/L12 [Haliangium ochraceum DSM 14365]
 gi|262080547|gb|ACY16516.1| ribosomal protein L7/L12 [Haliangium ochraceum DSM 14365]
          Length = 127

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 93/130 (71%), Gaps = 7/130 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KT 56
           M++I  + ++E LS LT+++  +L++ LE++WGV A APV+V    AA+ G AA+E  +T
Sbjct: 1   MADITQDQVIEYLSGLTVMDLVKLTESLEEKWGVKA-APVAVAGVPAADGGGAAAEEEQT 59

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF V+LKG     +KI  IK VR IT LGLK+AK+LV+ APK +K  + KDEANE+ +KL
Sbjct: 60  EFTVILKGAG--AQKIQTIKAVREITGLGLKDAKDLVDGAPKEVKADIPKDEANEIAEKL 117

Query: 117 EDAGATVELR 126
           + AGA VE++
Sbjct: 118 KAAGAEVEVK 127


>gi|237756129|ref|ZP_04584702.1| ribosomal protein L7/L12 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691714|gb|EEP60749.1| ribosomal protein L7/L12 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 128

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/124 (54%), Positives = 91/124 (73%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I E + S+T++E A+L K LE+E+GVSA+A V+     A  AG+AA   EKTEF+V+L
Sbjct: 7   EEIKEAIKSMTVLELAQLVKDLEEEFGVSAAAMVAAAPAAAGAAGAAAPAEEKTEFDVIL 66

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR IT LGLKEAK+LV+ APK +K G+SK+EA ++KKKLE+AGAT
Sbjct: 67  T--NAGANKINVIKVVREITGLGLKEAKDLVDGAPKPVKEGVSKEEAEQIKKKLEEAGAT 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEIK 128


>gi|51598647|ref|YP_072835.1| 50S ribosomal protein L7/L12 [Borrelia garinii PBi]
 gi|51573218|gb|AAU07243.1| ribosomal protein L7/L12 [Borrelia garinii PBi]
 gi|52694912|gb|AAU85607.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 82/123 (66%), Gaps = 5/123 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  L     +E  +L   +E+++GV+A+  +S V   AA  GS  SE + EF+V+L 
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA--ISAVGGGAASTGSTDSEEQIEFDVILM 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F + K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA V
Sbjct: 64  SFGNSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKV 121

Query: 124 ELR 126
           E++
Sbjct: 122 EVK 124


>gi|262038199|ref|ZP_06011593.1| ribosomal protein L7/L12 [Leptotrichia goodfellowii F0264]
 gi|261747780|gb|EEY35225.1| ribosomal protein L7/L12 [Leptotrichia goodfellowii F0264]
          Length = 124

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 85/124 (68%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N +  +E L ++T++E  E+ + +E+ +GVSA  PV+V    A     +A EK+EF+V+L
Sbjct: 4   NKDQFIEDLKNMTVLELKEVVEAIEETFGVSAQ-PVAVAGGAAGAGAGSAEEKSEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+ VIKEVRAIT LGLKEAKELVE+  K++K G+SK+EA  +K +LE AGAT
Sbjct: 63  --VSAGAAKLGVIKEVRAITGLGLKEAKELVEAGGKAVKEGVSKEEAEALKAQLEGAGAT 120

Query: 123 VELR 126
           VEL+
Sbjct: 121 VELK 124


>gi|254449092|ref|ZP_05062544.1| ribosomal protein L7/L12 [gamma proteobacterium HTCC5015]
 gi|198261284|gb|EDY85577.1| ribosomal protein L7/L12 [gamma proteobacterium HTCC5015]
          Length = 126

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 88/123 (71%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-VVAPVAAEAGSAASEKTEFEVVLK 63
           + I+E +++++++E  EL   +E+++GV A+A  + VV       G+AA EKTEF+VV+ 
Sbjct: 6   DEILEAIANMSVMEVVELISDMEEKFGVEAAAAAAPVVMAGGDAGGAAAEEKTEFDVVMT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D   K+  IK VRAIT LGLKEAKE+VE AP ++K G SK++A E KK+LE+AGA+V
Sbjct: 66  SFGD--NKVGAIKAVRAITGLGLKEAKEMVEGAPATVKEGASKEDAEEAKKQLEEAGASV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|257460969|ref|ZP_05626069.1| ribosomal protein L7/L12 [Campylobacter gracilis RM3268]
 gi|257441632|gb|EEV16775.1| ribosomal protein L7/L12 [Campylobacter gracilis RM3268]
          Length = 126

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (70%), Gaps = 5/124 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA    AA+  EKTEF+VVL
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGAGAAAAEEKTEFDVVL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D   KKI VIK VRA+T LGLKEAK+  E+ P  LK GL+K++A + KK+LE+AGA 
Sbjct: 65  --LDAGDKKINVIKVVRALTGLGLKEAKDATEATPSVLKEGLNKEDAEKAKKELEEAGAK 122

Query: 123 VELR 126
           VEL+
Sbjct: 123 VELK 126


>gi|310659516|ref|YP_003937237.1| 50S ribosomal protein L7/l12 [Clostridium sticklandii DSM 519]
 gi|308826294|emb|CBH22332.1| 50S ribosomal subunit protein L7/L12 [Clostridium sticklandii]
          Length = 120

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I+E + ++ ++E  EL K  E+++GVSASAPV +    A    +AA EKTEF+V+L
Sbjct: 2   TIEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMMAGAAAG---AAAEEKTEFDVIL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K+ VIK VR IT LGLKEAK+LV+ APK +K G +K+EA+++K+KLE AGA 
Sbjct: 59  A--EAGSSKVGVIKVVREITGLGLKEAKDLVDGAPKPVKEGATKEEADQIKEKLEAAGAK 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|148240707|ref|YP_001226094.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 7803]
 gi|166222221|sp|A5GPD2|RL7_SYNPW RecName: Full=50S ribosomal protein L7/L12
 gi|147849246|emb|CAK24797.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 7803]
          Length = 130

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (68%), Gaps = 5/124 (4%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV----APVAAEAGSAASEKTEFEVVL 62
           I+E L +L+L+EA+EL K++E+ +GVSA+A   VV        A  G AA EKTEF+VVL
Sbjct: 8   ILESLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAPGAAGAGGGEAAEEKTEFDVVL 67

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           + FD    KI V+K VR  T LGL +AK +VE+APK++K G+SKDEA  +KK +E+ G  
Sbjct: 68  ESFD-ASAKIKVLKAVREATGLGLGDAKAMVEAAPKAIKEGVSKDEAEALKKAIEEVGGK 126

Query: 123 VELR 126
           V L+
Sbjct: 127 VTLK 130


>gi|116327515|ref|YP_797235.1| 50S ribosomal protein L7/L12 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116331872|ref|YP_801590.1| 50S ribosomal protein L7/L12 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
 gi|116120259|gb|ABJ78302.1| 50S Ribosomal protein L7/L12 [Leptospira borgpetersenii serovar
           Hardjo-bovis L550]
 gi|116125561|gb|ABJ76832.1| 50S Ribosomal protein L7/L12 [Leptospira borgpetersenii serovar
           Hardjo-bovis JB197]
          Length = 126

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 94/123 (76%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE-FEVVLK 63
           E+++E++  LTL+EAA+L K++E ++G+SA+APV+V A   A  G AA+E+   F V+LK
Sbjct: 4   EALLEQIGKLTLVEAADLVKKMEDKFGISAAAPVAVAAAAPASGGGAAAEEASTFNVILK 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GF D  KKI VIK VR IT LGLKEAK+LVE+  K++K G+SK EA+++KKKLE  GA +
Sbjct: 64  GFGD--KKIEVIKLVREITGLGLKEAKDLVEAGGKAVKEGVSKAEADDLKKKLEGVGAQI 121

Query: 124 ELR 126
           EL+
Sbjct: 122 ELK 124


>gi|15640354|ref|NP_229981.1| 50S ribosomal protein L7/L12 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591004|ref|ZP_01678322.1| ribosomal protein L7/L12 [Vibrio cholerae 2740-80]
 gi|121728880|ref|ZP_01681889.1| ribosomal protein L7/L12 [Vibrio cholerae V52]
 gi|147673429|ref|YP_001218595.1| 50S ribosomal protein L7/L12 [Vibrio cholerae O395]
 gi|153216338|ref|ZP_01950416.1| ribosomal protein L7/L12 [Vibrio cholerae 1587]
 gi|153819684|ref|ZP_01972351.1| ribosomal protein L7/L12 [Vibrio cholerae NCTC 8457]
 gi|153823149|ref|ZP_01975816.1| ribosomal protein L7/L12 [Vibrio cholerae B33]
 gi|153827142|ref|ZP_01979809.1| ribosomal protein L7/L12 [Vibrio cholerae MZO-2]
 gi|153831462|ref|ZP_01984129.1| ribosomal protein L7/L12 [Vibrio cholerae 623-39]
 gi|227080539|ref|YP_002809090.1| ribosomal protein L7/L12 [Vibrio cholerae M66-2]
 gi|229506878|ref|ZP_04396386.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae BX 330286]
 gi|229508683|ref|ZP_04398177.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae B33]
 gi|229512396|ref|ZP_04401871.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TMA 21]
 gi|229516065|ref|ZP_04405516.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC9]
 gi|229519865|ref|ZP_04409298.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TM 11079-80]
 gi|229526889|ref|ZP_04416292.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527012|ref|ZP_04416408.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae 12129(1)]
 gi|229606392|ref|YP_002877040.1| 50S ribosomal protein L7/L12 [Vibrio cholerae MJ-1236]
 gi|254227012|ref|ZP_04920573.1| ribosomal protein L7/L12 [Vibrio cholerae V51]
 gi|254292043|ref|ZP_04962820.1| ribosomal protein L7/L12 [Vibrio cholerae AM-19226]
 gi|254851636|ref|ZP_05240986.1| ribosomal protein L7/L12 [Vibrio cholerae MO10]
 gi|255747128|ref|ZP_05421071.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholera CIRS 101]
 gi|262149004|ref|ZP_06028149.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae INDRE 91/1]
 gi|262166946|ref|ZP_06034666.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC27]
 gi|14195175|sp|Q9KV31|RL7_VIBCH RecName: Full=50S ribosomal protein L7/L12
 gi|172047475|sp|A5F3P4|RL7_VIBC3 RecName: Full=50S ribosomal protein L7/L12
 gi|254806404|sp|C3LR59|RL7_VIBCM RecName: Full=50S ribosomal protein L7/L12
 gi|9654741|gb|AAF93500.1| ribosomal protein L7/L12 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547145|gb|EAX57275.1| ribosomal protein L7/L12 [Vibrio cholerae 2740-80]
 gi|121628848|gb|EAX61308.1| ribosomal protein L7/L12 [Vibrio cholerae V52]
 gi|124114333|gb|EAY33153.1| ribosomal protein L7/L12 [Vibrio cholerae 1587]
 gi|125620474|gb|EAZ48847.1| ribosomal protein L7/L12 [Vibrio cholerae V51]
 gi|126509772|gb|EAZ72366.1| ribosomal protein L7/L12 [Vibrio cholerae NCTC 8457]
 gi|126519336|gb|EAZ76559.1| ribosomal protein L7/L12 [Vibrio cholerae B33]
 gi|146315312|gb|ABQ19851.1| ribosomal protein L7/L12 [Vibrio cholerae O395]
 gi|148873057|gb|EDL71192.1| ribosomal protein L7/L12 [Vibrio cholerae 623-39]
 gi|149738970|gb|EDM53286.1| ribosomal protein L7/L12 [Vibrio cholerae MZO-2]
 gi|150422029|gb|EDN13999.1| ribosomal protein L7/L12 [Vibrio cholerae AM-19226]
 gi|227008427|gb|ACP04639.1| ribosomal protein L7/L12 [Vibrio cholerae M66-2]
 gi|227012183|gb|ACP08393.1| ribosomal protein L7/L12 [Vibrio cholerae O395]
 gi|229335535|gb|EEO01016.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae 12129(1)]
 gi|229336058|gb|EEO01077.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229343106|gb|EEO08091.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TM 11079-80]
 gi|229346968|gb|EEO11935.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC9]
 gi|229350611|gb|EEO15556.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TMA 21]
 gi|229354318|gb|EEO19247.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae B33]
 gi|229355983|gb|EEO20902.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae BX 330286]
 gi|229369047|gb|ACQ59470.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae MJ-1236]
 gi|254847341|gb|EET25755.1| ribosomal protein L7/L12 [Vibrio cholerae MO10]
 gi|255735177|gb|EET90579.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholera CIRS 101]
 gi|262024651|gb|EEY43332.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC27]
 gi|262031194|gb|EEY49813.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae INDRE 91/1]
          Length = 121

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 84/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V V  P AA   +A  E+TEF V+L  
Sbjct: 6   EQILDAIAEMSVMQVVELISAMEEKFGVSAAAAV-VSGPAAA---AAVEEQTEFNVILAA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP S+K  +SK+EA  +KK+LE+AGATVE
Sbjct: 62  AG--ANKVAVIKAVRGATGLGLKEAKALVDGAPASVKEAVSKEEAEALKKELEEAGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|260887706|ref|ZP_05898969.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
 gi|330838622|ref|YP_004413202.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
 gi|260862586|gb|EEX77086.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
 gi|329746386|gb|AEB99742.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
          Length = 123

 Score = 92.8 bits (229), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 89/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E +EL K +E+++GVSA+APV+V A  AA A +A  EKTEF VVL  
Sbjct: 4   EEIMQAIEGMTVLELSELVKAMEEKFGVSAAAPVAVAAAGAAPAAAAGEEKTEFTVVLAA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VR  T LGLKEAKELV+ AP  +K  ++K EA E+KKKLE+AGATVE
Sbjct: 64  AGD--KKINVIKAVREATGLGLKEAKELVDGAPAPIKENIAKAEAEELKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|119383498|ref|YP_914554.1| 50S ribosomal protein L7/L12 [Paracoccus denitrificans PD1222]
 gi|166222189|sp|A1B014|RL7_PARDP RecName: Full=50S ribosomal protein L7/L12
 gi|119373265|gb|ABL68858.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Paracoccus
           denitrificans PD1222]
          Length = 124

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 87/127 (68%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV-VAPVAAEAGSAASEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V VA  AA    AA EKTEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKNILKDEYGIEPAAGGAVMVAGPAAGPAEAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVR IT LGLKEAK+LVE+  K +K G SK +A EMKKKLE A
Sbjct: 61  VVL--VDAGANKINVIKEVRGITGLGLKEAKDLVEAGGK-VKEGASKADAEEMKKKLEAA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|57242439|ref|ZP_00370377.1| ribosomal protein L7/L12 [Campylobacter upsaliensis RM3195]
 gi|57016724|gb|EAL53507.1| ribosomal protein L7/L12 [Campylobacter upsaliensis RM3195]
          Length = 125

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  V      A    +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVVVAGGAAAGGGAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K +A E KK+LE+AGA VE
Sbjct: 65  -DSGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKADAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|331268156|ref|YP_004347805.1| ribosomal protein L12 [Chlorella variabilis]
 gi|325296333|gb|ADZ05053.1| ribosomal protein L12 [Chlorella variabilis]
          Length = 130

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 83/124 (66%), Gaps = 7/124 (5%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS----AASEKTEFEVVL 62
           I+EKL S+TL+EAAEL  ++E+ +GV ASAPV      A  A         EKT F+VV+
Sbjct: 8   IIEKLKSITLLEAAELVSQIEETFGVDASAPVGGGFIAAPGAAGAAAEVVEEKTTFDVVI 67

Query: 63  KGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +  D P  K++ V+K VR +T L LKEAKE + S PK+++ G+SKD+A   K++LEDAGA
Sbjct: 68  E--DVPTDKRVPVLKVVRNLTSLDLKEAKEAITSLPKTIQQGVSKDDAEAAKQQLEDAGA 125

Query: 122 TVEL 125
            V++
Sbjct: 126 KVKI 129


>gi|254432037|ref|ZP_05045740.1| ribosomal protein L7/L12 [Cyanobium sp. PCC 7001]
 gi|197626490|gb|EDY39049.1| ribosomal protein L7/L12 [Cyanobium sp. PCC 7001]
          Length = 127

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 89/126 (70%), Gaps = 2/126 (1%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFEV 60
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+A   VV A   A A  AA EKTEF+V
Sbjct: 3   ATTDQILEQLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAAAPAAAAEAAEEKTEFDV 62

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+ FD    KI V+K VR  T LGL +AK LVE+APK++K G++K +A  +KK +E+AG
Sbjct: 63  ILESFD-AAAKIKVLKAVREATGLGLGDAKSLVEAAPKAVKEGIAKADAEALKKAIEEAG 121

Query: 121 ATVELR 126
             V ++
Sbjct: 122 GKVSIK 127


>gi|126734764|ref|ZP_01750510.1| ribosomal protein L7/L12 [Roseobacter sp. CCS2]
 gi|126715319|gb|EBA12184.1| ribosomal protein L7/L12 [Roseobacter sp. CCS2]
          Length = 124

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M++++ + E++ +LTL+EA EL   L+ E+G+  +A  +V+ A      G AA+EKTEF+
Sbjct: 1   MADLKKMAEEIVALTLLEAQELKTILKDEYGIEPAAGGAVMMASGGDAGGEAAAEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G SKDEA E+K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGASKDEAEEIKSKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|152991726|ref|YP_001357447.1| 50S ribosomal protein L7/L12 [Sulfurovum sp. NBC37-1]
 gi|166222220|sp|A6Q6I1|RL7_SULNB RecName: Full=50S ribosomal protein L7/L12
 gi|151423587|dbj|BAF71090.1| 50S ribosomal protein L7/L12 [Sulfurovum sp. NBC37-1]
          Length = 124

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GV+A A V V A  AA  G AA E+TEF VVL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVTAQATV-VAAGGAAAGGEAAEEQTEFNVVLT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI  IK VRAIT LGLKEAK  VE  P  LK G+SK+EA E KK++E+AGA+ E
Sbjct: 64  -DAGAKKINAIKVVRAITGLGLKEAKAAVEETPTVLKEGVSKEEAEEFKKQIEEAGASCE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|134298084|ref|YP_001111580.1| 50S ribosomal protein L7/L12 [Desulfotomaculum reducens MI-1]
 gi|172044213|sp|A4J102|RL7_DESRM RecName: Full=50S ribosomal protein L7/L12
 gi|134050784|gb|ABO48755.1| LSU ribosomal protein L12P [Desulfotomaculum reducens MI-1]
          Length = 124

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 91/126 (72%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS +  ++E +  LT++E AEL K  E+E+GVSA+APV+V A  AA A +A  EKTEF+V
Sbjct: 1   MSKVAEVLEIVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAPAAGAAAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L    D  KKI VIK VR IT LGLKEAKELV+ APK +K  ++K+EA  +K KL +AG
Sbjct: 61  ILTSAGD--KKINVIKVVREITGLGLKEAKELVDGAPKPVKEKIAKEEAESIKAKLTEAG 118

Query: 121 ATVELR 126
           ATV+++
Sbjct: 119 ATVDVK 124


>gi|148244879|ref|YP_001219573.1| 50S ribosomal protein L7/L12 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|166222225|sp|A5CW26|RL7_VESOH RecName: Full=50S ribosomal protein L7/L12
 gi|146326706|dbj|BAF61849.1| 50S ribosomal protein L7/L12 [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 124

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 88/124 (70%), Gaps = 8/124 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASA--PVSVVAPVAAEAGSAASEKTEFEVVL 62
           E I+  ++ +++I+  EL   +E+++GVSA+A  PV+VVA V     +   EK EF+++L
Sbjct: 7   EDILNAIADMSVIDVVELVSAMEEKFGVSATAVTPVAVVADV----DNTVVEKDEFDIML 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F   +KK+AVIK VR+IT LGLKE+K++VESAP  +K   SK EA +++++L++ GA+
Sbjct: 63  TSF--GEKKVAVIKAVRSITGLGLKESKDMVESAPVVIKESASKIEAEDIERQLKEVGAS 120

Query: 123 VELR 126
           VEL+
Sbjct: 121 VELK 124


>gi|291286304|ref|YP_003503120.1| 50S ribosomal protein L7/L12 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883464|gb|ADD67164.1| ribosomal protein L7/L12 [Denitrovibrio acetiphilus DSM 12809]
          Length = 126

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 88/123 (71%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E + ++T+IE +EL K LE ++GVSASAPV+++A   A  G AA+  +TEF V L 
Sbjct: 6   EQVIEFIENMTVIELSELVKELEDKFGVSASAPVAMMAAGPAAGGEAAAAEQTEFTVELT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              D  KK+ VIK VR IT LGLKEAK LV+ AP  +K G+SK+EA E+K K+E+AGA+V
Sbjct: 66  AAGD--KKVQVIKVVREITGLGLKEAKALVDGAPAPVKEGVSKEEAEELKAKIEEAGASV 123

Query: 124 ELR 126
            ++
Sbjct: 124 TVK 126


>gi|71892327|ref|YP_278061.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|109893747|sp|Q492B8|RL7_BLOPB RecName: Full=50S ribosomal protein L7/L12
 gi|71796433|gb|AAZ41184.1| 50S ribosomal subunit protein L7/L12 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 122

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +S++++++   L+  +E+++GVS +A ++ V P  +EA     E+TEF V L  
Sbjct: 6   EQILDAISNMSVMDIVRLTSMMEEKFGVS-TASLTTVEPDTSEA--IVEEQTEFNVFLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             +   KI VIK VR+IT LGLKEAKELVESAP  LK  ++KD+A  +KK LE  GA+VE
Sbjct: 63  IGN--NKIPVIKTVRSITGLGLKEAKELVESAPVILKESINKDDAETLKKTLETVGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|154149202|ref|YP_001407181.1| 50S ribosomal protein L7/L12 [Campylobacter hominis ATCC BAA-381]
 gi|166222152|sp|A7I3U0|RL7_CAMHC RecName: Full=50S ribosomal protein L7/L12
 gi|153805211|gb|ABS52218.1| ribosomal protein L7/L12 [Campylobacter hominis ATCC BAA-381]
          Length = 124

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA APV V     A A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAGAGAAAAAEEKTEFDLVLT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VRAIT LGLKEAK+ VE  P  LK G++K++A + K  LE AGA VE
Sbjct: 64  -DTGAEKIKVIKAVRAITGLGLKEAKDAVEKTPSVLKEGMNKEDAEKAKADLEAAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|118411000|ref|YP_874395.1| 50S ribosomal protein L12 [Phaeodactylum tricornutum]
 gi|125987530|sp|A0T0C0|RK12_PHATC RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|116739747|gb|ABK20618.1| 50S ribosomal protein L12 [Phaeodactylum tricornutum]
          Length = 128

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 83/126 (65%), Gaps = 7/126 (5%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFEVV 61
           I+ IVE L +LTL+EA+EL  ++E+ +GV ASA  S  VV   A        EKTEF ++
Sbjct: 5   IDQIVEDLKTLTLLEASELVTKIEETFGVDASAAASGGVVMAAAPAVVEEVEEKTEFNLM 64

Query: 62  LKGFDD--PKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           L   D+    KKIAV+K VR++T LGLKEAKELVESAPK ++ GL KD A E KK++E A
Sbjct: 65  L---DEVPADKKIAVLKVVRSLTGLGLKEAKELVESAPKQIQEGLGKDAAEEAKKQIEAA 121

Query: 120 GATVEL 125
           G    L
Sbjct: 122 GGKASL 127


>gi|262401580|ref|ZP_06078147.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio sp. RC586]
 gi|262352295|gb|EEZ01424.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio sp. RC586]
          Length = 121

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 84/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V V  P AA   +A  E+TEF VVL  
Sbjct: 6   EQILDAIAEMSVMQVVELISAMEEKFGVSAAAAV-VSGPAAA---AAVEEQTEFNVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP ++K  +SK+EA  +KK+LE+AGATVE
Sbjct: 62  AG--ANKVAVIKAVRGATGLGLKEAKALVDGAPATVKEAVSKEEAEALKKELEEAGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|302876543|ref|YP_003845176.1| 50S ribosomal protein L7/L12 [Clostridium cellulovorans 743B]
 gi|307687216|ref|ZP_07629662.1| 50S ribosomal protein L7/L12 [Clostridium cellulovorans 743B]
 gi|302579400|gb|ADL53412.1| ribosomal protein L7/L12 [Clostridium cellulovorans 743B]
          Length = 119

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 88/121 (72%), Gaps = 6/121 (4%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            I+E + ++T++E  EL    E+E+GVSA+APV+VV   A    +AA EKTEF VVLK  
Sbjct: 5   QIIEAIKNMTVLELNELVTACEEEFGVSAAAPVAVVGGAAP---AAAEEKTEFNVVLK-- 59

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
            + K+KI VIK VR +T LGLKEAKELV+  PK+LK G+SK+EA+ MK KLE+ GA VEL
Sbjct: 60  -EAKEKIKVIKVVRELTGLGLKEAKELVDGVPKALKEGVSKEEADAMKAKLEEVGAVVEL 118

Query: 126 R 126
           +
Sbjct: 119 Q 119


>gi|237751207|ref|ZP_04581687.1| ribosomal protein L7/L12 [Helicobacter bilis ATCC 43879]
 gi|229372573|gb|EEO22964.1| ribosomal protein L7/L12 [Helicobacter bilis ATCC 43879]
          Length = 125

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+  V   A     AG+AA EKTEF+VVL  
Sbjct: 6   EDVLEYIGNLSVLELSELVKAFEEKFGVSAAPTVVAGAVAGGGAGAAAEEKTEFDVVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR IT LGLKEAKE  E  P +LK G+SK++A   KKKLE+AGA VE
Sbjct: 64  VDAGANKINVIKAVREITGLGLKEAKEATEKTPNTLKEGVSKEDAENFKKKLEEAGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|24371821|ref|NP_715863.1| 50S ribosomal protein L7/L12 [Shewanella oneidensis MR-1]
 gi|120596981|ref|YP_961555.1| 50S ribosomal protein L7/L12 [Shewanella sp. W3-18-1]
 gi|146294849|ref|YP_001185273.1| 50S ribosomal protein L7/L12 [Shewanella putrefaciens CN-32]
 gi|81589445|sp|Q8EK75|RL7_SHEON RecName: Full=50S ribosomal protein L7/L12
 gi|166222210|sp|A4YBZ1|RL7_SHEPC RecName: Full=50S ribosomal protein L7/L12
 gi|166222212|sp|A1REA6|RL7_SHESW RecName: Full=50S ribosomal protein L7/L12
 gi|24345626|gb|AAN53308.1|AE015471_13 ribosomal protein L7/L12 [Shewanella oneidensis MR-1]
 gi|120557074|gb|ABM23001.1| LSU ribosomal protein L12P [Shewanella sp. W3-18-1]
 gi|145566539|gb|ABP77474.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Shewanella
           putrefaciens CN-32]
 gi|319424572|gb|ADV52646.1| ribosomal protein L7/L12 [Shewanella putrefaciens 200]
          Length = 122

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E  ++++++E  EL + +E+++GVSA+A V        EA +A  E+TEF V+L  
Sbjct: 6   DQILEAFAAMSVMEVVELIEAMEEKFGVSAAAAV---VSGGGEAAAAVEEQTEFNVILTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   K+AVIK +R  T LGLKEAK + E+AP ++K G+SK+EA  +KK+L +AGA+VE
Sbjct: 63  HGD--NKVAVIKAIRGATGLGLKEAKAMSEAAPVAVKEGVSKEEAEALKKELVEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|269101021|ref|YP_003289169.1| 50S ribosomal protein L12 [Ectocarpus siliculosus]
 gi|266631529|emb|CAV31200.1| Chloroplast 50S ribosomal protein L12 [Ectocarpus siliculosus]
 gi|270118659|emb|CAT18714.1| Chloroplast 50S ribosomal protein L12 [Ectocarpus siliculosus]
          Length = 130

 Score = 92.0 bits (227), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 88/128 (68%), Gaps = 7/128 (5%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA----PVAAEAGSAASEKTEFE 59
           I +++++L +LTL+EAAEL K +E+ + V ASA   V+        +E  ++  EKTEF+
Sbjct: 5   ISTLIDELKTLTLLEAAELVKAIEETFDVDASAGGGVMMMSGGTTTSEENASGEEKTEFD 64

Query: 60  VVLKGFDDPK-KKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           V L     PK KKI+++K VR++T+LGLKEAKE+VE+ PK ++ GL+K  A E KK LE+
Sbjct: 65  VSLDEV--PKDKKISILKIVRSLTELGLKEAKEVVENTPKVIQEGLTKSAAEEAKKVLEE 122

Query: 119 AGATVELR 126
           AGA V L+
Sbjct: 123 AGAVVTLK 130


>gi|330850833|ref|YP_004376583.1| 50S ribosomal protein L12 [Fistulifera sp. JPCC DA0580]
 gi|328835653|dbj|BAK18949.1| 50S ribosomal protein L12 [Fistulifera sp. JPCC DA0580]
          Length = 128

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 88/126 (69%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFEVV 61
           I+ IVE L +LTL+EA+EL  ++E+ +GV ASA V   V+   A  A  A  E+TEF+++
Sbjct: 5   IDQIVEDLKTLTLLEASELVSKIEETFGVDASAAVGGGVIMAAAPVAEEAVEEQTEFDLM 64

Query: 62  LKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           L   + P  KKI+V+K VR +T LGLKEAKELVE+AP  ++TGL+K+ A + KK++E AG
Sbjct: 65  LD--EVPADKKISVLKVVRGLTGLGLKEAKELVEAAPTKVQTGLAKEAAEDGKKQIEAAG 122

Query: 121 ATVELR 126
           A   L+
Sbjct: 123 AKASLK 128


>gi|296131827|ref|YP_003639074.1| ribosomal protein L7/L12 [Thermincola sp. JR]
 gi|296030405|gb|ADG81173.1| ribosomal protein L7/L12 [Thermincola potens JR]
          Length = 128

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (70%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKT 56
           MS +  I+E +  LT++E AEL K  E+E+GV+A+APV+V A   A AG AA+    EKT
Sbjct: 1   MSKVNEILEAVKGLTVLELAELVKAFEEEFGVTAAAPVAVAAAAPAAAGGAAAAAAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L    D  KKI VIK VR IT LGLKEAKELV+ APK +K  + K+EA  +K KL
Sbjct: 61  EFDVILASAGD--KKINVIKVVREITGLGLKEAKELVDGAPKPVKEKVGKEEAESIKAKL 118

Query: 117 EDAGATVELR 126
           E+AGATVEL+
Sbjct: 119 EEAGATVELK 128


>gi|30410810|ref|NP_660396.2| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 129

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S ++++   EL   +EK++GVSA+  +SV     +E  S   EKTEF++ LK 
Sbjct: 13  EQILEAVSEMSVMNVVELISAMEKKFGVSAN--MSVNTNNNSEK-STIEEKTEFDIFLKS 69

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
              P K ++VIK VR+ T LGLKEAK+LVESAP  LK  +SK++A  +KK LEDAGA +E
Sbjct: 70  IG-PNK-VSVIKSVRSATGLGLKEAKDLVESAPTVLKENMSKNDAESLKKTLEDAGAEIE 127

Query: 125 LR 126
           ++
Sbjct: 128 IK 129


>gi|303327282|ref|ZP_07357724.1| ribosomal protein L7/L12 [Desulfovibrio sp. 3_1_syn3]
 gi|302863270|gb|EFL86202.1| ribosomal protein L7/L12 [Desulfovibrio sp. 3_1_syn3]
          Length = 128

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTEFEVV 61
           E +VE +SS+T++E +E  K LE+++GVSA+AP + +   A  AG       EKTEF+V+
Sbjct: 6   EEVVEFISSMTVLELSEFIKELEEKFGVSAAAPAAAMVMAAPAAGGDGAAVEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +    KI VIK VRA+T+LGLKEAKE V+ AP +LK  +SK+EA E KK+L +AGA
Sbjct: 66  LK--ETGANKIGVIKVVRALTNLGLKEAKEKVDGAPSTLKEAVSKEEAEEAKKQLTEAGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIK 128


>gi|220935500|ref|YP_002514399.1| 50S ribosomal protein L7/L12 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254806403|sp|B8GV66|RL7_THISH RecName: Full=50S ribosomal protein L7/L12
 gi|219996810|gb|ACL73412.1| 50S ribosomal protein L7/L12 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 125

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  +L   +E+++GVSA+A V+     AA   +AA  K EF+VV+  
Sbjct: 6   EDILETISNMTVLEIVDLISAMEEKFGVSAAAAVAAAPVAAAGGEAAAEVKDEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK +RAIT LGLKEAK++VE AP ++K G +KDEA ++KK+LE+AGA+VE
Sbjct: 66  F--GANKVGVIKVIRAITGLGLKEAKDMVEGAPSTVKEGANKDEAEKIKKELEEAGASVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|83858574|ref|ZP_00952096.1| 50S ribosomal protein L7/L12 [Oceanicaulis alexandrii HTCC2633]
 gi|83853397|gb|EAP91249.1| 50S ribosomal protein L7/L12 [Oceanicaulis alexandrii HTCC2633]
          Length = 124

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 90/126 (71%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  + E+L SLT++EA EL+  LE++    A+A V+V  P A    +AA EK EF+V
Sbjct: 1   MADIAKLCEELLSLTILEAKELNDLLEEKGIKPAAAAVAVAGPAAGGEAAAAEEKDEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   KKI VIKEVRAIT LGLKEAKELVE+  K++K G +K EA ++KKKLEDAG
Sbjct: 61  IL--VDAGDKKINVIKEVRAITGLGLKEAKELVEAGGKAVKEGAAKAEAEDIKKKLEDAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|315925311|ref|ZP_07921522.1| 50S ribosomal protein L7/L12 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621212|gb|EFV01182.1| 50S ribosomal protein L7/L12 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 125

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 92/124 (74%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            +E ++E + +L+++E +EL   LE+E+GVSA+APV+V A  AA  G A +EK++F+VVL
Sbjct: 4   KVEKLIEDVKALSVMELSELVSALEEEFGVSAAAPVAVAAAPAAAGGEAPAEKSDFDVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  +KI VIK VR +T LGLKEAK LV+ APK LK G++K+EA EMK K+E+ GAT
Sbjct: 64  ASVGD--QKIKVIKVVRELTGLGLKEAKALVDGAPKPLKEGVAKEEAEEMKSKIEEVGAT 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|22654272|sp|P41188|RL7_BUCAP RecName: Full=50S ribosomal protein L7/L12
 gi|21622931|gb|AAM67607.1| 50S ribosomal protein L7/l12 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 122

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S ++++   EL   +EK++GVSA+  +SV     +E  S   EKTEF++ LK 
Sbjct: 6   EQILEAVSEMSVMNVVELISAMEKKFGVSAN--MSVNTNNNSEK-STIEEKTEFDIFLKS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
              P K ++VIK VR+ T LGLKEAK+LVESAP  LK  +SK++A  +KK LEDAGA +E
Sbjct: 63  IG-PNK-VSVIKSVRSATGLGLKEAKDLVESAPTVLKENMSKNDAESLKKTLEDAGAEIE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|157960006|ref|YP_001500040.1| 50S ribosomal protein L7/L12 [Shewanella pealeana ATCC 700345]
 gi|189043011|sp|A8GYW8|RL7_SHEPA RecName: Full=50S ribosomal protein L7/L12
 gi|157845006|gb|ABV85505.1| ribosomal protein L7/L12 [Shewanella pealeana ATCC 700345]
          Length = 121

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L++++++E  EL + +E+++GVSA+A V      AA    AA EKTEF+VVL  
Sbjct: 6   DQILEALAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGSDAA----AAEEKTEFDVVLTS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   K+AVIK +RA T LGLKEAK + ESAP ++K  +SK+EA  +K  LE AGA VE
Sbjct: 62  HGD--NKVAVIKALRAATGLGLKEAKGMAESAPVAVKEAISKEEAEALKADLEAAGAAVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|118411125|ref|YP_874519.1| 50S ribosomal protein L12 [Thalassiosira pseudonana]
 gi|125987531|sp|A0T0Q7|RK12_THAPS RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|116739872|gb|ABK20742.1| 50S ribosomal protein L12 [Thalassiosira pseudonana]
          Length = 128

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 83/125 (66%), Gaps = 5/125 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFEVV 61
           I  IVE+L +LTL+EA+EL   +E+ +GV ASA     VV  VA  A     EKTEF V+
Sbjct: 5   INQIVEELKTLTLLEASELVAAIEETFGVDASASTGGGVVMAVAPAAAEEVEEKTEFTVM 64

Query: 62  LKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           L   + P  KKIAV+K VR +T LGLKEAKELVES PK ++ GL KD A + KK++EDAG
Sbjct: 65  LD--EVPADKKIAVLKVVRTLTGLGLKEAKELVESTPKMVQEGLGKDAAEDAKKQIEDAG 122

Query: 121 ATVEL 125
             V L
Sbjct: 123 GKVSL 127


>gi|133083|sp|P02395|RL7_MICLU RecName: Full=50S ribosomal protein L7/L12; AltName: Full=MA1/MA2
          Length = 118

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 91/124 (73%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E  +L K +E+E+GV+A+APV      A  A +AA EKTEF+VVL
Sbjct: 2   NKEQILEAIKAMTVLELNDLVKAIEEEFGVTAAAPVV-----AGGAAAAAEEKTEFDVVL 56

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR IT LGLKEAKE+V++APK+LK G+SKDEA E+K KLE+ GA+
Sbjct: 57  ASA--GAEKIKVIKVVREITGLGLKEAKEVVDNAPKALKEGVSKDEAEEIKAKLEEVGAS 114

Query: 123 VELR 126
           VE++
Sbjct: 115 VEVK 118


>gi|312622253|ref|YP_004023866.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202720|gb|ADQ46047.1| ribosomal protein L7/L12 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 129

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 93/126 (73%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEV 60
           ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A +AA    EKTEF V
Sbjct: 6   VQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQAAAPAAEEKTEFNV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D    KI VIK VR IT LGLKEAK+LV+SAPK +K  +SKDEA ++KKKLE+ G
Sbjct: 66  ILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDSAPKPIKENVSKDEAEQIKKKLEEVG 123

Query: 121 ATVELR 126
           A VEL+
Sbjct: 124 AKVELK 129


>gi|88809795|ref|ZP_01125301.1| ribosomal protein L7/L12 [Synechococcus sp. WH 7805]
 gi|88786179|gb|EAR17340.1| ribosomal protein L7/L12 [Synechococcus sp. WH 7805]
          Length = 129

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 86/123 (69%), Gaps = 4/123 (3%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTEFEVVLK 63
           I+E L +L+L+EA+EL K++E+ +GVSA+A   VV      AA  G AA EKTEF+VVL+
Sbjct: 8   ILESLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAPGAAAGGGEAAEEKTEFDVVLE 67

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F+    KI V+K VR  T LGL +AK +VE+APK++K G+SKDEA  +KK +E+ G  V
Sbjct: 68  SFE-ASSKIKVLKAVREATGLGLGDAKAMVEAAPKAIKEGVSKDEAEALKKAIEEVGGKV 126

Query: 124 ELR 126
            L+
Sbjct: 127 TLK 129


>gi|157803326|ref|YP_001491875.1| 50S ribosomal protein L7/L12 [Rickettsia canadensis str. McKiel]
 gi|166222204|sp|A8EXK7|RL7_RICCK RecName: Full=50S ribosomal protein L7/L12
 gi|157784589|gb|ABV73090.1| 50S ribosomal protein L7/L12 [Rickettsia canadensis str. McKiel]
          Length = 125

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 89/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV + A  A  A   A   KT+FE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVPMAAASAPAAAEEAVAEKTDFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KK+ VIK VR IT LGL EAK+LV+ APK++K  + K EA E+K KLE A
Sbjct: 61  VVLTAVGG--KKVEVIKVVREITGLGLIEAKKLVDEAPKAVKQSVKKAEAEEIKSKLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|195952635|ref|YP_002120925.1| 50S ribosomal protein L7/L12 [Hydrogenobaculum sp. Y04AAS1]
 gi|226733698|sp|B4U736|RL7_HYDS0 RecName: Full=50S ribosomal protein L7/L12
 gi|195932247|gb|ACG56947.1| ribosomal protein L7/L12 [Hydrogenobaculum sp. Y04AAS1]
          Length = 127

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           I+ IV+ +S +T++E AEL K+LE+++GVSA+A V+        A S A+E KTEF+V+L
Sbjct: 6   IDEIVDAISGMTVLEVAELVKKLEEKFGVSAAAMVAASPAAGGAAASPAAEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  D    K+ VIK VR +T LGLKEAK+LV+ APK +K G+SK+EA  +KKKLE+AGA 
Sbjct: 66  Q--DAGANKLNVIKVVRELTGLGLKEAKDLVDGAPKPIKQGVSKEEAENIKKKLEEAGAK 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEVK 127


>gi|294789167|ref|ZP_06754406.1| ribosomal protein L7/L12 [Simonsiella muelleri ATCC 29453]
 gi|294482908|gb|EFG30596.1| ribosomal protein L7/L12 [Simonsiella muelleri ATCC 29453]
          Length = 122

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  LT++E  EL K  E+++GVSA+A         A  G+AA  KTEF+V+L  
Sbjct: 6   EDILNAVEQLTVMELNELVKAFEEKFGVSAAAVAV---AGPATVGAAAEAKTEFDVILAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VR+IT LGLKEAK+LV+ APK+LK G+S+ EA+++KK+LE+AGA VE
Sbjct: 63  AGD--QKVGVIKVVRSITGLGLKEAKDLVDGAPKTLKEGVSQAEADDIKKQLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|56750903|ref|YP_171604.1| 50S ribosomal protein L7/L12 [Synechococcus elongatus PCC 6301]
 gi|81299442|ref|YP_399650.1| 50S ribosomal protein L7/L12 [Synechococcus elongatus PCC 7942]
 gi|81596295|sp|Q5N3N6|RL7_SYNP6 RecName: Full=50S ribosomal protein L7/L12
 gi|109893810|sp|Q31QK6|RL7_SYNE7 RecName: Full=50S ribosomal protein L7/L12
 gi|56685862|dbj|BAD79084.1| 50S ribosomal protein L12 [Synechococcus elongatus PCC 6301]
 gi|81168323|gb|ABB56663.1| LSU ribosomal protein L12P [Synechococcus elongatus PCC 7942]
          Length = 128

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFE 59
           +  + I+E L +LTL+EAAEL K++E+ +GVSA+APV  V   AA   +A +   KTEF+
Sbjct: 3   AKTDEILESLKTLTLLEAAELVKQIEEAFGVSAAAPVGGVVVAAAAGAAAEAVEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL+      KKIAV+K VR IT LGLKEAK+LVE+APK +K G+SKD+A   KK+LE+A
Sbjct: 63  VVLEEVP-ADKKIAVLKVVRGITGLGLKEAKDLVEAAPKPIKEGVSKDDAEAAKKELEEA 121

Query: 120 GATVELR 126
           GA V ++
Sbjct: 122 GAKVSVK 128


>gi|225631282|ref|ZP_03787961.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
 gi|225591016|gb|EEH12219.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Muscidifurax
           uniraptor]
          Length = 133

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/133 (51%), Positives = 89/133 (66%), Gaps = 9/133 (6%)

Query: 1   MSNIES-IVEKLSSLTLIEAAELSKRLEKEWGVSASA----PVSVVAPVAAEAG-SAASE 54
           MSN+ S +V+K+ SL L+EA+EL K LE++ G+ A +     V   AP+   A   AA E
Sbjct: 1   MSNVTSDLVDKILSLNLLEASELVKVLEEKIGLPAGSFLGGAVGAGAPIGDNAAVPAAQE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           K E++VV+K  D   KKI VIK VR + + LGLKEAKELVES PK L   + KDEA ++K
Sbjct: 61  KAEYKVVIKEID-ASKKIGVIKAVREVNSTLGLKEAKELVESLPKDLTANVPKDEAEKIK 119

Query: 114 KKLEDAGAT-VEL 125
           +KL +AGAT VEL
Sbjct: 120 QKLIEAGATKVEL 132


>gi|295694827|ref|YP_003588065.1| ribosomal protein L7/L12 [Bacillus tusciae DSM 2912]
 gi|295410429|gb|ADG04921.1| ribosomal protein L7/L12 [Bacillus tusciae DSM 2912]
          Length = 123

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  ++++E  +L K +E+E+GV+A+APV+V+   A  A  A  E+TEF+V+L  
Sbjct: 4   EDIIAAIKGMSVLELNDLVKAIEEEFGVTAAAPVAVMGGAAGGAAEAVEEQTEFDVILTA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAK+LV++APK +K  +SK+EA  +KKKLEDAGA+VE
Sbjct: 64  --PGGSKINVIKVVREITGLGLKEAKDLVDNAPKPVKEKVSKEEAETVKKKLEDAGASVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|307718199|ref|YP_003873731.1| 50S ribosomal protein L7/L12 [Spirochaeta thermophila DSM 6192]
 gi|306531924|gb|ADN01458.1| 50S ribosomal protein L7/L12 [Spirochaeta thermophila DSM 6192]
 gi|315186338|gb|EFU20099.1| LSU ribosomal protein L12P [Spirochaeta thermophila DSM 6578]
          Length = 128

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 92/123 (74%), Gaps = 2/123 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I++ +S +T++E AEL K +E+++GV+A+APV+V A  AA A +   E K+EF+V+LK
Sbjct: 7   EEILDAISQMTVLEVAELVKAMEEKFGVTAAAPVAVAAAPAAGAAAPQEEEKSEFDVILK 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           G  D KK I VIK VR +  LGLKEAK+ VE+  K++K G+SK EA E+KKKLE+AGA V
Sbjct: 67  GVADGKK-IPVIKVVREVMGLGLKEAKDFVEAPGKAVKEGVSKQEAEELKKKLEEAGAVV 125

Query: 124 ELR 126
           E++
Sbjct: 126 EIK 128


>gi|258591308|emb|CBE67607.1| 50S ribosomal subunit protein L7/L12 [NC10 bacterium 'Dutch
           sediment']
          Length = 130

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (69%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTEF 58
            ++ +++ + + T+++  +L K +E ++GVSA+A + + A  +  AG+AA+    EKTEF
Sbjct: 5   TVDDVLDSIETWTVLDLNKLVKGIEDKFGVSATAMMPMAAVGSGGAGAAAAPAAEEKTEF 64

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V+L    +  KKI VIKEVRAIT LGLKEAK+LVE APK +K GLSK EA E+K KLE 
Sbjct: 65  SVILASVGE--KKIQVIKEVRAITGLGLKEAKDLVEGAPKPVKEGLSKAEAEEIKAKLEA 122

Query: 119 AGATVELR 126
            GAT EL+
Sbjct: 123 TGATAELK 130


>gi|83854990|ref|ZP_00948520.1| ribosomal protein L7/L12 [Sulfitobacter sp. NAS-14.1]
 gi|83941512|ref|ZP_00953974.1| ribosomal protein L7/L12 [Sulfitobacter sp. EE-36]
 gi|83842833|gb|EAP82000.1| ribosomal protein L7/L12 [Sulfitobacter sp. NAS-14.1]
 gi|83847332|gb|EAP85207.1| ribosomal protein L7/L12 [Sulfitobacter sp. EE-36]
          Length = 123

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+AG+AA EKTEF+V
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA ++K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGIDKAEAEDIKAKLEAAG 117

Query: 121 ATVEL 125
           A +EL
Sbjct: 118 AEIEL 122


>gi|212550364|ref|YP_002308681.1| 50S ribosomal protein L7/L12 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|254806256|sp|B6YPZ8|RL7_AZOPC RecName: Full=50S ribosomal protein L7/L12
 gi|212548602|dbj|BAG83270.1| 50S ribosomal protein L7/L12 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 124

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 49/126 (38%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E +EL++ L+ E+G+  +   SV   V+        EKT F++
Sbjct: 1   MADLKAFAEQLVNLTIKEVSELTEILKTEYGIELATSSSVATGVSTSVVEVREEKTSFDL 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LKG      K+A++K V+ +T LGLKEAK +V++AP  LK G++++EA  +KK LE+AG
Sbjct: 61  ILKGVGT--NKLAIVKLVKELTGLGLKEAKGIVDNAPAPLKEGITRNEAETLKKSLEEAG 118

Query: 121 ATVELR 126
           A +++R
Sbjct: 119 AEIDIR 124


>gi|89893204|ref|YP_516691.1| 50S ribosomal protein L7/L12 [Desulfitobacterium hafniense Y51]
 gi|219666477|ref|YP_002456912.1| 50S ribosomal protein L7/L12 [Desulfitobacterium hafniense DCB-2]
 gi|123091865|sp|Q250P5|RL7_DESHY RecName: Full=50S ribosomal protein L7/L12
 gi|254806370|sp|B8G1V3|RL7_DESHD RecName: Full=50S ribosomal protein L7/L12
 gi|89332652|dbj|BAE82247.1| 50S ribosomal protein L7/L12 [Desulfitobacterium hafniense Y51]
 gi|219536737|gb|ACL18476.1| ribosomal protein L7/L12 [Desulfitobacterium hafniense DCB-2]
          Length = 124

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 87/126 (69%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS    I+E +  LT++E AEL K  E+E+GVSA+APV+V A   A A   A E+TEF+V
Sbjct: 1   MSKTAEILEAVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAPGAAAAPVAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +    KI VIK VR IT LGLKEAKELV+ APK +K  +SKD+A  +K KL +AG
Sbjct: 61  VL--MNAGAGKINVIKVVREITGLGLKEAKELVDGAPKPVKEKVSKDDAEAIKAKLVEAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|222056713|ref|YP_002539075.1| ribosomal protein L7/L12 [Geobacter sp. FRC-32]
 gi|254806375|sp|B9M6V3|RL7_GEOSF RecName: Full=50S ribosomal protein L7/L12
 gi|221566002|gb|ACM21974.1| ribosomal protein L7/L12 [Geobacter sp. FRC-32]
          Length = 126

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (72%), Gaps = 5/125 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           +++ S +EK+S L L   AE+ K LE+++GVSA+APV+V A     A  AA EKTEF+V+
Sbjct: 7   ADVISFIEKMSVLEL---AEMVKELEEKFGVSAAAPVAVAAVAGPAAAEAAEEKTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK       KI VIK VRA+T LGLKEAK+LV+ AP+ LKTG+SK+EA E KK+L +AGA
Sbjct: 64  LKA--AGANKIGVIKVVRALTSLGLKEAKDLVDGAPQPLKTGVSKEEAEEAKKQLVEAGA 121

Query: 122 TVELR 126
            VE++
Sbjct: 122 EVEIK 126


>gi|83591285|ref|YP_431294.1| 50S ribosomal protein L12P [Moorella thermoacetica ATCC 39073]
 gi|109893773|sp|Q2RFN8|RL7_MOOTA RecName: Full=50S ribosomal protein L7/L12
 gi|83574199|gb|ABC20751.1| LSU ribosomal protein L12P [Moorella thermoacetica ATCC 39073]
          Length = 126

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           MS ++ I+E +  LT++E +EL K LE E+GVSA+APV++     A A + A    +TEF
Sbjct: 1   MSKVQEIIEAVKGLTVLELSELVKALEDEFGVSAAAPVAMAVAPGAAAPAEAPAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK   D  KKI VIK VR IT LGLKEAK LV+ APK +K  +SK+EA  +K KLE+
Sbjct: 61  DVILKEAGD--KKINVIKVVREITALGLKEAKALVDEAPKPVKEKVSKEEAESIKAKLEE 118

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 119 AGATVEIK 126


>gi|330831428|ref|YP_004394380.1| 50S ribosomal protein L7/L12 [Aeromonas veronii B565]
 gi|328806564|gb|AEB51763.1| 50S ribosomal protein L7/L12 [Aeromonas veronii B565]
          Length = 121

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++S++++E  EL + +E+++GVSA+A V      A     A  EKTEF+VVL  
Sbjct: 6   DQIIEAVASMSVMEVVELIEAMEEKFGVSAAAAVMAGPAAA----EAVEEKTEFDVVLTA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVE+AP +LK G+SKDEA  +KK+LE AGA+VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVEAAPANLKEGVSKDEAEALKKELEAAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|113474157|ref|YP_720218.1| 50S ribosomal protein L12P [Trichodesmium erythraeum IMS101]
 gi|123057155|sp|Q119S9|RL7_TRIEI RecName: Full=50S ribosomal protein L7/L12
 gi|110165205|gb|ABG49745.1| LSU ribosomal protein L12P [Trichodesmium erythraeum IMS101]
          Length = 133

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 90/129 (69%), Gaps = 8/129 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------KTE 57
           + I+E+L SL+L+EA+EL K++E  +GVSA+AP   +    A  G+  +        +TE
Sbjct: 6   DEILEQLKSLSLLEASELVKQIEDAFGVSAAAPAGGMMMPMAMPGAPGAAAAEPEEEQTE 65

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+ +L  F    KKIA++K VR+IT LGLKEAKELVES PK LK G++K+ A ++KK+LE
Sbjct: 66  FDAILTEFPS-DKKIAILKVVRSITGLGLKEAKELVESVPKPLKEGIAKEAAEDIKKQLE 124

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 125 EAGAKVEIK 133


>gi|282889741|ref|ZP_06298280.1| 50S ribosomal protein L7/L12 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500315|gb|EFB42595.1| 50S ribosomal protein L7/L12 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 128

 Score = 90.9 bits (224), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 87/127 (68%), Gaps = 2/127 (1%)

Query: 1   MSNI-ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFE 59
           MSN  E +VE+LS LT++E AEL   LE++WGV A+A  +V+A   A A  AA+E T+F+
Sbjct: 1   MSNKKEELVEQLSQLTVLEMAELKTALEEKWGVKAAAAAAVMAVAPAAAAPAAAESTDFQ 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           + L+   D KK I+ IK VR IT LGLKEAKELVES PK +K    K EA E+KKK+E A
Sbjct: 61  ITLEKVTDDKK-ISAIKVVREITGLGLKEAKELVESTPKVIKETAPKAEAEEIKKKVEAA 119

Query: 120 GATVELR 126
           G  V L+
Sbjct: 120 GCKVTLK 126


>gi|254779746|ref|YP_003057852.1| 50S ribosomal protein L7/L12 [Helicobacter pylori B38]
 gi|254001658|emb|CAX29834.1| 50S ribosomal protein L7/L12 [Helicobacter pylori B38]
          Length = 125

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +SSL+++E AEL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYISSLSVLELAELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|320352909|ref|YP_004194248.1| 50S ribosomal protein L12P [Desulfobulbus propionicus DSM 2032]
 gi|320121411|gb|ADW16957.1| LSU ribosomal protein L12P [Desulfobulbus propionicus DSM 2032]
          Length = 126

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 92/123 (74%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           + +++ +S++T++E +EL K LE+++GVSA+APV+V A  A   G AA+E KTEF+V+L 
Sbjct: 6   QDVIDFISNMTVLELSELIKELEEKFGVSAAAPVAVAAVAAPAEGGAAAEEKTEFDVILT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              D  +KI VIKEVRAIT LGLKEAK+LVE  P  +K G+SKDEA  +K ++E AG TV
Sbjct: 66  NAGD--QKIKVIKEVRAITSLGLKEAKDLVEGVPAPIKEGVSKDEAAAIKTQIEGAGGTV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|257063574|ref|YP_003143246.1| LSU ribosomal protein L12P [Slackia heliotrinireducens DSM 20476]
 gi|256791227|gb|ACV21897.1| LSU ribosomal protein L12P [Slackia heliotrinireducens DSM 20476]
          Length = 124

 Score = 90.9 bits (224), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  +TL++A+EL K +E+ +GVSA+AP +V    A +A  AA+E+TEF+V+L+G
Sbjct: 6   EEIIEALKEMTLLQASELVKAIEETFGVSAAAPAAVAVAPAGDA-PAAAEQTEFDVILEG 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KIAVIK VR IT LGLKEAK  VESAP  +K  ++K+EA ++K KLE AGA V 
Sbjct: 65  FGD--NKIAVIKAVREITGLGLKEAKAAVESAPAPIKEKVAKEEAEDLKAKLEAAGAAVT 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|313903160|ref|ZP_07836554.1| LSU ribosomal protein L12P [Thermaerobacter subterraneus DSM 13965]
 gi|313466662|gb|EFR62182.1| LSU ribosomal protein L12P [Thermaerobacter subterraneus DSM 13965]
          Length = 127

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 94/129 (72%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           MS ++ +++ +  +T++E AEL K+ E+E+GVSA+APV+V AP AA   +A +   EKTE
Sbjct: 1   MSKVQEVLDIVKGMTVLELAELVKKFEEEFGVSAAAPVAVAAPAAAAGAAAPAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LK  D    KI VIK VR +T LGLKEAK+LV++APK +K G SK+EA ++K KL 
Sbjct: 61  FNVILK--DVGANKIQVIKVVRELTGLGLKEAKDLVDNAPKPIKEGASKEEAEQIKAKLA 118

Query: 118 DAGATVELR 126
           + GATVE++
Sbjct: 119 EVGATVEIQ 127


>gi|229915442|gb|ACQ90787.1| ribosomal protein L12 [Oocystis solitaria]
          Length = 131

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 82/125 (65%), Gaps = 6/125 (4%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSA---ASEKTEFEVV 61
           I+EKL S+TL+EAAEL  ++E+ +GV ASAP       PV     +      EKT F+V+
Sbjct: 8   IIEKLKSITLLEAAELVSQIEETFGVDASAPTGGGFAMPVMQNDENQKEIVEEKTSFDVI 67

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      K+IAV+K +R +T LG+KEAKE+  S P +LK  +SK+EA   K++LE+AGA
Sbjct: 68  LEDIAS-DKRIAVLKVIRNLTSLGVKEAKEVTTSLPHTLKESVSKEEAETAKQQLEEAGA 126

Query: 122 TVELR 126
            V+++
Sbjct: 127 KVKIQ 131


>gi|210632501|ref|ZP_03297429.1| hypothetical protein COLSTE_01331 [Collinsella stercoris DSM 13279]
 gi|210159596|gb|EEA90567.1| hypothetical protein COLSTE_01331 [Collinsella stercoris DSM 13279]
          Length = 125

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  +TL+EA+EL K +E  +GVSA+AP +VVA  AA A  A  EKTEF+VVL+G
Sbjct: 7   EEIIEALKEMTLLEASELVKAIEDTFGVSAAAPAAVVAGPAAAA-PAEEEKTEFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KI VIK VR +T LGLKEAKE+VE+APK++  G  K++A   K+KLE AGA V 
Sbjct: 66  FGD--NKIQVIKVVRELTSLGLKEAKEVVENAPKAVIEGAKKEDAEAAKEKLEAAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|225175683|ref|ZP_03729677.1| ribosomal protein L7/L12 [Dethiobacter alkaliphilus AHT 1]
 gi|225169012|gb|EEG77812.1| ribosomal protein L7/L12 [Dethiobacter alkaliphilus AHT 1]
          Length = 125

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 95/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFE 59
           MS +  ++E +  +T++E +EL K  E+E+GVSA+APV++ A  AA   + A+ E+TEF+
Sbjct: 1   MSKVNEVLEIVKEMTVLELSELVKAFEEEFGVSAAAPVAMAAAPAAGGDAPAAAEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL G  D  KK+ VIK VR  T LGLKEAKELV++APK++K  +SK++A+ +K KLE+A
Sbjct: 61  VVLSGAGD--KKVQVIKAVREATGLGLKEAKELVDNAPKAVKEKVSKEDADALKAKLEEA 118

Query: 120 GATVELR 126
           GA+VE++
Sbjct: 119 GASVEVK 125


>gi|157363340|ref|YP_001470107.1| 50S ribosomal protein L7/L12 [Thermotoga lettingae TMO]
 gi|166990990|sp|A8F4F9|RL7_THELT RecName: Full=50S ribosomal protein L7/L12
 gi|157313944|gb|ABV33043.1| ribosomal protein L7/L12 [Thermotoga lettingae TMO]
          Length = 129

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 71/130 (54%), Positives = 94/130 (72%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFE 59
           N+E IVE +  LT+ E AEL K LE+++GVSA+AP++V A  A  AG+  +   EKTEF+
Sbjct: 2   NVEQIVEAIEKLTVAELAELVKALEEKFGVSAAAPIAVAAAAAPAAGAQQAQAEEKTEFD 61

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESA--PKSL-KTGLSKDEANEMKKKL 116
           V+LKGF     KI VIK VR IT LGLKEAK+LVE A  P ++ K+G+ K+EA ++KKKL
Sbjct: 62  VLLKGFGS--NKIGVIKVVREITGLGLKEAKDLVEKAGSPDAIVKSGIPKNEAEDIKKKL 119

Query: 117 EDAGATVELR 126
           E+AGA V L+
Sbjct: 120 EEAGAEVTLK 129


>gi|20808669|ref|NP_623840.1| ribosomal protein L7/L12 [Thermoanaerobacter tengcongensis MB4]
 gi|24212244|sp|Q8R7U5|RL7_THETN RecName: Full=50S ribosomal protein L7/L12
 gi|20517305|gb|AAM25444.1| Ribosomal protein L7/L12 [Thermoanaerobacter tengcongensis MB4]
          Length = 125

 Score = 90.5 bits (223), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 94/126 (74%), Gaps = 8/126 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I++ + ++T++E AEL K LE+E+GVSA+APV+V A  AA A +AA   EKTEF+V+L
Sbjct: 4   EEILQAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGAPAAAPAEEKTEFDVIL 63

Query: 63  K--GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +  G D    KI VIK VR IT LGLKEAK+LV+S PK +K G+SK+EAN++K K E+ G
Sbjct: 64  QEVGSD----KIKVIKVVREITGLGLKEAKDLVDSVPKPIKEGVSKEEANQIKAKFEEVG 119

Query: 121 ATVELR 126
           A VE++
Sbjct: 120 AKVEIK 125


>gi|238752788|ref|ZP_04614256.1| 50S ribosomal protein L7/L12 [Yersinia rohdei ATCC 43380]
 gi|238708986|gb|EEQ01236.1| 50S ribosomal protein L7/L12 [Yersinia rohdei ATCC 43380]
          Length = 122

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 90/128 (70%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     AA E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAA----EAAEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F +   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA+ +KK LE+
Sbjct: 57  NVVLASFGE--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEADSLKKSLEE 114

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 115 AGASVEIK 122


>gi|83815730|ref|YP_445877.1| ribosomal protein L7/L12 [Salinibacter ruber DSM 13855]
 gi|294507787|ref|YP_003571845.1| Ribosomal protein L7/L12 [Salinibacter ruber M8]
 gi|109893799|sp|Q2S1Q4|RL7_SALRD RecName: Full=50S ribosomal protein L7/L12
 gi|83757124|gb|ABC45237.1| ribosomal protein L7/L12 [Salinibacter ruber DSM 13855]
 gi|294344115|emb|CBH24893.1| Ribosomal protein L7/L12 [Salinibacter ruber M8]
          Length = 127

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/129 (44%), Positives = 84/129 (65%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV---SASAPVSVVAPVAAEAGSAASEKTE 57
           M++IE + E+L  LT+ EA EL+  LE+E+ +   SA   V+      A+  +   E+T 
Sbjct: 1   MADIEELAEQLVGLTIQEANELANHLEEEYDIQPASAGVAVAADGGGGADGDAEEEEQTA 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL G      KI VIKEVR+IT +GLKEAK LV+ AP  +  G+S++EA+++K ++E
Sbjct: 61  FDVVLTGIG--GNKIQVIKEVRSITGMGLKEAKSLVDEAPNPVSEGVSREEADDLKAQIE 118

Query: 118 DAGATVELR 126
           DAG  VEL+
Sbjct: 119 DAGGEVELQ 127


>gi|24216120|ref|NP_713601.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45656646|ref|YP_000732.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|67461164|sp|Q72UA9|RL7_LEPIC RecName: Full=50S ribosomal protein L7/L12
 gi|67461208|sp|Q8F0S1|RL7_LEPIN RecName: Full=50S ribosomal protein L7/L12
 gi|24197363|gb|AAN50619.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599882|gb|AAS69369.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 127

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 84/123 (68%), Gaps = 2/123 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSAS-APVSVVAPVAAEAGSAASEKTEFEVVLK 63
           E+++E++  LTL+EAA+L K++E ++G+SA+          A     AA E + F V+LK
Sbjct: 4   EALLEQIGKLTLVEAADLVKKMEDKFGISAAAPVAVAAVGAAPAGAGAAEEASTFNVILK 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GFD   KKI VIK VR IT LGL +AK LVE+  K++K G++K EA+++KKK E AGA +
Sbjct: 64  GFDSA-KKIEVIKLVREITGLGLADAKGLVEAGGKAVKEGVAKAEADDLKKKFEGAGAQI 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|291543748|emb|CBL16857.1| LSU ribosomal protein L12P [Ruminococcus sp. 18P13]
          Length = 123

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 62/120 (51%), Positives = 83/120 (69%), Gaps = 5/120 (4%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
            VE +  +T++E +EL   +++E+GV+A+   +  A   A   +AA EKTEF+VVL  F 
Sbjct: 9   FVEDIKGMTVMELSELVDAIQEEFGVTAAIAAAPAAGAGA---AAAEEKTEFDVVLASFG 65

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           D K  + VIK V+ I  LGLKEAKE+VESAPK+LK G SK +A E+K KLE AGATVEL+
Sbjct: 66  DSK--MGVIKAVKEILGLGLKEAKEVVESAPKTLKEGASKADAEEIKTKLEAAGATVELK 123


>gi|218692267|ref|YP_002400479.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli ED1a]
 gi|254806374|sp|B7MRB2|RL7_ECO81 RecName: Full=50S ribosomal protein L7/L12
 gi|218429831|emb|CAR10800.2| 50S ribosomal subunit protein L7/L12 [Escherichia coli ED1a]
          Length = 121

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 87/123 (70%), Gaps = 8/123 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFEVVLK 63
           + I+E ++++++++  EL   +E+++GVSA+A V+V   PV       A EKTEF+V+LK
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV-----ETAEEKTEFDVILK 60

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA V
Sbjct: 61  AAG--ANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEV 118

Query: 124 ELR 126
           E++
Sbjct: 119 EVK 121


>gi|299830539|ref|YP_003734987.1| 50S ribosomal protein L12 [Durinskia baltica]
 gi|297384903|gb|ADI40202.1| 50S ribosomal protein L12 [Durinskia baltica]
          Length = 127

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 83/127 (65%), Gaps = 8/127 (6%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASA----PVSVVAPVAAEAGSAASEKTEFE 59
           I  IVE+L +LTL+EA+EL   +E+ +GV ASA    P+ + A    E      EKTEF+
Sbjct: 5   INQIVEELKTLTLLEASELVSAIEETFGVDASAAAAGPIMMAAAAPVEE---VEEKTEFD 61

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           + L       KKIA++K +R+IT LGLKEAKELVESAPK ++  ++KD A + KK++E+A
Sbjct: 62  LSLDEVP-ADKKIAILKVIRSITGLGLKEAKELVESAPKVIQEAVAKDAAEDAKKQIEEA 120

Query: 120 GATVELR 126
           G    L+
Sbjct: 121 GGKASLK 127


>gi|300867214|ref|ZP_07111877.1| 50S ribosomal protein L7/L12 [Oscillatoria sp. PCC 6506]
 gi|300334828|emb|CBN57043.1| 50S ribosomal protein L7/L12 [Oscillatoria sp. PCC 6506]
          Length = 128

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 91/126 (72%), Gaps = 7/126 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEFEV 60
           + I+E+L SLTL+EA+EL K++E+ +GVSA+AP   +  + A  G AA     E+TEF+V
Sbjct: 6   DQILEQLKSLTLLEASELVKQIEEAFGVSAAAPTGTM--MMAGPGPAAVEEVEEQTEFDV 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+      KKIA++KEVR IT LGLKEAK+LVE+APK++K  ++K  A ++KK+LE  G
Sbjct: 64  ILEEVP-ADKKIAILKEVRTITGLGLKEAKDLVEAAPKAVKEAIAKAAAEDIKKQLEAVG 122

Query: 121 ATVELR 126
           A + ++
Sbjct: 123 AKIAIK 128


>gi|94987372|ref|YP_595305.1| 50S ribosomal protein L7/L12 [Lawsonia intracellularis PHE/MN1-00]
 gi|122988768|sp|Q1MPU3|RL7_LAWIP RecName: Full=50S ribosomal protein L7/L12
 gi|94731621|emb|CAJ54984.1| ribosomal protein L7/L12 [Lawsonia intracellularis PHE/MN1-00]
          Length = 128

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 94/125 (75%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEFEVV 61
           E ++E +S++T++E ++  K LE+++GVSA+AP   + + AP AA A + A EKTEF+V+
Sbjct: 6   EQVIEFISNMTVLELSQFIKELEEKFGVSAAAPAVGMMMAAPTAASAEAEAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +    KIAVIK VRA+T LGLKEAK+ V+ AP +LK G+SK++A E KK+L +AGA
Sbjct: 66  LK--EAGANKIAVIKVVRALTGLGLKEAKDKVDGAPSTLKEGVSKEDAEEAKKQLTEAGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEVK 128


>gi|84685446|ref|ZP_01013344.1| ribosomal protein L7/L12 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666603|gb|EAQ13075.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2654]
          Length = 125

 Score = 90.5 bits (223), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 89/127 (70%), Gaps = 5/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL + L++E+G+  +A   V +  P   +AG+AA EKTEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKEILKEEYGIEPAAGGAVMMAGPAGGDAGAAAEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVLK       KIAVIKEVR IT LGLKEAK+LVE+  K +K G+ K EA ++K KLE 
Sbjct: 61  DVVLK--SAGGNKIAVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEDIKGKLEA 117

Query: 119 AGATVEL 125
           AGA VEL
Sbjct: 118 AGAEVEL 124


>gi|169837724|ref|ZP_02870912.1| LSU ribosomal protein L12P (L7/L12) [candidate division TM7
           single-cell isolate TM7a]
          Length = 122

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L +++++E  E+ + +E+ +GVSA          A    +AA EKTEF+VVL
Sbjct: 4   NKEQFIEDLKAMSVLELKEVVEAIEETFGVSAQPVAVAGGAAAG---AAAEEKTEFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+AVIKEVR IT LGLKEAKELVE+  K++K G+SK+EA E+K KLE AGAT
Sbjct: 61  --VSAGGAKLAVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKEEAEEIKGKLEAAGAT 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|218779769|ref|YP_002431087.1| 50S ribosomal protein L7/L12 [Desulfatibacillum alkenivorans AK-01]
 gi|226733673|sp|B8FEU2|RL7_DESAA RecName: Full=50S ribosomal protein L7/L12
 gi|218761153|gb|ACL03619.1| ribosomal protein L7/L12 [Desulfatibacillum alkenivorans AK-01]
          Length = 126

 Score = 90.1 bits (222), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/128 (50%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I  E ++E ++++T++E +EL K +E+++GVSA+APV+ VA     A  A  EKTEF
Sbjct: 1   MADITKEDVLEFIANMTVLELSELIKDIEEKFGVSAAAPVAAVAMAGPAAADAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L    D  KKI VIKEVRAIT LGLKEAK LVE APK++K G++K++A ++K++LE 
Sbjct: 61  DVILLSAGD--KKIQVIKEVRAITGLGLKEAKALVEEAPKAVKEGIAKEDAEKVKEQLEG 118

Query: 119 AGATVELR 126
           AGA V+++
Sbjct: 119 AGAQVDIK 126


>gi|149278891|ref|ZP_01885026.1| 50S ribosomal protein L7/L12 [Pedobacter sp. BAL39]
 gi|255530760|ref|YP_003091132.1| 50S ribosomal protein L7/L12 [Pedobacter heparinus DSM 2366]
 gi|149230510|gb|EDM35894.1| 50S ribosomal protein L7/L12 [Pedobacter sp. BAL39]
 gi|255343744|gb|ACU03070.1| ribosomal protein L7/L12 [Pedobacter heparinus DSM 2366]
          Length = 124

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 91/126 (72%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  A +A  AA EK+ F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAGPAGDAAPAAEEKSTFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  +   +K+AV+K V+ +T LGLKEAK+LV+ APK LK G++KDEA  +KK+LE+AG
Sbjct: 61  ILK--EAGGQKLAVVKLVKDLTGLGLKEAKDLVDGAPKELKAGVAKDEAEALKKQLEEAG 118

Query: 121 ATVELR 126
           A VE++
Sbjct: 119 AVVEIK 124


>gi|52840566|ref|YP_094365.1| 50S ribosomal protein L7/L12 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54293313|ref|YP_125728.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Lens]
 gi|54296357|ref|YP_122726.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Paris]
 gi|148361061|ref|YP_001252268.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Corby]
 gi|296105870|ref|YP_003617570.1| large subunit ribosomal protein L7/L12 [Legionella pneumophila
           2300/99 Alcoy]
 gi|81601552|sp|Q5WZM0|RL7_LEGPL RecName: Full=50S ribosomal protein L7/L12
 gi|81602030|sp|Q5X867|RL7_LEGPA RecName: Full=50S ribosomal protein L7/L12
 gi|81603559|sp|Q5ZYQ1|RL7_LEGPH RecName: Full=50S ribosomal protein L7/L12
 gi|166222179|sp|A5IHS2|RL7_LEGPC RecName: Full=50S ribosomal protein L7/L12
 gi|52627677|gb|AAU26418.1| 50S ribosomal protein L7/L12 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750142|emb|CAH11534.1| 50S ribosomal subunit protein L7/L12 [Legionella pneumophila str.
           Paris]
 gi|53753145|emb|CAH14592.1| 50S ribosomal subunit protein L7/L12 [Legionella pneumophila str.
           Lens]
 gi|148282834|gb|ABQ56922.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Corby]
 gi|295647771|gb|ADG23618.1| large subunit ribosomal protein L7/L12 [Legionella pneumophila
           2300/99 Alcoy]
 gi|307609130|emb|CBW98576.1| 50S ribosomal subunit protein L7/L12 [Legionella pneumophila 130b]
          Length = 126

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 90/121 (74%), Gaps = 3/121 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLKGF 65
           I+E +S++T++E  EL + +E+++ VSA+A    VA  AA AG+AA+E +TEF VV+  F
Sbjct: 8   ILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAPAAGAGAAAAEEQTEFTVVMTSF 67

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                K+ VIK +R IT LGLKEAK+LVE AP ++K G+SKDEA  +KK+LE+AGATVE+
Sbjct: 68  GS--NKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGVSKDEAASIKKELEEAGATVEV 125

Query: 126 R 126
           +
Sbjct: 126 K 126


>gi|34556891|ref|NP_906706.1| 50S ribosomal protein L7/L12 [Wolinella succinogenes DSM 1740]
 gi|81653584|sp|Q7MA57|RL7_WOLSU RecName: Full=50S ribosomal protein L7/L12
 gi|34482606|emb|CAE09606.1| PUTATIVE 50S RIBOSOMAL SUBUNIT PROTEIN L7/L12 [Wolinella
           succinogenes]
          Length = 124

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  L+++E +EL K  E+++GVSA AP  V    A  A +A  EKTEF+V+L  
Sbjct: 6   EELLDYIGGLSVLELSELVKAFEEKFGVSA-APTVVAGAGAGVAAAAVEEKTEFDVIL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D  +KKI VIK VR +T LGLKEAK+ VE  P ++K G +KD+A  MK KLE+AGA VE
Sbjct: 63  LDGGEKKINVIKVVRELTGLGLKEAKDAVEKTPTTIKEGANKDDAAAMKAKLEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|189499298|ref|YP_001958768.1| 50S ribosomal protein L7/L12 [Chlorobium phaeobacteroides BS1]
 gi|226733659|sp|B3EL60|RL7_CHLPB RecName: Full=50S ribosomal protein L7/L12
 gi|189494739|gb|ACE03287.1| ribosomal protein L7/L12 [Chlorobium phaeobacteroides BS1]
          Length = 126

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++IE++VE++  L+L EA+EL K LE ++GVSA+  V   A  AA  G A +  E+TEF
Sbjct: 1   MASIEALVEEIGKLSLTEASELVKALEDKFGVSAAPAVFAGAAAAAPGGEAEAKEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V LK       KI VIK VR+IT LGLKEAKE+V+ APK +K  +SK+EA ++ K+L+D
Sbjct: 61  DVELKAV--GANKINVIKAVRSITGLGLKEAKEMVDGAPKVVKEAVSKEEAEKVAKELKD 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|218438010|ref|YP_002376339.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 7424]
 gi|226733670|sp|B7KIR5|RL7_CYAP7 RecName: Full=50S ribosomal protein L7/L12
 gi|218170738|gb|ACK69471.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 7424]
          Length = 131

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 79/113 (69%), Gaps = 6/113 (5%)

Query: 19  AAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EKTEFEVVLKGFDDPKKKIA 73
           AAEL K++E+ +GVSA+APV  +   A  A   A+     EKTEF+V+L+      KKIA
Sbjct: 20  AAELVKQIEETFGVSAAAPVGGMMMAAPGAVPGAAAEPEEEKTEFDVILEEVP-ADKKIA 78

Query: 74  VIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           ++K VR IT LGLKEAK+LVES PK +K G +KD+A E KKKLE+AGA V ++
Sbjct: 79  ILKVVRTITGLGLKEAKDLVESTPKPIKEGTNKDDAEETKKKLEEAGAKVTVK 131


>gi|163783790|ref|ZP_02178774.1| ribosomal protein L7/L12 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880943|gb|EDP74463.1| ribosomal protein L7/L12 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 114

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 83/116 (71%), Gaps = 5/116 (4%)

Query: 14  LTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVVLKGFDDPKK 70
           ++++E AEL K+LE+E+GVSA+A V+      A    A +   EKTEF+VVLK       
Sbjct: 1   MSVLEVAELVKKLEEEFGVSAAAMVAAAPAGGAAGAGAGAAAEEKTEFDVVLK--SPGGN 58

Query: 71  KIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           KI VIK VR IT LGLKEAKELV++APK +K G+SK+EA ++K KLE+AGA VEL+
Sbjct: 59  KIQVIKVVREITGLGLKEAKELVDNAPKPIKEGVSKEEAEQIKSKLEEAGAEVELK 114


>gi|238756061|ref|ZP_04617384.1| 50S ribosomal protein L7/L12 [Yersinia ruckeri ATCC 29473]
 gi|238705728|gb|EEP98122.1| 50S ribosomal protein L7/L12 [Yersinia ruckeri ATCC 29473]
          Length = 121

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     A  EKTEF+V+L  
Sbjct: 6   DQIIEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAA----EAVEEKTEFDVILSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA+VE
Sbjct: 62  FGD--NKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|15645813|ref|NP_207990.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 26695]
 gi|2500212|sp|P55834|RL7_HELPY RecName: Full=50S ribosomal protein L7/L12
 gi|2314361|gb|AAD08245.1| ribosomal protein L7/L12 (rpl7/l12) [Helicobacter pylori 26695]
          Length = 125

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  EK++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEKKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|304437201|ref|ZP_07397162.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369863|gb|EFM23527.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 123

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (71%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A   A   +   EKTEF VVL
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAVGGAAPAAGGEEKTEFTVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KKI VIK VR  T LGLKEAKELV+ APK +K  ++K EA E+KKKLE+AGAT
Sbjct: 62  AAAGD--KKINVIKAVREATGLGLKEAKELVDGAPKPIKENIAKAEAEELKKKLEEAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|146297204|ref|YP_001180975.1| ribosomal protein L7/L12 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|312127424|ref|YP_003992298.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor hydrothermalis
           108]
 gi|145410780|gb|ABP67784.1| LSU ribosomal protein L12P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|311777443|gb|ADQ06929.1| ribosomal protein L7/L12 [Caldicellulosiruptor hydrothermalis 108]
          Length = 129

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEV 60
           ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A +AA    EKTEF V
Sbjct: 6   VQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQAAAPAAEEKTEFNV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D    KI VIK VR IT LGLKEAK+LV+ APK +K  +SKDEA ++KKKLE+ G
Sbjct: 66  ILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDGAPKPIKENVSKDEAEQIKKKLEEVG 123

Query: 121 ATVELR 126
           A VEL+
Sbjct: 124 AKVELK 129


>gi|209527685|ref|ZP_03276182.1| ribosomal protein L7/L12 [Arthrospira maxima CS-328]
 gi|209491857|gb|EDZ92215.1| ribosomal protein L7/L12 [Arthrospira maxima CS-328]
          Length = 134

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 90/130 (69%), Gaps = 9/130 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--------KT 56
           + I+E+L SL+L+EA+EL K++E+ +GV ASA       + A  G AA          KT
Sbjct: 6   DQILEQLKSLSLLEASELVKQIEEAFGVDASASAGGGMMMMAAPGMAAPGAEAAAEEEKT 65

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L  F    KKIAV+K VR+IT LGLKEAK+LVESAPK++K   +K++A  +KK+L
Sbjct: 66  EFDVILTEFP-ADKKIAVLKVVRSITGLGLKEAKDLVESAPKAIKEATTKEDAESIKKQL 124

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 125 EEAGAKVEVK 134


>gi|160947269|ref|ZP_02094436.1| hypothetical protein PEPMIC_01202 [Parvimonas micra ATCC 33270]
 gi|158446403|gb|EDP23398.1| hypothetical protein PEPMIC_01202 [Parvimonas micra ATCC 33270]
          Length = 124

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 89/125 (71%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           + E I+E +  L+++E  EL K  E+++GVSASAPV V   VA    + A+E KTEF+V+
Sbjct: 2   DFEQILEAIEKLSVLELNELVKAAEEKFGVSASAPVVVGGAVAGGEAAGAAEEKTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L      K K  V+K V+ ++ LGLKEAKE+V++APK++K G+SK+EA +MK KLE+ GA
Sbjct: 62  LASVGAEKMK--VVKAVKDLSGLGLKEAKEVVDNAPKAVKEGVSKEEAEQMKAKLEEVGA 119

Query: 122 TVELR 126
           TVEL+
Sbjct: 120 TVELK 124


>gi|323446614|gb|EGB02714.1| hypothetical protein AURANDRAFT_59709 [Aureococcus anophagefferens]
 gi|323447257|gb|EGB03188.1| hypothetical protein AURANDRAFT_59664 [Aureococcus anophagefferens]
 gi|323449070|gb|EGB04961.1| hypothetical protein AURANDRAFT_59434 [Aureococcus anophagefferens]
          Length = 131

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/130 (46%), Positives = 85/130 (65%), Gaps = 6/130 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KT 56
           + ++ I+E + SLTL+EA+EL  ++E+ +GV ASA       +AA   +         K 
Sbjct: 3   AKVDDILEDIKSLTLVEASELVSKIEETFGVDASAAPMAGMMMAAPGAAGGGAEAAEEKD 62

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L       KKIAV+K VR IT LGLKEAK +VESAP +LK G SKDEA ++KK++
Sbjct: 63  EFDVMLTEVP-ADKKIAVLKIVRTITGLGLKEAKTMVESAPIALKEGASKDEAEDIKKQI 121

Query: 117 EDAGATVELR 126
           E+ GA VEL+
Sbjct: 122 EEGGAKVELK 131


>gi|114331773|ref|YP_747995.1| ribosomal protein L7/L12 [Nitrosomonas eutropha C91]
 gi|114308787|gb|ABI60030.1| LSU ribosomal protein L12P [Nitrosomonas eutropha C91]
          Length = 121

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 62/120 (51%), Positives = 91/120 (75%), Gaps = 4/120 (3%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I+E ++++T++E +EL K LE+++GVSA+APV+V A  AA   +A  E+TEF V+L    
Sbjct: 6   ILESIANMTVLELSELIKELEEKFGVSAAAPVAVAAAPAAA--AAVEEQTEFSVILTSAG 63

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           D   K+ VIK VRA+T LGLKEAK+LV+SAPK++K G+SKD+A  +KK+L +AGA  E++
Sbjct: 64  D--NKVNVIKVVRAVTGLGLKEAKDLVDSAPKAVKEGISKDDAEALKKQLTEAGAGCEIK 121


>gi|84515196|ref|ZP_01002559.1| ribosomal protein L7/L12 [Loktanella vestfoldensis SKA53]
 gi|84511355|gb|EAQ07809.1| ribosomal protein L7/L12 [Loktanella vestfoldensis SKA53]
          Length = 123

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL++A EL   L+ E+G+  +A  +V+    A    AA EKTEF+V
Sbjct: 1   MADLKKLAEEIVGLTLLQAQELKTILKDEYGIEPAAGGAVMMAGPAATAEAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  D   +KI VIKEVR IT LGLKEAK+LVE+  K +K G SK EA+E+K KLE AG
Sbjct: 61  VLK--DAGAQKINVIKEVRGITGLGLKEAKDLVEAGGK-VKEGASKAEADEIKAKLEAAG 117

Query: 121 ATVEL 125
           ATVEL
Sbjct: 118 ATVEL 122


>gi|148653834|ref|YP_001280927.1| 50S ribosomal protein L7/L12 [Psychrobacter sp. PRwf-1]
 gi|172048570|sp|A5WH36|RL7_PSYWF RecName: Full=50S ribosomal protein L7/L12
 gi|148572918|gb|ABQ94977.1| LSU ribosomal protein L12P [Psychrobacter sp. PRwf-1]
          Length = 125

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++  ++ +++++  EL   +E+++GV+A+A V+     AA   +AA EK EF+V+L  
Sbjct: 6   EDVLNAIAEMSVMDIVELISEMEEKFGVTAAAAVAAAPAAAAAGAAAAEEKDEFDVILAS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D  KK+ VIK VR  T LGLKEAKELVE AP  +K G +K EA E+KKKLE+AGATVE
Sbjct: 66  FGD--KKVGVIKAVREATGLGLKEAKELVEGAPAPIKEGANKVEAEELKKKLEEAGATVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|304414673|ref|ZP_07395726.1| 50S ribosomal protein L7/L12 [Candidatus Regiella insecticola LSR1]
 gi|304283174|gb|EFL91583.1| 50S ribosomal protein L7/L12 [Candidatus Regiella insecticola LSR1]
          Length = 154

 Score = 89.4 bits (220), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +++LT++E  EL   +E+++GVSA+A V+    + A   +   EKTEF+V+L  
Sbjct: 38  EQILEGVAALTVMEVVELIADMEEKFGVSAAAAVAAGPAMTA---AVVEEKTEFDVILTT 94

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR  T LGLK+AK+LVE APK++K G+SKD+A  +KKKLE+ GA+ E
Sbjct: 95  VG--ANKIQVIKAVREATGLGLKDAKDLVEGAPKAVKEGISKDDAEALKKKLEETGASCE 152

Query: 125 LR 126
           L+
Sbjct: 153 LK 154


>gi|317177943|dbj|BAJ55732.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F16]
          Length = 125

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAATESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|108804982|ref|YP_644919.1| 50S ribosomal protein L12P [Rubrobacter xylanophilus DSM 9941]
 gi|123368028|sp|Q1AU21|RL7_RUBXD RecName: Full=50S ribosomal protein L7/L12
 gi|108766225|gb|ABG05107.1| LSU ribosomal protein L12P [Rubrobacter xylanophilus DSM 9941]
          Length = 128

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 86/125 (68%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E ++E + ++T++E +EL K LE+ +GVSA+A  +  A   A    AA+    KTEF+V+
Sbjct: 6   EELIEAIENMTVLELSELVKALEERFGVSATAVAAAPAAAGAAGAEAAAAEEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+  D   KKI VIKEVRA T LGLKEAK LV+ AP  +K GL K+EA  +K KLE+AGA
Sbjct: 66  LQ--DAGAKKIQVIKEVRAATGLGLKEAKALVDEAPNPVKEGLPKEEAEALKAKLEEAGA 123

Query: 122 TVELR 126
           TVEL+
Sbjct: 124 TVELK 128


>gi|313896756|ref|ZP_07830304.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320530082|ref|ZP_08031152.1| ribosomal protein L7/L12 [Selenomonas artemidis F0399]
 gi|312974673|gb|EFR40140.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320137515|gb|EFW29427.1| ribosomal protein L7/L12 [Selenomonas artemidis F0399]
          Length = 124

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 93/125 (74%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A  AA AG AA+E KTEF VV
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGAAPAGGAAAEEKTEFTVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D  KKI VIK VR  T LGLKEAKELV+ APK +K  ++K EA E+K KLE+AGA
Sbjct: 62  LASAGD--KKINVIKAVREATGLGLKEAKELVDGAPKPVKENIAKAEAEELKGKLEEAGA 119

Query: 122 TVELR 126
           TVEL+
Sbjct: 120 TVELK 124


>gi|302344364|ref|YP_003808893.1| ribosomal protein L7/L12 [Desulfarculus baarsii DSM 2075]
 gi|301640977|gb|ADK86299.1| ribosomal protein L7/L12 [Desulfarculus baarsii DSM 2075]
          Length = 126

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I    ++E L ++T++E +EL K LE  +GVSA+AP++V A   A A +   EKTEF
Sbjct: 1   MADITKNDVIEFLKNMTVLELSELIKELEDVFGVSAAAPMAVAAAAPAAAEAVEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+   D  KKI VIK VRAIT LGLKEAK+LV+ APK +K  + KDEA  +K +LE+
Sbjct: 61  DVILETAGD--KKIQVIKVVRAITGLGLKEAKDLVDGAPKPVKEAVPKDEAESIKAQLEE 118

Query: 119 AGATVELR 126
           AGA V+++
Sbjct: 119 AGAVVQVK 126


>gi|116748983|ref|YP_845670.1| 50S ribosomal protein L7/L12 [Syntrophobacter fumaroxidans MPOB]
 gi|166990989|sp|A0LII3|RL7_SYNFM RecName: Full=50S ribosomal protein L7/L12
 gi|116698047|gb|ABK17235.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P
           [Syntrophobacter fumaroxidans MPOB]
          Length = 127

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (70%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           MS I  E +++ + ++T++E +EL K LE+ +GVSA+APV++ A  A  A +A    +TE
Sbjct: 1   MSTISKEDVIKFIENMTVLELSELVKELEERFGVSAAAPVAMAAMPAGAAEAAPVAEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F VV+ G  D  KKI VIKEVRAIT+LGLKEAK+LVE  P  +K  + KDEA  + K+L 
Sbjct: 61  FSVVITGVGD--KKIQVIKEVRAITNLGLKEAKDLVEKVPGVVKEAIPKDEAEAIAKQLT 118

Query: 118 DAGATVELR 126
           +AGATVE++
Sbjct: 119 EAGATVEIK 127


>gi|303256440|ref|ZP_07342454.1| ribosomal protein L7/L12 [Burkholderiales bacterium 1_1_47]
 gi|331000381|ref|ZP_08324061.1| ribosomal protein L7/L12 [Parasutterella excrementihominis YIT
           11859]
 gi|302859931|gb|EFL83008.1| ribosomal protein L7/L12 [Burkholderiales bacterium 1_1_47]
 gi|329572087|gb|EGG53756.1| ribosomal protein L7/L12 [Parasutterella excrementihominis YIT
           11859]
          Length = 125

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 89/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++S++++E +EL K +E+++GVSA+A    VA  A  A + A EK+EF+VVLK 
Sbjct: 6   EEILDAIASMSVLEVSELIKMMEEKFGVSAAAAAVAVAAPAGGAAAPAEEKSEFDVVLK- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+ VIK VR +T LGLKEAK+LV+ APK++K GL+K +A E +KKLE AGA VE
Sbjct: 65  -EIGANKVQVIKAVRELTGLGLKEAKDLVDGAPKTVKEGLAKADAEEAQKKLEAAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|149195229|ref|ZP_01872319.1| 50S ribosomal protein L7/L12 [Caminibacter mediatlanticus TB-2]
 gi|149134662|gb|EDM23148.1| 50S ribosomal protein L7/L12 [Caminibacter mediatlanticus TB-2]
          Length = 123

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 4/125 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
              E I+E + +LT+ E  EL K  E+++ VSA    +VVA   A  G AA EK+EF+V+
Sbjct: 3   CTFEQILETIENLTVKELNELVKLFEEKFEVSAQP--TVVAGAGAAGGEAAEEKSEFDVI 60

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  D   KKI VIK VR IT  GLKEAKE+V+ AP ++K  +SK+EA E+KK LE+AGA
Sbjct: 61  LK--DAGAKKINVIKVVRQITGAGLKEAKEMVDGAPTTIKEAVSKEEAEEIKKALEEAGA 118

Query: 122 TVELR 126
           TVE++
Sbjct: 119 TVEVK 123


>gi|308184946|ref|YP_003929079.1| 50S ribosomal protein L7/L12 [Helicobacter pylori SJM180]
 gi|308060866|gb|ADO02762.1| 50S ribosomal protein L7/L12 [Helicobacter pylori SJM180]
          Length = 125

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E AEL K  E+++GVSA+  V   A VA    + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELAELVKMFEEKFGVSATPTVVAGAAVAGGVAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|208435095|ref|YP_002266761.1| ribosomal protein L7/L12 [Helicobacter pylori G27]
 gi|210135357|ref|YP_002301796.1| 50S ribosomal protein L7/L12 [Helicobacter pylori P12]
 gi|217032209|ref|ZP_03437707.1| hypothetical protein HPB128_2g11 [Helicobacter pylori B128]
 gi|298735788|ref|YP_003728313.1| 50S ribosomal protein L7/L12 [Helicobacter pylori B8]
 gi|226733694|sp|B6JN38|RL7_HELP2 RecName: Full=50S ribosomal protein L7/L12
 gi|226733695|sp|B5Z8J6|RL7_HELPG RecName: Full=50S ribosomal protein L7/L12
 gi|208433024|gb|ACI27895.1| ribosomal protein L7/L12 [Helicobacter pylori G27]
 gi|210133325|gb|ACJ08316.1| 50S ribosomal protein L7/l12 [Helicobacter pylori P12]
 gi|216946080|gb|EEC24691.1| hypothetical protein HPB128_2g11 [Helicobacter pylori B128]
 gi|298354977|emb|CBI65849.1| large subunit ribosomal protein L7/L12 [Helicobacter pylori B8]
 gi|307637873|gb|ADN80323.1| LSU ribosomal protein L7/L12(P1/P2) [Helicobacter pylori 908]
 gi|317012980|gb|ADU83588.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Lithuania75]
 gi|325996470|gb|ADZ51875.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 2018]
 gi|325998059|gb|ADZ50267.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 2017]
          Length = 125

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E AEL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELAELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|269469119|gb|EEZ80667.1| ribosomal protein L7/L12 [uncultured SUP05 cluster bacterium]
          Length = 125

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 91/126 (72%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN + I+  ++ ++++   EL   +E+++GVSA+A  +  A  AA+AG A  EK+EF V
Sbjct: 3   LSN-DDILNAIADMSVMNVVELVSAMEEKFGVSAAAAAAAPAAAAADAGGAVEEKSEFNV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL  F   +KK+AVIK VR+IT LGLKEAK++VESA   +K G SK EA E++K+LE+AG
Sbjct: 62  VLTSF--GEKKVAVIKAVRSITGLGLKEAKDMVESADAVIKEGASKAEAEEIQKQLEEAG 119

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 120 ASVELK 125


>gi|189485076|ref|YP_001956017.1| 50S ribosomal protein L7/L12 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|226734490|sp|B1GZ74|RL7_UNCTG RecName: Full=50S ribosomal protein L7/L12
 gi|170287035|dbj|BAG13556.1| 50S ribosomal protein L7/L12 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 125

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +SS+++IE +EL K LE+++GVSA+AP   V    + A  A  EKTEF V+L  
Sbjct: 7   DQLIESISSMSVIELSELVKALEEKFGVSAAAPAPAVVAGTSPA-VATEEKTEFNVILGS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               K  I VIK VR +T LGLKEAK+LV+ APK++K  ++K EA E+KKK  + GATVE
Sbjct: 66  VGTSK--INVIKVVREVTGLGLKEAKDLVDGAPKTVKENVAKAEAEEIKKKFTEVGATVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|332042973|gb|EGI79171.1| ribosomal protein L7/L12 [Lacinutrix algicola 5H-3-7-4]
          Length = 124

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    +A   A  G AA E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAMAGPVAGGGDAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAK LV+ AP ++K  +SKDEA  +K +LE+AG
Sbjct: 61  ILKA--PGSAKLAVVKLVKELTGLGLKEAKGLVDEAPSAIKEAVSKDEAEALKSQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|261839920|gb|ACX99685.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 52]
 gi|317182450|dbj|BAJ60234.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F57]
          Length = 125

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAATESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|11467316|ref|NP_043173.1| ribosomal protein L12 [Cyanophora paradoxa]
 gi|1350606|sp|P48124|RK12_CYAPA RecName: Full=50S ribosomal protein L12, cyanelle
 gi|1016117|gb|AAA81204.1| ribosomal subunit L7 [Cyanophora paradoxa]
          Length = 126

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (69%), Gaps = 5/119 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----VVAPVAAEAGSAASEKTE 57
           S  + I+E+L  LTLIEAA+L K +E+ +GV ASAPV     ++AP A     AA EK+ 
Sbjct: 3   SKTDEILEQLKGLTLIEAADLVKAIEEAFGVDASAPVGGGMVMMAPAAGGGADAAEEKSA 62

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F++VL+      KKIAV+K VR++T+LGLKEAK+LVE+ PK +K G SKDE  ++KK L
Sbjct: 63  FDLVLEEVP-ADKKIAVLKVVRSLTNLGLKEAKDLVEATPKVVKEGASKDELKQLKKNL 120


>gi|110597685|ref|ZP_01385970.1| ribosomal protein L7/L12 [Chlorobium ferrooxidans DSM 13031]
 gi|110340805|gb|EAT59282.1| ribosomal protein L7/L12 [Chlorobium ferrooxidans DSM 13031]
          Length = 124

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 90/125 (72%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           +IE++VE++  LTL EA+EL K LE ++GVSA+         AA + + A E +TEF+VV
Sbjct: 2   SIETLVEEIGKLTLTEASELVKALETKFGVSAAPVAVAGVAAAAPSDAPAKEEQTEFDVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    + K  I VIK VRAIT LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+DAGA
Sbjct: 62  LTAAGESK--INVIKVVRAITGLGLKEAKDLVDGAPKTVKEAVSKDEAEKIAKELKDAGA 119

Query: 122 TVELR 126
           +VEL+
Sbjct: 120 SVELK 124


>gi|37521171|ref|NP_924548.1| 50S ribosomal protein L7/L12 [Gloeobacter violaceus PCC 7421]
 gi|81710263|sp|Q7NK76|RL7_GLOVI RecName: Full=50S ribosomal protein L7/L12
 gi|35212167|dbj|BAC89543.1| 50S ribosomal protein L12 [Gloeobacter violaceus PCC 7421]
          Length = 137

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/135 (46%), Positives = 89/135 (65%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---VVAP-------VAAEAGSAA 52
            +E I+E L +L+L+EAAEL K +E+ +GV A AP     +V P        AA      
Sbjct: 5   RVEKILEDLKALSLLEAAELVKGIEEVFGVKAEAPAGGGMMVMPGVMPGAPAAAAPAEPV 64

Query: 53  SEKTEFEVVLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
            E+TEF V+L+  + P  KKIA++K  R IT LGLKEAK+LVE+APK++K G++KD+A  
Sbjct: 65  EEQTEFTVMLE--EVPADKKIAILKVAREITGLGLKEAKDLVEAAPKAVKEGVNKDDAAT 122

Query: 112 MKKKLEDAGATVELR 126
           +KKKLE+AGA   ++
Sbjct: 123 IKKKLEEAGAKASIK 137


>gi|87300792|ref|ZP_01083634.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 5701]
 gi|87284663|gb|EAQ76615.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 5701]
          Length = 127

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 87/126 (69%), Gaps = 2/126 (1%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFEV 60
           +  + I+E L +L+L+EA+EL K++E+ +GVSA+A   VV A   A A  AA E+TEF+V
Sbjct: 3   TKTDDILESLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAAPAAAAEAAEEQTEFDV 62

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+ FD    KI V+K VR  T LGL EAK LVE+APK++K G++K +A  +KK +E+ G
Sbjct: 63  ILESFD-AAAKIKVLKAVREATGLGLGEAKALVEAAPKAVKEGIAKGDAEALKKSIEEVG 121

Query: 121 ATVELR 126
             V ++
Sbjct: 122 GKVTIK 127


>gi|254461215|ref|ZP_05074631.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2083]
 gi|206677804|gb|EDZ42291.1| ribosomal protein L7/L12 [Rhodobacteraceae bacterium HTCC2083]
          Length = 125

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/127 (49%), Positives = 89/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  A+    V+A      G+AA E+TEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAGGDAGGAAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK     K  I VIKEVRAIT LGLKEAKELVE+  K++K G+SK+EA ++K KLE A
Sbjct: 61  VILKAAGASK--INVIKEVRAITGLGLKEAKELVEAGGKAVKEGVSKEEAEDVKGKLEAA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAEVEVK 125


>gi|145297377|ref|YP_001140218.1| 50S ribosomal protein L7/L12 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166222131|sp|A4SHU8|RL7_AERS4 RecName: Full=50S ribosomal protein L7/L12
 gi|142850149|gb|ABO88470.1| ribosomal protein L12 [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 120

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 7/122 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++S++++E  EL + +E+++GVSA+  V+     A  A  A  EKTEF+VVL  
Sbjct: 6   DQIIEAVASMSVMEVVELIEAMEEKFGVSAAVAVA-----AGPAAEAVEEKTEFDVVLTA 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VRA T LGLKEAK+LVE+AP +LK  +SKDEA  +KK+LE+AGA+VE
Sbjct: 61  --AGANKVAVIKAVRAATGLGLKEAKDLVEAAPANLKEAISKDEAETLKKQLEEAGASVE 118

Query: 125 LR 126
           ++
Sbjct: 119 IK 120


>gi|212702085|ref|ZP_03310213.1| hypothetical protein DESPIG_00092 [Desulfovibrio piger ATCC 29098]
 gi|212674490|gb|EEB34973.1| hypothetical protein DESPIG_00092 [Desulfovibrio piger ATCC 29098]
          Length = 128

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 89/125 (71%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E +VE +S++T++E +E  K LE+++GVSA+AP + +   A   G AA+   EKTEF+V+
Sbjct: 6   EQVVEFISNMTVLELSEFIKELEEKFGVSAAAPAAAMVMAAPADGGAAAAAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +    KI VIK VRA+T LGLKEAKE V+  P +LK G+SK+EA E KK+L +AGA
Sbjct: 66  LK--EAGANKIGVIKVVRALTSLGLKEAKEKVDGCPSTLKEGVSKEEAEEAKKQLTEAGA 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 VVEVK 128


>gi|320161297|ref|YP_004174521.1| 50S ribosomal protein L7/L12 [Anaerolinea thermophila UNI-1]
 gi|319995150|dbj|BAJ63921.1| 50S ribosomal protein L7/L12 [Anaerolinea thermophila UNI-1]
          Length = 129

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/130 (50%), Positives = 93/130 (71%), Gaps = 7/130 (5%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EK 55
           M+++  +VE+LS+L+++EAAEL K LE++WGVSA+APV+ VA +    G+AA      EK
Sbjct: 1   MADLNKLVEELSALSVLEAAELVKMLEEKWGVSAAAPVAAVAAMPVAGGAAAPAEPVEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+VVLK  D   KKI VIK +R +T+LGL EAK + E+A   + +G+ K+ AN+ K K
Sbjct: 61  TEFDVVLK--DAGPKKIEVIKVIRQLTNLGLVEAKTMAETAGAKVLSGVGKEAANDAKSK 118

Query: 116 LEDAGATVEL 125
           LE AGA VE+
Sbjct: 119 LEAAGAVVEI 128


>gi|83949808|ref|ZP_00958541.1| ribosomal protein L7/L12 [Roseovarius nubinhibens ISM]
 gi|83837707|gb|EAP77003.1| ribosomal protein L7/L12 [Roseovarius nubinhibens ISM]
          Length = 126

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/128 (50%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL   L+ E+G+  +A   V V A      G+AA E+TEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMVAAAGGDAGGAAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       KI VIKEVRAIT LGLKEAKELVE+  K++K  +SKDEA ++K KLE 
Sbjct: 61  DVILKSA--GASKINVIKEVRAITGLGLKEAKELVEAGGKAVKEQVSKDEAEDIKGKLEA 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|284050924|ref|ZP_06381134.1| 50S ribosomal protein L7/L12 [Arthrospira platensis str. Paraca]
 gi|291565929|dbj|BAI88201.1| 50S ribosomal protein L7/L12 [Arthrospira platensis NIES-39]
          Length = 134

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 90/130 (69%), Gaps = 9/130 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--------KT 56
           + I+E+L SL+L+EA+EL K++E+ +GV ASA       + A  G AA          KT
Sbjct: 6   DQILEQLKSLSLLEASELVKQIEEAFGVDASASAGGGMMMMAAPGMAAPGAEAAAEEEKT 65

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L  F    KKIAV+K VR+IT LGLKEAK+LVESAPK++K   +K++A  +KK+L
Sbjct: 66  EFDVILTEFP-ADKKIAVLKVVRSITGLGLKEAKDLVESAPKAIKEATTKEDAESIKKQL 124

Query: 117 EDAGATVELR 126
           E++GA VE++
Sbjct: 125 EESGAKVEVK 134


>gi|292670286|ref|ZP_06603712.1| ribosomal protein L7/L12 [Selenomonas noxia ATCC 43541]
 gi|292648017|gb|EFF65989.1| ribosomal protein L7/L12 [Selenomonas noxia ATCC 43541]
          Length = 124

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/125 (52%), Positives = 90/125 (72%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A   A   +A  E K+EF VV
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGGAAPAAAGGEEKSEFTVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D  KKI VIK VR  T LGLKEAKELV+ APK +K  ++K EA+E+K KLE+AGA
Sbjct: 62  LAAAGD--KKINVIKAVREATGLGLKEAKELVDGAPKPVKENVAKAEADELKAKLEEAGA 119

Query: 122 TVELR 126
           TVEL+
Sbjct: 120 TVELK 124


>gi|322434563|ref|YP_004216775.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX9]
 gi|321162290|gb|ADW67995.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX9]
          Length = 123

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I+ + + + SL+L+EA+ L K+LE+  GVSA+A  +  A     A +   EKTEF V
Sbjct: 1   MADIQQLEDSIVSLSLLEASALVKKLEERLGVSAAAAAAAPAAGGGAAAAVVEEKTEFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D    KI+ IK VR +T LGLKEAK+LV+ APK LK G+SKD+A  + KK E   
Sbjct: 61  ILK--DAGANKISTIKTVREVTGLGLKEAKDLVDGAPKPLKEGVSKDDAAAIAKKFEGI- 117

Query: 121 ATVELR 126
           ATVE++
Sbjct: 118 ATVEIK 123


>gi|297183425|gb|ADI19558.1| hypothetical protein [uncultured gamma proteobacterium
           HF0770_27E13]
          Length = 131

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 88/130 (67%), Gaps = 7/130 (5%)

Query: 2   SNI---ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--EAGSAASEKT 56
           SNI   E ++E +S +++++  EL   +E+++GVSASAP  V     A  E      E+T
Sbjct: 4   SNIASREELLEAISKMSVMDLVELISEMEEKFGVSASAPAPVAVAATAGAEPSDKEDEQT 63

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+++LK F D   KIAVIK VRAIT LGLK+AK++VE AP ++K  +SK E  EM K+L
Sbjct: 64  EFDLILKSFGD--NKIAVIKAVRAITSLGLKDAKDMVEKAPITIKEAVSKKEVEEMTKQL 121

Query: 117 EDAGATVELR 126
           ED+GA VEL+
Sbjct: 122 EDSGAVVELK 131


>gi|319897824|ref|YP_004136021.1| 50S ribosomal subunit protein l7/l12 [Haemophilus influenzae F3031]
 gi|317433330|emb|CBY81707.1| 50S ribosomal subunit protein L7/L12 [Haemophilus influenzae F3031]
          Length = 124

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S T+ E  EL   +E+++GVSA+A     AP A  A +AA EKTEF+VVLK 
Sbjct: 6   EQIIEAIASKTVTEIVELIAAMEEKFGVSAAAAAVAAAPAAGGA-AAAEEKTEFDVVLK- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +KK+LE+AGA VE
Sbjct: 64  -SAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAEALKKELEEAGAEVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|281491788|ref|YP_003353768.1| 50S ribosomal protein L12P (L7/L12) [Lactococcus lactis subsp.
           lactis KF147]
 gi|281375502|gb|ADA65012.1| LSU ribosomal protein L12P (L7/L12) [Lactococcus lactis subsp.
           lactis KF147]
          Length = 121

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+IV +L + T++E +EL K +E+++ V+A+APV+  A        AA+ K  F+V L
Sbjct: 4   NIENIVAELENATILELSELVKAIEEKFDVTAAAPVAAAAGAG----DAAAAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KK+AVIKEVR IT LGLKEAKELV+ AP  +K GLS+ EANE+K+KLE AGA+
Sbjct: 60  TSAGD--KKVAVIKEVRGITGLGLKEAKELVDGAPTMIKEGLSESEANEIKEKLEAAGAS 117

Query: 123 VELR 126
           + L+
Sbjct: 118 ITLK 121


>gi|16272584|ref|NP_438801.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae Rd KW20]
 gi|68249219|ref|YP_248331.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 86-028NP]
 gi|145629685|ref|ZP_01785482.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 22.1-21]
 gi|145631670|ref|ZP_01787433.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae R3021]
 gi|145633889|ref|ZP_01789610.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 3655]
 gi|145635666|ref|ZP_01791362.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittAA]
 gi|145638007|ref|ZP_01793642.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittHH]
 gi|145639389|ref|ZP_01794994.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittII]
 gi|145642229|ref|ZP_01797796.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae R3021]
 gi|148826726|ref|YP_001291479.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittEE]
 gi|148827818|ref|YP_001292571.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittGG]
 gi|229845631|ref|ZP_04465756.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 6P18H1]
 gi|229847420|ref|ZP_04467520.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 7P49H1]
 gi|260581383|ref|ZP_05849198.1| ribosomal protein L7/L12 [Haemophilus influenzae RdAW]
 gi|260583187|ref|ZP_05850966.1| ribosomal protein L7/L12 [Haemophilus influenzae NT127]
 gi|329122556|ref|ZP_08251138.1| 50S ribosomal protein L7/L12 [Haemophilus aegyptius ATCC 11116]
 gi|1173065|sp|P44348|RL7_HAEIN RecName: Full=50S ribosomal protein L7/L12
 gi|81336377|sp|Q4QMS6|RL7_HAEI8 RecName: Full=50S ribosomal protein L7/L12
 gi|166222172|sp|A5UE95|RL7_HAEIE RecName: Full=50S ribosomal protein L7/L12
 gi|166222173|sp|A5UHD2|RL7_HAEIG RecName: Full=50S ribosomal protein L7/L12
 gi|1573639|gb|AAC22301.1| ribosomal protein L7/L12 (rpL7/L12) [Haemophilus influenzae Rd
           KW20]
 gi|68057418|gb|AAX87671.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 86-028NP]
 gi|144978196|gb|EDJ87969.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 22.1-21]
 gi|144982693|gb|EDJ90229.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae R3021]
 gi|144985261|gb|EDJ92104.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 3655]
 gi|145267061|gb|EDK07069.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittAA]
 gi|145268801|gb|EDK08769.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittHH]
 gi|145271436|gb|EDK11348.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittII]
 gi|145273089|gb|EDK12968.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 22.4-21]
 gi|148716886|gb|ABQ99096.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittEE]
 gi|148719060|gb|ABR00188.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae PittGG]
 gi|229809658|gb|EEP45384.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 7P49H1]
 gi|229811431|gb|EEP47135.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae 6P18H1]
 gi|260091978|gb|EEW75926.1| ribosomal protein L7/L12 [Haemophilus influenzae RdAW]
 gi|260093744|gb|EEW77653.1| ribosomal protein L7/L12 [Haemophilus influenzae NT127]
 gi|301169357|emb|CBW28957.1| 50S ribosomal subunit protein L7/L12 [Haemophilus influenzae 10810]
 gi|309751765|gb|ADO81749.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae R2866]
 gi|309973867|gb|ADO97068.1| 50S ribosomal protein L7/L12 [Haemophilus influenzae R2846]
 gi|327473139|gb|EGF18564.1| 50S ribosomal protein L7/L12 [Haemophilus aegyptius ATCC 11116]
          Length = 123

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S T+ E  EL   +E+++GVSA+A V+          +AA EKTEF+VVLK 
Sbjct: 6   EQIIEAIASKTVTEIVELIAAMEEKFGVSAAAAVAAAPAAGGA--AAAEEKTEFDVVLK- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +KK+LE+AGA VE
Sbjct: 63  -SAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAEALKKELEEAGAEVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|255534438|ref|YP_003094809.1| 50S ribosomal protein L7/L12 [Flavobacteriaceae bacterium 3519-10]
 gi|255340634|gb|ACU06747.1| LSU ribosomal protein L7/L12 (L23e) [Flavobacteriaceae bacterium
           3519-10]
          Length = 122

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL+  L+ E+G+  +A   V++  A     AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELATILKDEYGIEPAAAAVVMS--AGGGAEAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLKEAK++V+SAP  +KTG+SKDEA  +KK+LE+AG
Sbjct: 59  ILKAAGG--SKLAVVKLVKDLTGAGLKEAKDMVDSAPAPIKTGISKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VE++
Sbjct: 117 AEVEVK 122


>gi|224436426|ref|ZP_03657443.1| 50S ribosomal protein L7/L12 [Helicobacter cinaedi CCUG 18818]
 gi|313142940|ref|ZP_07805133.1| 50S ribosomal protein L7/L12 [Helicobacter cinaedi CCUG 18818]
 gi|313127971|gb|EFR45588.1| 50S ribosomal protein L7/L12 [Helicobacter cinaedi CCUG 18818]
          Length = 124

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA AP  V   VA    +AA EKT+F V+L  
Sbjct: 6   EDVLEYIGNLSVLELSELVKAFEEKFGVSA-APTVVAGAVAGGGAAAAEEKTDFNVIL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR IT LGLKEAK+  E  P +LK G+SK++A   KKKLE+ GA VE
Sbjct: 63  VDAGANKINVIKVVREITGLGLKEAKDATEQTPSTLKEGVSKEDAENFKKKLEEVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|117620804|ref|YP_858457.1| 50S ribosomal protein L7/L12 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166222130|sp|A0KQA6|RL7_AERHH RecName: Full=50S ribosomal protein L7/L12
 gi|117562211|gb|ABK39159.1| ribosomal protein L7/L12 [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 121

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++S++++E  EL + +E+++GVSA+A V      A     A  EKTEF+VVL  
Sbjct: 6   DQIIEAVASMSVMEVVELIEAMEEKFGVSAAAAVMAGPAAA----EAVEEKTEFDVVLTA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVE+AP +LK  +SKDEA  +KK+LE AGA+VE
Sbjct: 62  --AGANKVAVIKAVRGATGLGLKEAKDLVEAAPANLKEAVSKDEAEALKKELEAAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|323703911|ref|ZP_08115543.1| ribosomal protein L7/L12 [Desulfotomaculum nigrificans DSM 574]
 gi|323531127|gb|EGB21034.1| ribosomal protein L7/L12 [Desulfotomaculum nigrificans DSM 574]
          Length = 127

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 92/129 (71%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           MS +  ++E +  LT++E AEL K  E+E+GVSA+APV+V A  AA A +A +   EKTE
Sbjct: 1   MSKVAEVLEIVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAPAAGAAAAGAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L    D  KKI VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +K KL 
Sbjct: 61  FDVILASAGD--KKINVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKEEAESIKAKLT 118

Query: 118 DAGATVELR 126
           +AGATVE++
Sbjct: 119 EAGATVEVK 127


>gi|323149181|ref|YP_004222010.1| ribosomal protein L12 [Coccomyxa sp. C-169]
 gi|317467237|gb|ADV29858.1| ribosomal protein L12 [Coccomyxa sp. C-169]
          Length = 129

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 84/127 (66%), Gaps = 4/127 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE---F 58
           +  E I+EKL ++TL EAAEL  R+E+ +GV ASAP    A     AG AA  + E   F
Sbjct: 3   TTTEEIIEKLKTITLFEAAELVSRIEETFGVDASAPSGGFASAPLAAGEAAEAQEEKTAF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+     K+ +AV+K +R +T LGLKEAKE   S PK++K G+SK+EA + K++LE+
Sbjct: 63  DVILEDVASDKR-VAVLKVIRNLTSLGLKEAKEFTSSLPKAVKEGVSKEEAEQAKQQLEE 121

Query: 119 AGATVEL 125
           AG  V++
Sbjct: 122 AGGKVKI 128


>gi|224418579|ref|ZP_03656585.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|253826870|ref|ZP_04869755.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|313142107|ref|ZP_07804300.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|253510276|gb|EES88935.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|313131138|gb|EFR48755.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
          Length = 124

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA AP  V   VA  AG+AA EKTEF+V+L  
Sbjct: 6   EDVLEYIGNLSVMELSELVKAFEEKFGVSA-APTVVAGAVAGGAGAAAEEKTEFDVILA- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR +T LGLKEAK+ VE  P ++K G+ K++A  MK K E+AGA VE
Sbjct: 64  -DSGDKKINVIKVVREVTGLGLKEAKDAVEKTPFTVKEGVKKEDAEAMKAKFEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|125975205|ref|YP_001039115.1| 50S ribosomal protein L12P [Clostridium thermocellum ATCC 27405]
 gi|256003133|ref|ZP_05428125.1| ribosomal protein L7/L12 [Clostridium thermocellum DSM 2360]
 gi|281419556|ref|ZP_06250567.1| ribosomal protein L7/L12 [Clostridium thermocellum JW20]
 gi|125715430|gb|ABN53922.1| LSU ribosomal protein L12P [Clostridium thermocellum ATCC 27405]
 gi|255992824|gb|EEU02914.1| ribosomal protein L7/L12 [Clostridium thermocellum DSM 2360]
 gi|281406778|gb|EFB37045.1| ribosomal protein L7/L12 [Clostridium thermocellum JW20]
 gi|316939369|gb|ADU73403.1| ribosomal protein L7/L12 [Clostridium thermocellum DSM 1313]
          Length = 129

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 9/129 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFE 59
            +  ++E + +L+++E +EL K LE+E+GVSA+APV+V A  AA  G+AA    EKTEFE
Sbjct: 5   KVTKLIEDVKALSVLELSELVKALEEEFGVSAAAPVAVAAVGAAAPGAAAPAAEEKTEFE 64

Query: 60  VVLK--GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           V+LK  G D    KI VIK VR +T LGLKEAK+LV+ APK+LK G+SKDEA +++ K +
Sbjct: 65  VILKSPGAD----KIKVIKVVREVTGLGLKEAKDLVDGAPKTLKEGVSKDEAAQIEAKFK 120

Query: 118 DAGATVELR 126
           + GATVE++
Sbjct: 121 EVGATVEIK 129


>gi|317052111|ref|YP_004113227.1| 50S ribosomal protein L7/L12 [Desulfurispirillum indicum S5]
 gi|316947195|gb|ADU66671.1| ribosomal protein L7/L12 [Desulfurispirillum indicum S5]
          Length = 126

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (75%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E  +  L +++++E AEL K LE+++GVSA+APV+V A   A   +AA E KTEF+V+L 
Sbjct: 6   EDFISYLENMSVLELAELVKELEEKFGVSAAAPVAVAAAGPAAGPAAAEEEKTEFDVIL- 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +  +KKI VIK VR +T LGLKEAK+LVE APK++K G+SKD+ANE+K KLE+AGA V
Sbjct: 65  -VNAGEKKINVIKVVREVTGLGLKEAKDLVEGAPKAVKEGVSKDQANELKAKLEEAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|162419344|ref|YP_001607195.1| 50S ribosomal protein L7/L12 [Yersinia pestis Angola]
 gi|229839430|ref|ZP_04459589.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|226734499|sp|A9R0H7|RL7_YERPG RecName: Full=50S ribosomal protein L7/L12
 gi|162352159|gb|ABX86107.1| ribosomal protein L7/L12 [Yersinia pestis Angola]
 gi|229695796|gb|EEO85843.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. PEXU2]
          Length = 130

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (68%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A   A   +AA E    
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAVAAGPAAAVEAAEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVL  F +   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK
Sbjct: 61  QTEFDVVLASFGE--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKK 118

Query: 115 KLEDAGATVELR 126
            LE+AGA+VE++
Sbjct: 119 SLEEAGASVEIK 130


>gi|302337470|ref|YP_003802676.1| ribosomal protein L7/L12 [Spirochaeta smaragdinae DSM 11293]
 gi|301634655|gb|ADK80082.1| ribosomal protein L7/L12 [Spirochaeta smaragdinae DSM 11293]
          Length = 129

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 96/124 (77%), Gaps = 3/124 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E I+E +++++++E +EL   +E+++GV+A+APV+V A  AA A +AA E  KTEF+V+L
Sbjct: 7   EDILEAIANMSVLEVSELITMMEEKFGVTAAAPVAVAAAGAAPAAAAAEEEEKTEFDVIL 66

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K   D KK I VIKEVRAIT LGLKEAK++VE+  K++K G+SK++A  MK+KLE AGA 
Sbjct: 67  KSVADGKK-IPVIKEVRAITGLGLKEAKDIVEAGDKAIKEGVSKEDAASMKEKLEAAGAV 125

Query: 123 VELR 126
           VE++
Sbjct: 126 VEVK 129


>gi|119899714|ref|YP_934927.1| 50S ribosomal protein L7/L12 [Azoarcus sp. BH72]
 gi|166222133|sp|A1KB35|RL7_AZOSB RecName: Full=50S ribosomal protein L7/L12
 gi|119672127|emb|CAL96041.1| 50S ribosomal subunit protein L7/L12 [Azoarcus sp. BH72]
          Length = 125

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + S+T++E  +L K  E+++GVSA+A           A  AA EKTEF+V+L  
Sbjct: 6   DDILEAVGSMTVMELNDLVKAFEEKFGVSAAALAVAAPGAGGAAAPAAEEKTEFDVILTA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VRA T LGLKEAK++V+ APK++K G++K +A  +KK+LEDAGA VE
Sbjct: 66  A--GEKKVEVIKVVRAATGLGLKEAKDVVDGAPKAVKEGIAKADAEALKKQLEDAGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|219848381|ref|YP_002462814.1| 50S ribosomal protein L7/L12 [Chloroflexus aggregans DSM 9485]
 gi|254806271|sp|B8G988|RL7_CHLAD RecName: Full=50S ribosomal protein L7/L12
 gi|219542640|gb|ACL24378.1| ribosomal protein L7/L12 [Chloroflexus aggregans DSM 9485]
          Length = 132

 Score = 88.2 bits (217), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 88/134 (65%), Gaps = 10/134 (7%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--------SVVAPVAAEAGSAA 52
           MS I++I+E +  L ++E  EL K++E++WGV+A+APV           A   A A + A
Sbjct: 1   MSKIDTIIEMIEGLNVLELVELKKKMEEKWGVTAAAPVMAMGVAAPVAAAGDGAAAAAPA 60

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKTEF+V+LK  +    KI VIK VR +T LGLKEAK+LVE APK ++ G+SK+EA   
Sbjct: 61  EEKTEFDVILK--EAGPNKIQVIKVVRELTSLGLKEAKDLVEGAPKPVREGVSKEEAEAA 118

Query: 113 KKKLEDAGATVELR 126
           K KL + GA VE++
Sbjct: 119 KAKLTEVGAVVEIK 132


>gi|317180926|dbj|BAJ58712.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F32]
          Length = 125

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA    + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGVAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|261838521|gb|ACX98287.1| ribosomal protein L7/L12 [Helicobacter pylori 51]
 gi|315587087|gb|ADU41468.1| ribosomal protein L7/L12 [Helicobacter pylori 35A]
          Length = 125

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGSAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|15612187|ref|NP_223839.1| 50S ribosomal protein L7/L12 [Helicobacter pylori J99]
 gi|108563563|ref|YP_627879.1| 50S ribosomal protein L7/L12 [Helicobacter pylori HPAG1]
 gi|188527986|ref|YP_001910673.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Shi470]
 gi|217034096|ref|ZP_03439517.1| hypothetical protein HP9810_893g43 [Helicobacter pylori 98-10]
 gi|308183304|ref|YP_003927431.1| 50S ribosomal protein L7/L12 [Helicobacter pylori PeCan4]
 gi|7388074|sp|P56875|RL7_HELPJ RecName: Full=50S ribosomal protein L7/L12
 gi|123373707|sp|Q1CS67|RL7_HELPH RecName: Full=50S ribosomal protein L7/L12
 gi|226733696|sp|B2UUW1|RL7_HELPS RecName: Full=50S ribosomal protein L7/L12
 gi|1840151|gb|AAB47278.1| 50S ribosomal protein L7/L12 [Helicobacter pylori]
 gi|4155719|gb|AAD06700.1| 50S RIBOSOMAL PROTEIN L7/L12 [Helicobacter pylori J99]
 gi|107837336|gb|ABF85205.1| ribosomal protein L7/L12 [Helicobacter pylori HPAG1]
 gi|188144226|gb|ACD48643.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Shi470]
 gi|216943491|gb|EEC22945.1| hypothetical protein HP9810_893g43 [Helicobacter pylori 98-10]
 gi|297380381|gb|ADI35268.1| ribosomal protein L7/L12 [Helicobacter pylori v225d]
 gi|308062480|gb|ADO04368.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Cuz20]
 gi|308063980|gb|ADO05867.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Sat464]
 gi|308065489|gb|ADO07381.1| 50S ribosomal protein L7/L12 [Helicobacter pylori PeCan4]
 gi|317009877|gb|ADU80457.1| 50S ribosomal protein L7/L12 [Helicobacter pylori India7]
 gi|317011401|gb|ADU85148.1| 50S ribosomal protein L7/L12 [Helicobacter pylori SouthAfrica7]
 gi|317178504|dbj|BAJ56292.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F30]
          Length = 125

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|15673250|ref|NP_267424.1| 50S ribosomal protein L7/L12 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|14195168|sp|Q9CG42|RL7_LACLA RecName: Full=50S ribosomal protein L7/L12
 gi|12724243|gb|AAK05366.1|AE006359_4 50S ribosomal protein L7/L12 [Lactococcus lactis subsp. lactis
           Il1403]
 gi|326406807|gb|ADZ63878.1| 50S ribosomal protein L12P [Lactococcus lactis subsp. lactis CV56]
          Length = 121

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+IV +L + T++E +EL K +E+++ V+A+APV+  A        AA+ K  F+V L
Sbjct: 4   NIENIVAELENATILELSELVKAIEEKFDVTAAAPVAAAAGAG----DAAAAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KK+AVIKEVR IT LGLKEAKELV+ AP  +K GLS+ EANE+K+KLE AGA+
Sbjct: 60  TSAGD--KKVAVIKEVRGITGLGLKEAKELVDGAPTMIKEGLSESEANEVKEKLEAAGAS 117

Query: 123 VELR 126
           + L+
Sbjct: 118 ITLK 121


>gi|323141138|ref|ZP_08076041.1| ribosomal protein L7/L12 [Phascolarctobacterium sp. YIT 12067]
 gi|322414404|gb|EFY05220.1| ribosomal protein L7/L12 [Phascolarctobacterium sp. YIT 12067]
          Length = 123

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 92/124 (74%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N + I+E + S+T++E +EL K LE+++GVSA+APV+V A  AA   +AA+EKTEF+V+L
Sbjct: 2   NKDQIIEAIESMTVLELSELVKALEEKFGVSAAAPVAVAAAPAAGGEAAAAEKTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR  T LGLKEAKELV+ APK++K  +SK +A+ +K+KLE AGAT
Sbjct: 62  T--SAGASKIGVIKAVREATGLGLKEAKELVDGAPKAIKEKISKADADALKEKLEAAGAT 119

Query: 123 VELR 126
           VE++
Sbjct: 120 VEVK 123


>gi|139438553|ref|ZP_01772069.1| Hypothetical protein COLAER_01067 [Collinsella aerofaciens ATCC
           25986]
 gi|133776092|gb|EBA39912.1| Hypothetical protein COLAER_01067 [Collinsella aerofaciens ATCC
           25986]
          Length = 125

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ L  +TL+EA+EL K +E  +GVSA+AP +VVA  AA A + A EKTEF+VVL+G
Sbjct: 7   DEIIDALKEMTLLEASELVKAIEDTFGVSAAAPAAVVAAPAAGA-AEAEEKTEFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KI VIK VR +T+LGLKEAKE+VE APK++  G  K++A   K+KLE AGA V 
Sbjct: 66  FGD--NKIQVIKAVRELTNLGLKEAKEVVEGAPKAVLEGAKKEDAEAAKEKLEAAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|237747358|ref|ZP_04577838.1| LSU ribosomal protein L7/L12 [Oxalobacter formigenes HOxBLS]
 gi|229378709|gb|EEO28800.1| LSU ribosomal protein L7/L12 [Oxalobacter formigenes HOxBLS]
          Length = 126

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+E + +++++E  +L K  E+++GVSA+A         A AG AA+E +TEF VVL 
Sbjct: 6   EDILEAVGAMSVMELNDLVKAFEEKFGVSAAAMAVAGPAGGAAAGGAAAEEQTEFTVVLA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+AVIK VR IT LGLKEAK++V+SAPK +K G+SK +A E KKKLEDAGA V
Sbjct: 66  EF--GANKVAVIKAVREITGLGLKEAKDMVDSAPKPVKEGVSKADAEEAKKKLEDAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|147676644|ref|YP_001210859.1| 50S ribosomal protein L7/L12 [Pelotomaculum thermopropionicum SI]
 gi|189043003|sp|A5D5H9|RL7_PELTS RecName: Full=50S ribosomal protein L7/L12
 gi|146272741|dbj|BAF58490.1| ribosomal protein L7/L12 [Pelotomaculum thermopropionicum SI]
          Length = 129

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 91/131 (69%), Gaps = 7/131 (5%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EK 55
           MS ++ I+E +  LT++E +EL K  E+E+GVSA+APV+V A   A A  AA      E+
Sbjct: 1   MSKVQEILEAVKGLTVLELSELVKAFEEEFGVSAAAPVAVAAAPGAAAAPAAPAAAEEEQ 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+V+L    D  KK+ VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +K K
Sbjct: 61  TEFDVILTAVGD--KKVNVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKEEAAAIKAK 118

Query: 116 LEDAGATVELR 126
           L +AGATVE++
Sbjct: 119 LTEAGATVEVK 129


>gi|116512110|ref|YP_809326.1| 50S ribosomal protein L7/L12 [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125624036|ref|YP_001032519.1| 50S ribosomal protein L7/L12 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|122940147|sp|Q02YR8|RL7_LACLS RecName: Full=50S ribosomal protein L7/L12
 gi|166222178|sp|A2RKI9|RL7_LACLM RecName: Full=50S ribosomal protein L7/L12
 gi|116107764|gb|ABJ72904.1| LSU ribosomal protein L12P [Lactococcus lactis subsp. cremoris
           SK11]
 gi|124492844|emb|CAL97800.1| 50S ribosomal protein L7/L12 [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|300070807|gb|ADJ60207.1| 50S ribosomal protein L7/L12 [Lactococcus lactis subsp. cremoris
           NZ9000]
          Length = 121

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+IV +L + T++E +EL K +E+++ V+A+APV+  A        AA+ K  F+V L
Sbjct: 4   NIENIVAELENATILELSELVKAIEEKFDVTAAAPVAAAAGAG----EAAAAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KK+AVIKEVR IT LGLKEAKELV+ AP  +K GLS+ EANE+K+KLE AGA+
Sbjct: 60  TAAGD--KKVAVIKEVRGITGLGLKEAKELVDGAPTVVKEGLSESEANEIKEKLEAAGAS 117

Query: 123 VELR 126
           + L+
Sbjct: 118 ITLK 121


>gi|168021680|ref|XP_001763369.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685504|gb|EDQ71899.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 132

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 79/122 (64%), Gaps = 4/122 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA---PVSVVAPVAAEAGSAASEKTEFE 59
            ++ +V ++  LTL EA   +++L++  GVSAS+   P    A V AEA  A  EKTEF+
Sbjct: 8   KLDRLVSEVEQLTLEEARVFTEKLQERLGVSASSFASPAGTAAGVPAEAAPAVEEKTEFD 67

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +VL        +IAVIK VR +T LGLKEAK+++E  PK +K G+SK++A E +K LE A
Sbjct: 68  LVLDEVPS-SARIAVIKAVRTLTALGLKEAKDMIEGLPKKVKEGVSKEDAEEAQKALEAA 126

Query: 120 GA 121
           GA
Sbjct: 127 GA 128


>gi|224534639|ref|ZP_03675213.1| ribosomal protein L7/L12 [Borrelia spielmanii A14S]
 gi|224514108|gb|EEF84428.1| ribosomal protein L7/L12 [Borrelia spielmanii A14S]
          Length = 124

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 81/124 (65%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  L     +E  +L   +E+++GV+A         V+A + + + E+TEF+V+L
Sbjct: 4   NKEDILTWLEGAKTMEVVDLVTAIEEKFGVTAVVTAGGGGAVSAGS-TDSEEQTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA 
Sbjct: 63  MSFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAVKEGLSKSDAEELKKKLEAVGAK 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|257126635|ref|YP_003164749.1| ribosomal protein L7/L12 [Leptotrichia buccalis C-1013-b]
 gi|257050574|gb|ACV39758.1| ribosomal protein L7/L12 [Leptotrichia buccalis C-1013-b]
          Length = 123

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L +++++E  E+ + +E+ +GVSA  PV+V    AA   +AA EKTEF+V+L
Sbjct: 4   NKEQFIEDLKAMSVLELKEVVEAIEETFGVSAQ-PVAVAGGAAAGG-AAAEEKTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+AVIKEVR IT LGLKEAKELVE+  K++K G+SK+EA  +K +LE AGAT
Sbjct: 62  --VSPGGAKLAVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKEEAEAVKAQLEGAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|261401764|ref|ZP_05987889.1| ribosomal protein L7/L12 [Neisseria lactamica ATCC 23970]
 gi|313667425|ref|YP_004047709.1| 50S ribosomal protein L7/L12 [Neisseria lactamica ST-640]
 gi|59800190|sp|P0A0W8|RL7_NEILA RecName: Full=50S ribosomal protein L7/L12
 gi|59800191|sp|P0A0W9|RL7_NEISI RecName: Full=50S ribosomal protein L7/L12
 gi|11321428|gb|AAG34164.1|AF312972_1 ribosomal protein L7/L12 [Neisseria lactamica]
 gi|11321432|gb|AAG34166.1|AF312974_1 ribosomal protein L7/L12 [Neisseria sicca ATCC 29256]
 gi|269208102|gb|EEZ74557.1| ribosomal protein L7/L12 [Neisseria lactamica ATCC 23970]
 gi|309379170|emb|CBX22301.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313004887|emb|CBN86313.1| 50S ribosomal protein L7/L12 [Neisseria lactamica 020-06]
          Length = 122

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++GVSA+A     +   A   +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKFGVSAAAVAVASSAGPA---AAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 63  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|77918307|ref|YP_356122.1| 50S ribosomal protein L7/L12 [Pelobacter carbinolicus DSM 2380]
 gi|109893778|sp|Q3A6Q5|RL7_PELCD RecName: Full=50S ribosomal protein L7/L12
 gi|77544390|gb|ABA87952.1| LSU ribosomal protein L12P [Pelobacter carbinolicus DSM 2380]
          Length = 127

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 97/129 (75%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           M++I  E +V  + +++++E AEL K LE+++GVSA+APV+V A   A AG+AA+E K E
Sbjct: 1   MADITKEQVVSFIENMSVLELAELVKELEEKFGVSAAAPVAVAAAPGAAAGAAAAEEKDE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVLK   D  KKI VIK VRA T LGLKEAK++V+ AP+++K  + K EA E+KK+LE
Sbjct: 61  FDVVLKSAGD--KKINVIKVVRAATGLGLKEAKDMVDGAPQTIKEAMPKAEAEELKKQLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAAVELK 127


>gi|183221355|ref|YP_001839351.1| 50S ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189911448|ref|YP_001963003.1| 50S ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167776124|gb|ABZ94425.1| 50S Ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779777|gb|ABZ98075.1| 50S ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 127

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 94/124 (75%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE-FEVV 61
           ++++++E++ SLTL++AA+L K++E+++G+SA+APV+V A   A  G+AA+E+   F V+
Sbjct: 2   SVDALLEQIGSLTLVQAADLVKKMEEKFGISAAAPVAVAAVAGAGGGAAAAEEPATFNVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK   D  KKI VIK VR IT LGL +AK LVE+  KS+K G+SKDEA ++KKKLE  GA
Sbjct: 62  LKAHGD--KKIDVIKLVREITGLGLADAKTLVEAGGKSVKEGVSKDEAADIKKKLEGVGA 119

Query: 122 TVEL 125
            VE+
Sbjct: 120 QVEV 123


>gi|255326808|ref|ZP_05367884.1| ribosomal protein L7/L12 [Rothia mucilaginosa ATCC 25296]
 gi|255296025|gb|EET75366.1| ribosomal protein L7/L12 [Rothia mucilaginosa ATCC 25296]
          Length = 124

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +IE ++     L+L+E +E  K  E+E+ V+A+APV+        AG AA EK+EF+VVL
Sbjct: 5   SIEELIAAFKELSLVEVSEFVKAFEEEFDVTAAAPVA--VVAGGAAGEAAEEKSEFDVVL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +   D  KKIAVIKEVRA+T LGLKEAK+LV+SAPK+L  G+SK++A + K++LE AGAT
Sbjct: 63  ESAGD--KKIAVIKEVRALTSLGLKEAKDLVDSAPKALLEGVSKEDAEKAKEQLEAAGAT 120

Query: 123 VELR 126
           + L+
Sbjct: 121 ITLK 124


>gi|52694916|gb|AAU85609.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 79/123 (64%), Gaps = 5/123 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  L     IE  +L   +E+++GV+A+         +   GS  SE +TEF+V+L 
Sbjct: 6   EDILTWLEGAKTIEVVDLVTAIEEKFGVTAAIAAVGGGAAST--GSTDSEEQTEFDVILM 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA V
Sbjct: 64  SFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKV 121

Query: 124 ELR 126
           E++
Sbjct: 122 EVK 124


>gi|238790615|ref|ZP_04634380.1| 50S ribosomal protein L7/L12 [Yersinia frederiksenii ATCC 33641]
 gi|238721284|gb|EEQ12959.1| 50S ribosomal protein L7/L12 [Yersinia frederiksenii ATCC 33641]
          Length = 122

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/128 (50%), Positives = 89/128 (69%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     AA E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAVAA----EAAEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F D   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+
Sbjct: 57  NVVLASFGD--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEE 114

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 115 AGASVEIK 122


>gi|238785549|ref|ZP_04629530.1| 50S ribosomal protein L7/L12 [Yersinia bercovieri ATCC 43970]
 gi|238794960|ref|ZP_04638557.1| 50S ribosomal protein L7/L12 [Yersinia intermedia ATCC 29909]
 gi|238798662|ref|ZP_04642136.1| 50S ribosomal protein L7/L12 [Yersinia mollaretii ATCC 43969]
 gi|238713534|gb|EEQ05565.1| 50S ribosomal protein L7/L12 [Yersinia bercovieri ATCC 43970]
 gi|238717480|gb|EEQ09322.1| 50S ribosomal protein L7/L12 [Yersinia mollaretii ATCC 43969]
 gi|238725718|gb|EEQ17275.1| 50S ribosomal protein L7/L12 [Yersinia intermedia ATCC 29909]
 gi|318607539|emb|CBY29037.1| LSU ribosomal protein L7/L12 (P1/P2) [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|330863590|emb|CBX73702.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica W22703]
          Length = 122

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 88/128 (68%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     A  E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAA----EAVEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F D   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+
Sbjct: 57  NVVLASFGD--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEE 114

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 115 AGASVEIK 122


>gi|256371207|ref|YP_003109031.1| ribosomal protein L7/L12 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007791|gb|ACU53358.1| ribosomal protein L7/L12 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 128

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 94/130 (72%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KT 56
           M++I+ I++++S LT++E +EL K  E+ +GV+A+APV+V A   A  G  A+     + 
Sbjct: 1   MADIQGILDQISELTVVELSELVKAFEERFGVTAAAPVAVAAVAGAAGGGEAAPAEEEQQ 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VVL    D  KKI VIKEVRA+T+LGLKEAK+LV++APK +   +SK++A + K +L
Sbjct: 61  EFDVVLVSAGD--KKIQVIKEVRALTNLGLKEAKDLVDAAPKPVLEKVSKEDAEKAKAQL 118

Query: 117 EDAGATVELR 126
           E AGATVEL+
Sbjct: 119 EGAGATVELK 128


>gi|119511568|ref|ZP_01630676.1| 50S ribosomal protein L7/L12 [Nodularia spumigena CCY9414]
 gi|119463803|gb|EAW44732.1| 50S ribosomal protein L7/L12 [Nodularia spumigena CCY9414]
          Length = 129

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 92/128 (71%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTEF 58
           +  + I+E+L +L+L+EA+EL K++E+ +GVSA+AP   +  +A  A +A     EKTEF
Sbjct: 3   ATTDQILEQLKTLSLLEASELVKQIEEAFGVSAAAPAGGMMMMAPGAAAAAEPVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L       KKIAV+K VR +T LGLKEAK+LVE+APK++K G++KD A + KK++E+
Sbjct: 63  DVILDSVP-ADKKIAVLKIVRELTGLGLKEAKDLVEAAPKAVKEGIAKDAAEDAKKRIEE 121

Query: 119 AGATVELR 126
           AG  V ++
Sbjct: 122 AGGKVTVK 129


>gi|330720886|gb|EGG99073.1| LSU ribosomal protein L7/L12 (P1/P2) [gamma proteobacterium
           IMCC2047]
          Length = 125

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 90/122 (73%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++  ++ ++++E  EL + +E+++GVSA+A V+     A +AG+AA  +TEF+VVL  
Sbjct: 6   DDLLNAIAEMSVMEVVELIEAMEEKFGVSAAAAVAAAPAAAGDAGAAAEAQTEFDVVLAS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+  IK VRAIT LGLKEAKE+V+ AP ++K G+SK+EA E+K +LE+AGATVE
Sbjct: 66  AGD--KKVNAIKAVRAITGLGLKEAKEMVDGAPSTVKEGVSKEEAEEIKGQLEEAGATVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|302871677|ref|YP_003840313.1| ribosomal protein L7/L12 [Caldicellulosiruptor obsidiansis OB47]
 gi|312135323|ref|YP_004002661.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor owensensis OL]
 gi|312793741|ref|YP_004026664.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312876860|ref|ZP_07736837.1| ribosomal protein L7/L12 [Caldicellulosiruptor lactoaceticus 6A]
 gi|302574536|gb|ADL42327.1| ribosomal protein L7/L12 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775374|gb|ADQ04861.1| ribosomal protein L7/L12 [Caldicellulosiruptor owensensis OL]
 gi|311796375|gb|EFR12727.1| ribosomal protein L7/L12 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180881|gb|ADQ41051.1| ribosomal protein L7/L12 [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 129

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 92/126 (73%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEV 60
           ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A +AA    EKTEF V
Sbjct: 6   VQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQAAAPAAEEKTEFNV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D    KI VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA ++KKKLE+ G
Sbjct: 66  ILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDGAPKPIKENVSKEEAEQIKKKLEEVG 123

Query: 121 ATVELR 126
           A VEL+
Sbjct: 124 AKVELK 129


>gi|51244968|ref|YP_064852.1| 50S ribosomal protein L7 /L12 [Desulfotalea psychrophila LSv54]
 gi|81642550|sp|Q6AP79|RL7_DESPS RecName: Full=50S ribosomal protein L7/L12
 gi|50876005|emb|CAG35845.1| probable 50S ribosomal protein L7 /L12 [Desulfotalea psychrophila
           LSv54]
          Length = 123

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 87/122 (71%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ ++ ++++E +EL    E+++GVSA+APV+V A   A    A  EKTEF+V+L  
Sbjct: 6   EDVIDFIAGMSVLELSELIGEFEEKFGVSAAAPVAVAAAGVAA--EAVEEKTEFDVILA- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIKEVRAIT LGLKEAK LVESAP +LK G+SKDEA E+K KLE  GAT E
Sbjct: 63  -SAGSEKIKVIKEVRAITGLGLKEAKSLVESAPAALKEGVSKDEAAELKAKLEAVGATAE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|332159911|ref|YP_004296488.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664141|gb|ADZ40785.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 121

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (67%), Gaps = 9/128 (7%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A        A  E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAA-----EAVEEQTEF 55

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F D   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+
Sbjct: 56  NVVLASFGD--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEE 113

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 114 AGASVEIK 121


>gi|317014587|gb|ADU82023.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Gambia94/24]
          Length = 125

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGATAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|303282951|ref|XP_003060767.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458238|gb|EEH55536.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 129

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 83/127 (65%), Gaps = 4/127 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---VVAPVAAEAGSAASEKTEF 58
           +  + I+EK+  LTL+EA+EL K++E+ +GV ASAP     + A  A  A  AA EKTEF
Sbjct: 3   ATTDDIIEKMKGLTLLEASELVKQIEEVFGVDASAPAGGMVMAAGPAGGAAEAAEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           ++V+K  D   K+IA+IK VR++T LGLKEAK+ V + P S+  G SK E  E  K L +
Sbjct: 63  DLVIKDVD-ASKRIAIIKVVRSLTSLGLKEAKDAVTNLPFSILEGKSKAECEEAMKTLTE 121

Query: 119 AGATVEL 125
            GAT E+
Sbjct: 122 GGATCEI 128


>gi|217967753|ref|YP_002353259.1| ribosomal protein L7/L12 [Dictyoglomus turgidum DSM 6724]
 gi|226733677|sp|B8E0K0|RL7_DICTD RecName: Full=50S ribosomal protein L7/L12
 gi|217336852|gb|ACK42645.1| ribosomal protein L7/L12 [Dictyoglomus turgidum DSM 6724]
          Length = 125

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 79/126 (62%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS--APVSVVAPVAAEAGSAASEKTEFEV 60
           N E I++ +  + +IE  EL K LE+E+GVSA+            A A +   EKT F+V
Sbjct: 2   NKEEIIQAIKEMKVIELVELVKALEEEFGVSAAMPVAAVGAPVAGAAAAAPVEEKTTFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D    KI V+K VR IT LGLKEAK+LV+S PK +K G+SK EA E+K KLE  G
Sbjct: 62  ILK--DAGANKIKVLKVVREITGLGLKEAKDLVDSTPKPIKEGVSKQEAEEIKAKLEAEG 119

Query: 121 ATVELR 126
           A VE++
Sbjct: 120 AVVEIK 125


>gi|78221838|ref|YP_383585.1| 50S ribosomal protein L7/L12 [Geobacter metallireducens GS-15]
 gi|109893765|sp|Q39Y14|RL7_GEOMG RecName: Full=50S ribosomal protein L7/L12
 gi|78193093|gb|ABB30860.1| LSU ribosomal protein L12P [Geobacter metallireducens GS-15]
          Length = 127

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 92/121 (76%), Gaps = 3/121 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLKGF 65
           +V  + ++T++E +EL K LE+++GVSA+APV+V A  A  A + A+ EKTEF+++LK  
Sbjct: 9   VVSFIENMTVLELSELVKELEEKFGVSAAAPVAVAAAAAPAAAAEAAEEKTEFDIILK-- 66

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                KI VIK VRA+T LGLKEAK+LV+ APKS+KTG+SK+EA + KK+L ++GA VE+
Sbjct: 67  SAGANKIGVIKVVRALTGLGLKEAKDLVDGAPKSVKTGVSKEEAEDAKKQLVESGAEVEI 126

Query: 126 R 126
           +
Sbjct: 127 K 127


>gi|319787933|ref|YP_004147408.1| ribosomal protein L7/L12 [Pseudoxanthomonas suwonensis 11-1]
 gi|317466445|gb|ADV28177.1| ribosomal protein L7/L12 [Pseudoxanthomonas suwonensis 11-1]
          Length = 123

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 85/126 (67%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E IVE ++  TL+E  EL K +E+++    SA   V    AA   +A  E+TEF V
Sbjct: 3   LSN-EQIVEAIAGKTLMEVMELVKAIEEKF--GVSAAAPVAVAAAAGPAAAVEEQTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK   +  KK+ VIK VRAIT LGLKEAK+LVE APK +K G+SK++A + KK LE AG
Sbjct: 60  VLKAAGE--KKVEVIKAVRAITGLGLKEAKDLVEGAPKDVKEGVSKEDAEKFKKDLEAAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|289432782|ref|YP_003462655.1| ribosomal protein L7/L12 [Dehalococcoides sp. GT]
 gi|288946502|gb|ADC74199.1| ribosomal protein L7/L12 [Dehalococcoides sp. GT]
          Length = 123

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (70%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ ++  +  +T+IE +EL K LEKE+GVSA+  V+  A   A A +A  EKTEF V+LK
Sbjct: 3   IDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAAPAAGGASAAAAVEEKTEFNVILK 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR +T LGLKEAK++VE+APK++K  +SK+EA+  KK LE AGATV
Sbjct: 63  --DVGANKINVIKAVRELTSLGLKEAKDMVEAAPKAVKENVSKEEADAAKKALEAAGATV 120

Query: 124 ELR 126
           E++
Sbjct: 121 EIK 123


>gi|268608118|ref|ZP_06141846.1| 50S ribosomal protein L12P [Ruminococcus flavefaciens FD-1]
          Length = 124

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 83/123 (67%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I   +E + +L+++E +EL   +++E+GV+A             AG  A+ KTEF+V+L 
Sbjct: 6   ITKFIEDIKTLSVLELSELVDAIQEEFGVTAVVAAG--PAAGGAAGGDAAAKTEFDVILA 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D K  +AVIK  + +  LGLKEAKE+VESAPK++K G+S+ EANE+K K E+AGAT+
Sbjct: 64  SFGDAK--MAVIKVAKEVLGLGLKEAKEVVESAPKAIKEGVSEAEANELKAKFEEAGATI 121

Query: 124 ELR 126
           E++
Sbjct: 122 EIK 124


>gi|147669523|ref|YP_001214341.1| 50S ribosomal protein L7/L12 [Dehalococcoides sp. BAV1]
 gi|189042992|sp|A5FQQ9|RL7_DEHSB RecName: Full=50S ribosomal protein L7/L12
 gi|146270471|gb|ABQ17463.1| LSU ribosomal protein L12P [Dehalococcoides sp. BAV1]
          Length = 123

 Score = 87.4 bits (215), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 87/123 (70%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ ++  +  +T+IE +EL K LEKE+GVSA+  V+  A   A A +A  EKTEF V+LK
Sbjct: 3   IDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAAPAAGGAAAAAAVEEKTEFNVILK 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR +T LGLKEAK++VE+APK++K  +SK+EA+  KK LE AGATV
Sbjct: 63  --DVGANKINVIKAVRELTSLGLKEAKDMVEAAPKAVKENVSKEEADAAKKALEAAGATV 120

Query: 124 ELR 126
           E++
Sbjct: 121 EIK 123


>gi|291531615|emb|CBK97200.1| LSU ribosomal protein L12P [Eubacterium siraeum 70/3]
          Length = 124

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I +++E++  L+++E  EL K LE+E+    SA    VA  AA   +AA EKTEF+VVL
Sbjct: 5   KILAMIEEVKGLSVLELNELVKALEEEF--GVSAAAVAVAGPAAGGAAAAEEKTEFDVVL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F D K  +AVIK V+ +  LGLKEAKELVESAPK++K G SK EA E+K KLE+AGA 
Sbjct: 63  ASFGDAK--MAVIKAVKDVCGLGLKEAKELVESAPKAIKEGASKAEAEEIKAKLEEAGAK 120

Query: 123 VELR 126
           +EL+
Sbjct: 121 IELK 124


>gi|228989309|ref|ZP_04149300.1| 50S ribosomal protein L7/L12 [Bacillus pseudomycoides DSM 12442]
 gi|228770387|gb|EEM18960.1| 50S ribosomal protein L7/L12 [Bacillus pseudomycoides DSM 12442]
          Length = 119

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K +E+E+GV+A+APV+VV         AA+EKTEF+VVL+ 
Sbjct: 4   EQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVVGGAG----EAAAEKTEFDVVLES 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR IT LGLKEAKELV++ PK++K G SK+EA EMK KLE+ GA VE
Sbjct: 60  --AGAQKIKVIKVVREITGLGLKEAKELVDNTPKAIKEGASKEEAEEMKAKLEEVGAAVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|291541519|emb|CBL14629.1| LSU ribosomal protein L12P [Ruminococcus bromii L2-63]
          Length = 125

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I +I+E+L  LT++E +EL   +E E+GVSA+A V+V  P A    +AA+E+TEF+VVLK
Sbjct: 6   ITAIIEELKGLTVLELSELVHAVEDEFGVSAAAAVAVAGPAADGG-AAAAEQTEFDVVLK 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KIAVIK VR +T LGLKEAK LV+ APK+LK G+SK++A  +K KLE+AGA V
Sbjct: 65  AAGG--NKIAVIKVVREVTGLGLKEAKALVDGAPKALKEGVSKEDAEAIKTKLEEAGAEV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|220930956|ref|YP_002507864.1| ribosomal protein L7/L12 [Halothermothrix orenii H 168]
 gi|254806377|sp|B8D0B5|RL7_HALOH RecName: Full=50S ribosomal protein L7/L12
 gi|219992266|gb|ACL68869.1| ribosomal protein L7/L12 [Halothermothrix orenii H 168]
          Length = 123

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 90/122 (73%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E AEL + LE+++GVSA+APV++ A   A+ G    EKTEF+V L  
Sbjct: 4   EEIIEAIENMTVLELAELVEELEEKFGVSAAAPVAMAAVPGAQGGEQQEEKTEFDVHLA- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   KKI VIK VR +T LGLK+AK LV+ AP ++K G+SK+EA E+K KLEDAGATVE
Sbjct: 63  -EIGGKKINVIKVVREVTGLGLKDAKALVDDAPTNVKEGVSKEEAEEIKSKLEDAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|157368525|ref|YP_001476514.1| 50S ribosomal protein L7/L12 [Serratia proteamaculans 568]
 gi|166990988|sp|A8G8E6|RL7_SERP5 RecName: Full=50S ribosomal protein L7/L12
 gi|157320289|gb|ABV39386.1| ribosomal protein L7/L12 [Serratia proteamaculans 568]
          Length = 121

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     A  EKTEF+VVLKG
Sbjct: 6   DQIIEGVAALSVMEIVELIAAMEEKFGVSAAAVAAGPAAAA----EAVEEKTEFDVVLKG 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKKALEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|289548399|ref|YP_003473387.1| ribosomal protein L7/L12 [Thermocrinis albus DSM 14484]
 gi|289182016|gb|ADC89260.1| ribosomal protein L7/L12 [Thermocrinis albus DSM 14484]
          Length = 130

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 92/128 (71%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTEF 58
            I+ IVE + ++TL+E AEL K+LE+++GVSASA V+    VAA A +A +    EKTEF
Sbjct: 5   TIDEIVEAIGNMTLLEVAELVKKLEEKFGVSASAMVAAAPAVAAGAPAAGAPAAEEKTEF 64

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       KI VIK VR IT LGLKEAK+LVE APK +K G+SK+EA ++ +KL +
Sbjct: 65  DVILK--SAGANKINVIKVVREITGLGLKEAKDLVEGAPKPVKEGVSKEEAEKIAQKLRE 122

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 123 AGAEVEIK 130


>gi|260890612|ref|ZP_05901875.1| ribosomal protein L7/L12 [Leptotrichia hofstadii F0254]
 gi|260859657|gb|EEX74157.1| ribosomal protein L7/L12 [Leptotrichia hofstadii F0254]
          Length = 123

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L +++++E  E+ + +E+ +GVSA  PV+V    AA   +AA EKTEF+V+L
Sbjct: 4   NKEQFIEDLKAMSVLELKEVVEAIEETFGVSAQ-PVAVAGGAAAGG-AAAEEKTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+AVIKEVR IT LGLKEAKELVE+  K++K G++K+EA  +K +LE AGAT
Sbjct: 62  --VSAGAAKLAVIKEVRGITGLGLKEAKELVEAGGKAVKEGVAKEEAEALKAQLEGAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|89053058|ref|YP_508509.1| 50S ribosomal protein L7/L12 [Jannaschia sp. CCS1]
 gi|109893770|sp|Q28UX8|RL7_JANSC RecName: Full=50S ribosomal protein L7/L12
 gi|88862607|gb|ABD53484.1| LSU ribosomal protein L12P [Jannaschia sp. CCS1]
          Length = 124

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+ A  A  AG AA E+TEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGAGGAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEEIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|33152868|ref|NP_874221.1| 50S ribosomal protein L7/L12 [Haemophilus ducreyi 35000HP]
 gi|71153690|sp|Q7VKL5|RL7_HAEDU RecName: Full=50S ribosomal protein L7/L12
 gi|33149093|gb|AAP96610.1| 50S ribosomal protein L7/L12 [Haemophilus ducreyi 35000HP]
          Length = 120

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 84/122 (68%), Gaps = 7/122 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A V+          +AA EKTEF+VVL  
Sbjct: 6   EQIIEAIASKSVSEIVELITAMEEKFGVSAAAAVAAAPAA-----AAAEEKTEFDVVLA- 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LEDAGA VE
Sbjct: 60  -NAGANKVAVIKAVRGATGLGLKEAKDLVESAPATLKEGISKPEAEALKKELEDAGAQVE 118

Query: 125 LR 126
           ++
Sbjct: 119 IK 120


>gi|293375380|ref|ZP_06621661.1| ribosomal protein L7/L12 [Turicibacter sanguinis PC909]
 gi|325844409|ref|ZP_08168136.1| ribosomal protein L7/L12 [Turicibacter sp. HGF1]
 gi|292645933|gb|EFF63962.1| ribosomal protein L7/L12 [Turicibacter sanguinis PC909]
 gi|325489083|gb|EGC91467.1| ribosomal protein L7/L12 [Turicibacter sp. HGF1]
          Length = 121

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 80/120 (66%), Gaps = 7/120 (5%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           ++E +  ++++E  EL K +E+E+GV+A+APV++V      AG      +E +V+L   +
Sbjct: 9   MIEAIKEMSVLELNELVKAIEEEFGVTAAAPVAMVGGAVEAAGP-----SEVDVILT--N 61

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
              KKI VIK VR IT LGLKEAKELV+  P  +K  +S +EA E+K KLE+AGA VE++
Sbjct: 62  AGAKKIGVIKVVREITGLGLKEAKELVDGTPAKIKEKVSPEEAEELKAKLEEAGAVVEVK 121


>gi|326799810|ref|YP_004317629.1| 50S ribosomal protein L7/L12 [Sphingobacterium sp. 21]
 gi|326550574|gb|ADZ78959.1| 50S ribosomal protein L7/L12 [Sphingobacterium sp. 21]
          Length = 125

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  AA   + A+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAGPAAGGDAPAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +T LGLKEAK+LV+ APK LK G++KDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLTGLGLKEAKDLVDGAPKELKAGVAKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|307128978|ref|YP_003880994.1| 50S ribosomal subunit protein L7/L12 [Dickeya dadantii 3937]
 gi|306526507|gb|ADM96437.1| 50S ribosomal subunit protein L7/L12 [Dickeya dadantii 3937]
          Length = 122

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 88/122 (72%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V +   AEA   A EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVASAGPAEA---AEEKTEFDVILKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK  +SKD+A  +KK LE+AGA VE
Sbjct: 63  VG--ANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEAVSKDDAEALKKSLEEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|283457504|ref|YP_003362086.1| 50S ribosomal protein L7/L12 [Rothia mucilaginosa DY-18]
 gi|283133501|dbj|BAI64266.1| ribosomal protein L7/L12 [Rothia mucilaginosa DY-18]
          Length = 124

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 90/124 (72%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +IE ++     L+L+E +E  K  E+E+ V+A+APV+        AG AA EK+EF+V+L
Sbjct: 5   SIEELIAAFKELSLVEVSEFVKAFEEEFDVTAAAPVA--VVAGGAAGEAAEEKSEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +   D  KKIAVIKEVRA+T LGLKEAK+LV+SAPK+L  G+SK++A + K++LE AGAT
Sbjct: 63  ESAGD--KKIAVIKEVRALTSLGLKEAKDLVDSAPKALLEGVSKEDAEKAKEQLEAAGAT 120

Query: 123 VELR 126
           + L+
Sbjct: 121 ITLK 124


>gi|117924147|ref|YP_864764.1| 50S ribosomal protein L12P [Magnetococcus sp. MC-1]
 gi|166222180|sp|A0L5W5|RL7_MAGSM RecName: Full=50S ribosomal protein L7/L12
 gi|117607903|gb|ABK43358.1| LSU ribosomal protein L12P [Magnetococcus sp. MC-1]
          Length = 123

 Score = 87.0 bits (214), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++  + S+T++E +EL K LE+++GVSA+APV+V A V          KTEF+V+L  
Sbjct: 4   EEMISAIESMTVLELSELVKALEEKFGVSAAAPVAVAAAVGGGEAVVEEAKTEFDVILAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VR +T LGLKEAK+LVE APK++K  +SKDEA+++K KLE+AGA VE
Sbjct: 64  AGD--KKIHVIKAVREMTGLGLKEAKDLVEGAPKAVKEAVSKDEADKLKAKLEEAGAVVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|123440674|ref|YP_001004667.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166222227|sp|A1JIH9|RL7_YERE8 RecName: Full=50S ribosomal protein L7/L12
 gi|122087635|emb|CAL10417.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 122

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 87/128 (67%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     A  E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAA----EAVEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F D   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+
Sbjct: 57  NVVLASFGD--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEE 114

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 115 AGAAVEIK 122


>gi|148269603|ref|YP_001244063.1| 50S ribosomal protein L7/L12 [Thermotoga petrophila RKU-1]
 gi|170288279|ref|YP_001738517.1| ribosomal protein L7/L12 [Thermotoga sp. RQ2]
 gi|281411679|ref|YP_003345758.1| ribosomal protein L7/L12 [Thermotoga naphthophila RKU-10]
 gi|166222223|sp|A5IJW4|RL7_THEP1 RecName: Full=50S ribosomal protein L7/L12
 gi|226734488|sp|B1L936|RL7_THESQ RecName: Full=50S ribosomal protein L7/L12
 gi|147735147|gb|ABQ46487.1| LSU ribosomal protein L12P [Thermotoga petrophila RKU-1]
 gi|170175782|gb|ACB08834.1| ribosomal protein L7/L12 [Thermotoga sp. RQ2]
 gi|281372782|gb|ADA66344.1| ribosomal protein L7/L12 [Thermotoga naphthophila RKU-10]
          Length = 128

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 89/129 (68%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS--APVSVVAPVAAEAGSAASEKTEFEV 60
            I+ I+E +  LT+ E AEL K+LE ++GV+A+    V+      A AG+A  EKTEF+V
Sbjct: 2   TIDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESA--PKS-LKTGLSKDEANEMKKKLE 117
           VLK F   + KI VIK VR IT LGLKEAK+LVE A  P + +K+G+ K EA ++KKKLE
Sbjct: 62  VLKSF--GQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAIIKSGVPKQEAEDIKKKLE 119

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 120 EAGAEVELK 128


>gi|262043781|ref|ZP_06016883.1| ribosomal protein L7/L12 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259038868|gb|EEW40037.1| ribosomal protein L7/L12 [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 121

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+E+GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEEFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|109948062|ref|YP_665290.1| 50S ribosomal protein L7/L12 [Helicobacter acinonychis str. Sheeba]
 gi|123362513|sp|Q17VN5|RL7_HELAH RecName: Full=50S ribosomal protein L7/L12
 gi|109715283|emb|CAK00291.1| 50S ribosomal protein L7/L12 [Helicobacter acinonychis str. Sheeba]
          Length = 125

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKT+F V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAVAESEEKTDFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|169830425|ref|YP_001716407.1| ribosomal protein L7/L12 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226733674|sp|B1I1M6|RL7_DESAP RecName: Full=50S ribosomal protein L7/L12
 gi|169637269|gb|ACA58775.1| ribosomal protein L7/L12 [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 126

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 65/128 (50%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           MS +  I+E +  LT++E AEL K +E+E+GVSA+APV+ VA V A A     E  +TEF
Sbjct: 1   MSKVNEIIEIVKGLTVLELAELVKAMEEEFGVSAAAPVAAVAAVPAAAAPVVEEEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK   +  +KI VIK VR IT LGLKEAKELV+ AP  +K  ++K+EA  +KKKLE+
Sbjct: 61  DVILKNVGN--EKIKVIKVVREITGLGLKEAKELVDGAPNPVKEKVNKEEAETIKKKLEE 118

Query: 119 AGATVELR 126
            GA +E++
Sbjct: 119 VGAGIEIK 126


>gi|162448679|ref|YP_001611046.1| 50S ribosomal protein L7/L12 [Sorangium cellulosum 'So ce 56']
 gi|259491656|sp|A9GRA8|RL7_SORC5 RecName: Full=50S ribosomal protein L7/L12
 gi|161159261|emb|CAN90566.1| 50S ribosomal protein L7/L12 [Sorangium cellulosum 'So ce 56']
          Length = 128

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (67%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E +V+ LS+L +I+ AEL K LE +WGV A+     VA   A A  A     +TEF+VVL
Sbjct: 7   EQVVDYLSNLPVIQIAELIKDLENKWGVKAAPAAVAVAAGPAAAAPAEKAPEQTEFDVVL 66

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK +R IT LGLKEAK+LVE+APK++K  +SK +A EMKKKL +AGAT
Sbjct: 67  A--NAGSNKIGVIKAIREITGLGLKEAKDLVEAAPKTVKEQVSKADAEEMKKKLVEAGAT 124

Query: 123 VELR 126
           VEL+
Sbjct: 125 VELK 128


>gi|259415959|ref|ZP_05739879.1| ribosomal protein L7/L12 [Silicibacter sp. TrichCH4B]
 gi|259347398|gb|EEW59175.1| ribosomal protein L7/L12 [Silicibacter sp. TrichCH4B]
          Length = 124

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+  +A  +V+ A  A    +A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGEAAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|189424402|ref|YP_001951579.1| 50S ribosomal protein L7/L12 [Geobacter lovleyi SZ]
 gi|226733692|sp|B3E7S7|RL7_GEOLS RecName: Full=50S ribosomal protein L7/L12
 gi|189420661|gb|ACD95059.1| ribosomal protein L7/L12 [Geobacter lovleyi SZ]
          Length = 126

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 86/120 (71%), Gaps = 2/120 (1%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           +V  +  +T++E AEL K LE+++GVSA+APV+V A   A A  AA EKTEF+V+LK   
Sbjct: 9   VVAFIEKMTVLELAELVKELEEKFGVSAAAPVAVAAAAPAAAAEAAEEKTEFDVILK--S 66

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
               KI VIK VR +T LGLKEAK+LV+ AP  +KTG+SK EA E +K+L +AGA VE++
Sbjct: 67  AGANKINVIKVVRTLTSLGLKEAKDLVDGAPSPVKTGISKAEAEEAQKQLVEAGAEVEIK 126


>gi|206890982|ref|YP_002249157.1| ribosomal protein L7/L12 [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742920|gb|ACI21977.1| ribosomal protein L7/L12 [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 128

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (69%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E + +   +LT++E ++  K  E+ +GV+A+APV+V A   A A  AA    EKT F+V+
Sbjct: 6   EEVFQFFDNLTILELSQFIKEFEERYGVTAAAPVAVAAAPGAPAAQAAPAAEEKTSFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK   D  KKI VIK VR +T LGLKEAK+LV+ APK +KTG+SK+EA+ +K KLE  GA
Sbjct: 66  LKAAGD--KKIQVIKVVRELTGLGLKEAKDLVDGAPKPVKTGVSKEEADTIKSKLEAEGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIQ 128


>gi|17232795|ref|NP_489343.1| 50S ribosomal protein L7/L12 [Nostoc sp. PCC 7120]
 gi|20978564|sp|Q8YLJ5|RL7_ANASP RecName: Full=50S ribosomal protein L7/L12
 gi|17134442|dbj|BAB77002.1| 50S ribosomal protein L12 [Nostoc sp. PCC 7120]
          Length = 130

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 93/126 (73%), Gaps = 5/126 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEFEV 60
           + I+++L SL+L+EAAEL K++E+ +GVSA+AP   +  +AA   +AA+E    +TEF+V
Sbjct: 6   DQILDQLKSLSLLEAAELVKQIEEAFGVSAAAPAGGMMMMAAPGAAAAAEPVEEQTEFDV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+      KKIAV+K VR IT LGLKEAK+LVE+APK++K  ++KD A + KK++E+AG
Sbjct: 66  VLESVP-ADKKIAVLKIVREITGLGLKEAKDLVEAAPKAVKEAIAKDAAEDAKKRIEEAG 124

Query: 121 ATVELR 126
             V ++
Sbjct: 125 GKVTVK 130


>gi|159029121|emb|CAO87480.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gi|190192153|dbj|BAG48288.1| 50S ribosomal protein L12 [Microcystis aeruginosa NIES-843]
          Length = 130

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/131 (51%), Positives = 91/131 (69%), Gaps = 6/131 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEK 55
           MS +  I+EKL +LTL+EAAEL K +E+ +GVSA+AP   +         A A  A  E+
Sbjct: 1   MSAVAEILEKLKTLTLLEAAELVKGIEETFGVSAAAPTGGIIMAAPGAAPAAAAEAVEEQ 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF VVL+      KKIA++K VR +T LGLKEAK+LVE+APK++K G +KD+A  +KKK
Sbjct: 61  TEFNVVLEEVP-ADKKIAILKVVRELTGLGLKEAKDLVEAAPKAVKEGTNKDDAAAIKKK 119

Query: 116 LEDAGATVELR 126
           LEDAGA V ++
Sbjct: 120 LEDAGAKVSVK 130


>gi|89071238|ref|ZP_01158417.1| ribosomal protein L7/L12 [Oceanicola granulosus HTCC2516]
 gi|89043224|gb|EAR49454.1| ribosomal protein L7/L12 [Oceanicola granulosus HTCC2516]
          Length = 126

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 85/128 (66%), Gaps = 6/128 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTE 57
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+          G+A  EKTE
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGDAGGAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVLK  +   +KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE
Sbjct: 61  FDVVLK--NAGAQKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGIDKAEAEEIKSKLE 117

Query: 118 DAGATVEL 125
            AGA VEL
Sbjct: 118 AAGAEVEL 125


>gi|146278577|ref|YP_001168736.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides ATCC 17025]
 gi|166222201|sp|A4WVL7|RL7_RHOS5 RecName: Full=50S ribosomal protein L7/L12
 gi|145556818|gb|ABP71431.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides ATCC 17025]
          Length = 124

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 66/127 (51%), Positives = 85/127 (66%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV-VAPVAAEAGSAASEKTEFE 59
           M+++  + E +  LTL+EA EL   L+ ++G+  +A  +V VA  AA A  A  EKTEF+
Sbjct: 1   MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMVAGPAAAAAPAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K   SK +A  MKKKLE+A
Sbjct: 61  VVLT--DAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAASKADAEAMKKKLEEA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|297172928|gb|ADI23889.1| hypothetical protein [uncultured gamma proteobacterium
           HF4000_48J03]
          Length = 133

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 63/132 (47%), Positives = 89/132 (67%), Gaps = 9/132 (6%)

Query: 2   SNI---ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA----EAGSAASE 54
           SNI   E ++E +S +++++  EL   +E+++GVSASAP  V A   A    E      E
Sbjct: 4   SNIASREELLEAISKMSVMDLVELISEMEEKFGVSASAPAPVAAAATAGDGAEPSDKEDE 63

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+++LK F D   KIAVIK VRAIT LGLK+AK++VE AP +++  +SK E  EM K
Sbjct: 64  QTEFDLILKSFGD--NKIAVIKAVRAITSLGLKDAKDMVEGAPITIQEAVSKKEVEEMTK 121

Query: 115 KLEDAGATVELR 126
           +LED+GA VEL+
Sbjct: 122 QLEDSGAVVELK 133


>gi|254465953|ref|ZP_05079364.1| ribosomal protein L7/L12 [Rhodobacterales bacterium Y4I]
 gi|206686861|gb|EDZ47343.1| ribosomal protein L7/L12 [Rhodobacterales bacterium Y4I]
          Length = 124

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 65/126 (51%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+  A+    V+A      G+A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAAGDAGGAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+SKDEA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVSKDEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|152990016|ref|YP_001355738.1| 50S ribosomal protein L7/L12 [Nitratiruptor sp. SB155-2]
 gi|166222185|sp|A6Q1M2|RL7_NITSB RecName: Full=50S ribosomal protein L7/L12
 gi|151421877|dbj|BAF69381.1| 50S ribosomal protein L7/L12 [Nitratiruptor sp. SB155-2]
          Length = 127

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 86/124 (69%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSA--SAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           E ++E +S+L+++E +EL K  E+++GVSA  +     VA   AE G+AA EKTEF+VVL
Sbjct: 6   EDVIEYISNLSVLELSELVKEFEEKFGVSAQPTVVAGAVAAGGAEGGAAAEEKTEFDVVL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D   KKI  IK +R +T LGLKEAKE  E+ P  +K G+SK+EA E+KK+ E+AGA 
Sbjct: 66  T--DAGPKKINTIKVIRQVTGLGLKEAKEAAENTPTVIKEGVSKEEAEELKKQFEEAGAK 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEIK 127


>gi|77024207|gb|ABA55574.1| chloroplast 50S ribosomal protein L7 [Pavlova lutheri]
          Length = 208

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           + I+E+L +LTL+EAA+L K +E+ +GV ASA   ++      A  AA   E+TEF+V+L
Sbjct: 40  DKILEELKTLTLMEAADLVKGIEEAFGVDASAGGGMMMAAPVAAAPAAVVEEQTEFDVIL 99

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F    KKIAV+K VR +T LGLKEAK+LVE+APKSLK G+SK EA   ++     G  
Sbjct: 100 DSFP-ADKKIAVLKVVRTLTGLGLKEAKDLVEAAPKSLKAGISKAEAGRDRQVDRGGGRQ 158

Query: 123 VE 124
           V 
Sbjct: 159 VH 160


>gi|77462250|ref|YP_351754.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides 2.4.1]
 gi|126461112|ref|YP_001042226.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides ATCC 17029]
 gi|126461126|ref|YP_001042240.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638104|ref|YP_002524366.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides KD131]
 gi|109893795|sp|Q3J5T1|RL7_RHOS4 RecName: Full=50S ribosomal protein L7/L12
 gi|254806391|sp|B9KL82|RL7_RHOSK RecName: Full=50S ribosomal protein L7/L12
 gi|77386668|gb|ABA77853.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides 2.4.1]
 gi|126102776|gb|ABN75454.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides ATCC 17029]
 gi|126102790|gb|ABN75468.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158885|gb|ACL99864.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides KD131]
          Length = 125

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 84/128 (65%), Gaps = 5/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M+++  + E +  LTL+EA EL   L+ ++G+  +A   V +  P A  A  A  EKTEF
Sbjct: 1   MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGPAAGAAAPAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K  ++K +A  MKKKLE+
Sbjct: 61  DVVLT--DAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAVAKADAEAMKKKLEE 117

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 118 AGAKVELK 125


>gi|325972669|ref|YP_004248860.1| 50S ribosomal protein L7/L12 [Spirochaeta sp. Buddy]
 gi|324027907|gb|ADY14666.1| 50S ribosomal protein L7/L12 [Spirochaeta sp. Buddy]
          Length = 127

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 87/126 (69%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+  E I+E ++ ++++E A+L K +E ++GV A+A      PVA  A +A  E TEF V
Sbjct: 1   MATKEEILESIAKMSVMEVADLIKMMEDKFGVKAAAAAVAAGPVAEAA-AAVEEPTEFNV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D P KKIA IKEVRAIT LGLKEAK+LVE+  K +K  +SK +A  +K+KLE AG
Sbjct: 60  ILKACD-PTKKIAAIKEVRAITGLGLKEAKDLVEAGDKVVKESVSKADAAALKEKLEAAG 118

Query: 121 ATVELR 126
            TVE++
Sbjct: 119 CTVEVK 124


>gi|227825219|ref|ZP_03990051.1| 50S ribosomal protein L7/L12 [Acidaminococcus sp. D21]
 gi|226905718|gb|EEH91636.1| 50S ribosomal protein L7/L12 [Acidaminococcus sp. D21]
          Length = 122

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 90/122 (73%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ + S+T++E A+L K +E+++GVSA+APV+V A  AA   +AA+EKTEF+VVL  
Sbjct: 4   EEIMQAIESMTVLELADLVKAMEEKFGVSAAAPVAVAAAPAAGG-AAAAEKTEFDVVLT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR +T LGLKEAK  V+SAP +LK G+SK +A  MK KLE+AGA VE
Sbjct: 62  -DCGASKINVIKVVRELTGLGLKEAKAAVDSAPNTLKEGVSKADAEAMKAKLEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|238020178|ref|ZP_04600604.1| hypothetical protein GCWU000324_00053 [Kingella oralis ATCC 51147]
 gi|237868572|gb|EEP69576.1| hypothetical protein GCWU000324_00053 [Kingella oralis ATCC 51147]
          Length = 124

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S+LT++E  EL K  E+++GVSA+A      P A  A +A   KTEF+V+L  
Sbjct: 6   EDILEAVSNLTVMELNELVKAFEEKFGVSAAAVAVAAGPAAGGA-AAGEAKTEFDVILAS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK+LV+ APK+LK G+S+ EA+++KK+LE+AGA VE
Sbjct: 65  AGD--QKVGVIKVVRAITGLGLKEAKDLVDGAPKTLKEGVSQAEADDIKKQLEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|254458746|ref|ZP_05072170.1| ribosomal protein L7/L12 [Campylobacterales bacterium GD 1]
 gi|207084512|gb|EDZ61800.1| ribosomal protein L7/L12 [Campylobacterales bacterium GD 1]
          Length = 123

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S L+++E +EL K  E+++GVSA  PV++    AA   +AA E+TEF+V++  
Sbjct: 6   EDVLEFISGLSVLELSELVKEFEEKFGVSAQ-PVAMAGGAAAGG-AAAEEQTEFDVIIT- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAKE  E+ P ++K G+ K+ A   KK+LE+AGATVE
Sbjct: 63  -DAGAKKIGVIKAVRALTGLGLKEAKEATEALPSTIKEGVDKETAEAAKKELEEAGATVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|251791444|ref|YP_003006165.1| 50S ribosomal protein L7/L12 [Dickeya zeae Ech1591]
 gi|271498791|ref|YP_003331816.1| 50S ribosomal protein L7/L12 [Dickeya dadantii Ech586]
 gi|247540065|gb|ACT08686.1| ribosomal protein L7/L12 [Dickeya zeae Ech1591]
 gi|270342346|gb|ACZ75111.1| ribosomal protein L7/L12 [Dickeya dadantii Ech586]
          Length = 121

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAAPA----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  V--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|237753297|ref|ZP_04583777.1| 50S ribosomal protein L7/L12 [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375564|gb|EEO25655.1| 50S ribosomal protein L7/L12 [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 124

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA AP  V   VA    +A+ EKTEF+++L  
Sbjct: 6   EDVLEYIGNLSVMELSELVKAFEEKFGVSA-APTVVAGAVAGGGAAASEEKTEFDIILT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR +T LGLKEAK+ VE  P ++K G+ K++A+ +K K E+AGA V+
Sbjct: 64  -DSGDKKINVIKVVREVTGLGLKEAKDAVEKTPFTVKEGVKKEDADAIKAKFEEAGAKVD 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|223041764|ref|ZP_03611957.1| 50S ribosomal protein L7/L12 [Actinobacillus minor 202]
 gi|223017448|gb|EEF15866.1| 50S ribosomal protein L7/L12 [Actinobacillus minor 202]
          Length = 122

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A V+      A   +AA EKTEF+VVL  
Sbjct: 6   EQIIEAIASKSVSEIVELITAMEEKFGVSAAAAVAAAPAAGA---AAAEEKTEFDVVLA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 62  -DAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAEAEALKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|224370698|ref|YP_002604862.1| 50S ribosomal protein L7/L12 [Desulfobacterium autotrophicum HRM2]
 gi|259491643|sp|C0Q9Y0|RL7_DESAH RecName: Full=50S ribosomal protein L7/L12
 gi|223693415|gb|ACN16698.1| RplL [Desulfobacterium autotrophicum HRM2]
          Length = 127

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 93/123 (75%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           + +VE +++++++E +EL K LE+++GVSA+APV+++A   A    AA+E +TEF+V+L+
Sbjct: 7   DDVVEFIANMSVLELSELVKELEEKFGVSAAAPVAMMAAGGAADAGAAAEEQTEFDVILE 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              D  KKI VIKEVRAIT LGLKEAK LV+ APK +K G+ K+EA ++K +LE AGA V
Sbjct: 67  AAGD--KKIGVIKEVRAITGLGLKEAKALVDEAPKPVKEGIVKEEAEKIKAQLEAAGAQV 124

Query: 124 ELR 126
            ++
Sbjct: 125 SVK 127


>gi|86140282|ref|ZP_01058841.1| 50S ribosomal protein L7/L12 [Leeuwenhoekiella blandensis MED217]
 gi|85832224|gb|EAQ50673.1| 50S ribosomal protein L7/L12 [Leeuwenhoekiella blandensis MED217]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    +A  AA    AA E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAMAGPAAGGDDAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLK+AKELV++AP  +K G++KDEA  +K +LE+AG
Sbjct: 61  ILKAA--GGSKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGIAKDEAEAIKSQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|254495702|ref|ZP_05108619.1| 50S ribosomal protein L7/L12 [Legionella drancourtii LLAP12]
 gi|254355081|gb|EET13699.1| 50S ribosomal protein L7/L12 [Legionella drancourtii LLAP12]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 86/120 (71%), Gaps = 3/120 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I+E +S+++++E  EL + +E+++ VSA+A    V   AA A +A  E+TEF V++  F 
Sbjct: 8   ILETISNMSVMEVVELIEAMEEKFNVSAAAAAVAVVAPAAAA-AAVEEQTEFNVIMTSFG 66

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
               K+ VIK VR +T LGLKEAK+LVE AP ++K G+SKDEA  +KK+LE+AGA+VE++
Sbjct: 67  --ANKVNVIKAVRGLTGLGLKEAKDLVEGAPSTIKEGVSKDEAASVKKELEEAGASVEVK 124


>gi|150025249|ref|YP_001296075.1| 50S ribosomal protein L7/L12 [Flavobacterium psychrophilum
           JIP02/86]
 gi|166222166|sp|A6GYU1|RL7_FLAPJ RecName: Full=50S ribosomal protein L7/L12
 gi|45439265|gb|AAS64309.1| putative ribosomal protein L7/L12 [Flavobacterium psychrophilum]
 gi|149771790|emb|CAL43264.1| 50S ribosomal protein L7/L12 [Flavobacterium psychrophilum
           JIP02/86]
          Length = 122

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  +L+  L+ E+G+  +A   V+     E  +A   +TEF V
Sbjct: 1   MADLKQFAEQLVNLTVKEVNDLATILKDEYGIEPAAAAVVMQAGGGE--AAEEAQTEFTV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    K+AV+K V+ +T LGLKEAK+LV++AP ++K G+SKDEA  +KK LE+AG
Sbjct: 59  VLK--EAGASKLAVVKAVKELTGLGLKEAKDLVDAAPSNVKEGVSKDEAEGLKKSLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AVVELK 122


>gi|71066443|ref|YP_265170.1| 50S ribosomal protein L7/L12 [Psychrobacter arcticus 273-4]
 gi|109893787|sp|Q4FQH2|RL7_PSYA2 RecName: Full=50S ribosomal protein L7/L12
 gi|71039428|gb|AAZ19736.1| LSU ribosomal protein L12P [Psychrobacter arcticus 273-4]
          Length = 123

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++  ++ +++++  EL   +E+++GV+A+   +  A   A   +AA EK EF+VVL  
Sbjct: 6   DDVLNAIAEMSVMDIVELISAMEEKFGVTAAVAAAPAAAGPAA--AAAEEKDEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F +  KK+ VIK VR  T LGLKEAK+LVESAP S+K G++K EA E+KKKLE+AGATVE
Sbjct: 64  FGE--KKVGVIKAVREATGLGLKEAKDLVESAPASIKEGVNKAEAEELKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|260780674|ref|YP_003227040.1| 50S ribosomal protein L12 [Bryopsis hypnoides]
 gi|260176752|gb|ACX33761.1| 50S ribosomal protein L12 [Bryopsis hypnoides]
          Length = 135

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 85/129 (65%), Gaps = 10/129 (7%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSAS--APVSVVAPVAA----EAGSAASEKTEFEV 60
           I+EKL ++TL+EA EL K +E+ +GV  S  AP+++     A    EA S   E+TEF +
Sbjct: 8   IIEKLKNITLLEAVELVKDIEETFGVDTSIGAPMTIGTNTEALNSVEATSQ-KEQTEFTI 66

Query: 61  VLK---GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           +L+   G D   K++++ + +R IT LGLK+AKEL    P+ LK  +SK++A+++K + E
Sbjct: 67  ILEQVPGEDQKSKRLSIFRLIREITSLGLKDAKELTTKLPQPLKEAISKEQADDIKNQFE 126

Query: 118 DAGATVELR 126
           +AGA V+++
Sbjct: 127 EAGAKVKIQ 135


>gi|11467025|ref|NP_041932.1| ribosomal protein L12 [Euglena gracilis]
 gi|400984|sp|P31915|RK12_EUGGR RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|415775|emb|CAA50119.1| ribosomal protein L12 [Euglena gracilis]
          Length = 131

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 81/123 (65%), Gaps = 8/123 (6%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV------VAPVAAEAGSAASEKTEFEV 60
           I+E+L  +TL+EA EL K++E  +GV A+  +S       + P  A+  +   EKTEF+V
Sbjct: 8   ILERLKKITLLEAYELVKQIENTFGVDATIALSASNTNPSILPSKADE-TVVEEKTEFDV 66

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +++     K+ I VIK VR++T LGLKEAK+L+ES PK +   +SK+ A E KK LE+AG
Sbjct: 67  IIQEVPSAKR-INVIKTVRSLTTLGLKEAKDLIESVPKVVCEAVSKEVAEETKKLLEEAG 125

Query: 121 ATV 123
           A++
Sbjct: 126 ASI 128


>gi|284106475|ref|ZP_06386261.1| Ribosomal protein L10 [Candidatus Poribacteria sp. WGA-A3]
 gi|283830071|gb|EFC34342.1| Ribosomal protein L10 [Candidatus Poribacteria sp. WGA-A3]
          Length = 310

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (73%), Gaps = 2/123 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+  + S+T++E +EL K  E+++GV+A+APV+V AP A +AG+ A+E K  F+VVL 
Sbjct: 189 EDILGAVESMTVLELSELVKGFEEKFGVTAAAPVAVAAPAAGDAGAQAAEEKDAFDVVLA 248

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           G     KKI VIK VR IT LGLKEAK+LVE+APK +K G +KDEA  +KKKL D GATV
Sbjct: 249 GVP-ADKKIQVIKVVREITGLGLKEAKDLVEAAPKPVKEGAAKDEAETIKKKLTDVGATV 307

Query: 124 ELR 126
           E++
Sbjct: 308 EVK 310


>gi|301168467|emb|CBW28057.1| 50S ribosomal protein L7/L12 [Bacteriovorax marinus SJ]
          Length = 121

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S++++++ A L K LE+++GVSA+      A       +AA E+TEF V+L  
Sbjct: 6   EQLIEHISAMSVLDVANLVKELEEKFGVSAAPVAVAGAAAG----AAAEEQTEFTVMLT- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIKEVR IT LGLKEAKELVE APK +K G+ K EA E+KKKLE AGA  E
Sbjct: 61  -DAGAKKINVIKEVRGITGLGLKEAKELVEGAPKPIKEGIEKAEAEEIKKKLEAAGAKAE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|255084820|ref|XP_002504841.1| predicted protein [Micromonas sp. RCC299]
 gi|226520110|gb|ACO66099.1| predicted protein [Micromonas sp. RCC299]
          Length = 128

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/127 (44%), Positives = 84/127 (66%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFE 59
           +  + I+EK+ +LTL+EA+EL K++E+ +GV ASAP    V+A   A A   A+EKTEF+
Sbjct: 3   ATTDEIIEKMKTLTLLEASELVKQIEETFGVDASAPAGGMVMAAGPAAAAEEAAEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +V+   D   K+IA+IK VR +T LGLKEAK+ V + P ++  G +K E  E  K+LE  
Sbjct: 63  LVITDVD-ASKRIAIIKVVRGLTSLGLKEAKDAVTNLPFTILEGKTKGEVEEAMKELEAG 121

Query: 120 GATVELR 126
           GA  E++
Sbjct: 122 GAKCEMK 128


>gi|149198914|ref|ZP_01875955.1| ribosomal protein L7/L12 [Lentisphaera araneosa HTCC2155]
 gi|149137909|gb|EDM26321.1| ribosomal protein L7/L12 [Lentisphaera araneosa HTCC2155]
          Length = 132

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 90/123 (73%), Gaps = 2/123 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E++V+ +  ++++E   L K LE   GVSA+APV+V A   A A + A+ E+TEF+VVL 
Sbjct: 11  EALVKSIEEMSVLELTTLVKALEDRLGVSAAAPVAVAAAGGAAAPAEAAEEQTEFDVVLA 70

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            +    KKIAVIK VR+ T LGLK+AK+LVE APK++K   +KDEA+++KK LE+AGATV
Sbjct: 71  AYP-ADKKIAVIKVVRSATGLGLKDAKDLVEGAPKTVKEAAAKDEADKIKKDLEEAGATV 129

Query: 124 ELR 126
           EL+
Sbjct: 130 ELK 132


>gi|253686610|ref|YP_003015800.1| ribosomal protein L7/L12 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259491653|sp|C6DHR4|RL7_PECCP RecName: Full=50S ribosomal protein L7/L12
 gi|251753188|gb|ACT11264.1| ribosomal protein L7/L12 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 121

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A      A EKTEF+VVLKG
Sbjct: 6   DQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGPA----EVAEEKTEFDVVLKG 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|238897914|ref|YP_002923593.1| 50S ribosomal subunit protein L7/L12 [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|259491649|sp|C4K4F2|RL7_HAMD5 RecName: Full=50S ribosomal protein L7/L12
 gi|229465671|gb|ACQ67445.1| 50S ribosomal subunit protein L7/L12 [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 124

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 81/120 (67%), Gaps = 6/120 (5%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I   +  +T+    +L   +EKE+GVSA+A       VAA    A  EKTEF+V+LK F 
Sbjct: 11  ITNSIREMTITNVLDLISIMEKEFGVSAAAA----VAVAAAPAEAVEEKTEFDVILKSFG 66

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           +   K+AVIK VR  T LGLKEAKELVE+APK++K G++K+EA  +KK LE+AGA V+++
Sbjct: 67  E--NKVAVIKAVRGATGLGLKEAKELVEAAPKNVKEGINKEEAESLKKTLEEAGADVDIK 124


>gi|256083341|ref|XP_002577904.1| mitochondrial 60S ribosomal protein L7/L12 [Schistosoma mansoni]
 gi|238663244|emb|CAZ34142.1| mitochondrial 60S ribosomal protein L7/L12, putative [Schistosoma
           mansoni]
          Length = 181

 Score = 85.9 bits (211), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 80/129 (62%), Gaps = 9/129 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-------SVVAPVAAEAGSAASEK 55
           +I  IV ++SSLTL+E A+LS+ L+K+  +  + PV        +  PV       A  K
Sbjct: 51  HIHEIVNRISSLTLLEVADLSELLQKKLNIKNTGPVMPMMGQAPINQPVEEPEEQQAPTK 110

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V L  FD   KKI +IKE++  I ++ L +AK+ VESAP ++KT +SKDEA ++KK
Sbjct: 111 TAFSVKLVKFDA-AKKIQLIKEIKQVIPEMNLVQAKKFVESAPANIKTDVSKDEAEQIKK 169

Query: 115 KLEDAGATV 123
            LE+ GA++
Sbjct: 170 VLEEVGASI 178


>gi|190570969|ref|YP_001975327.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213019485|ref|ZP_03335291.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|190357241|emb|CAQ54663.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212994907|gb|EEB55549.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 133

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 89/133 (66%), Gaps = 9/133 (6%)

Query: 1   MSNIES-IVEKLSSLTLIEAAELSKRLEKEWGVSASA----PVSVVAPVAAEAGS-AASE 54
           M+N+ S +V+K+ SL L+EA+EL K LE++ G+ + +     V    P++  A +  A E
Sbjct: 1   MNNVTSDLVDKILSLNLLEASELVKVLEEKIGLPSGSFLGGAVGAGVPISDNANAPVAQE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           K E++VV+K  D   KKI VIK +R + + L LKEAKELVES PK L   +SKDEA ++K
Sbjct: 61  KAEYKVVIKEID-ASKKIGVIKAIREVNSTLNLKEAKELVESLPKDLTANVSKDEAEKIK 119

Query: 114 KKLEDAGAT-VEL 125
           +KL +AGAT VEL
Sbjct: 120 QKLIEAGATKVEL 132


>gi|300714846|ref|YP_003739649.1| 50S ribosomal protein L7/L12 [Erwinia billingiae Eb661]
 gi|299060682|emb|CAX57789.1| 50S ribosomal protein L7/L12 [Erwinia billingiae Eb661]
          Length = 121

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +++L+++E  EL   +E+++GVSA+A V+  A  A     A  EKTEF+VVLK 
Sbjct: 6   EQIIEGVAALSVMEIVELISAMEEKFGVSAAAAVAGPAAAA----EAVEEKTEFDVVLKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAESLKKALEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|228472149|ref|ZP_04056915.1| ribosomal protein L7/L12 [Capnocytophaga gingivalis ATCC 33624]
 gi|228276352|gb|EEK15076.1| ribosomal protein L7/L12 [Capnocytophaga gingivalis ATCC 33624]
          Length = 124

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 88/126 (69%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    V    A AG AA+EKTEF+V
Sbjct: 1   MADLKNFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVTAGPAAAGEAAAEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK   D   K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK +A  +KK LE+AG
Sbjct: 61  ILKSAGD--NKLAVVKLVKDLTGLGLKEAKEVVDGAPSKVKEGVSKADAENLKKSLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|42519941|ref|NP_965856.1| 50S ribosomal protein L7/L12 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58699876|ref|ZP_00374481.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|99034582|ref|ZP_01314547.1| hypothetical protein Wendoof_01000640 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
 gi|225629892|ref|YP_002726683.1| ribosomal protein L7/L12 [Wolbachia sp. wRi]
 gi|42409678|gb|AAS13790.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|58533607|gb|EAL58001.1| ribosomal protein L7/L12 [Wolbachia endosymbiont of Drosophila
           ananassae]
 gi|225591873|gb|ACN94892.1| ribosomal protein L7/L12 [Wolbachia sp. wRi]
          Length = 133

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (66%), Gaps = 9/133 (6%)

Query: 1   MSNIES-IVEKLSSLTLIEAAELSKRLEKEWGVSASA----PVSVVAPVAAEAGSAA-SE 54
           MSN+ S +V+K+ SL L+EA+EL K LE++ G+ A +     V   AP+   A + A  E
Sbjct: 1   MSNVTSDLVDKILSLNLLEASELVKVLEEKIGLPAGSFLGGAVGAGAPIGDNAAAPAAQE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           K E++VV+K  D   KKI VIK VR + + LGLKEAKELVES PK L   + KDEA ++K
Sbjct: 61  KAEYKVVIKEID-ASKKIGVIKAVREVNSTLGLKEAKELVESLPKDLTANVPKDEAEKIK 119

Query: 114 KKLEDAGAT-VEL 125
           +KL +AGAT VEL
Sbjct: 120 QKLIEAGATKVEL 132


>gi|312892226|ref|ZP_07751723.1| LSU ribosomal protein L12P [Mucilaginibacter paludis DSM 18603]
 gi|311295356|gb|EFQ72528.1| LSU ribosomal protein L12P [Mucilaginibacter paludis DSM 18603]
          Length = 126

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  +A   + A E  +T F
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAPSAGGDAPAEEAVQTAF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK  +    K+AV+K V+ +T LGLKEAK+LV+ APK +KTG++K+EA  +KK+LE+
Sbjct: 61  DVILK--EAGGAKLAVVKLVKDLTGLGLKEAKDLVDGAPKEVKTGVTKEEAESLKKQLEE 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAVVEVK 126


>gi|256825896|ref|YP_003149856.1| 50S ribosomal protein L7/L12 [Kytococcus sedentarius DSM 20547]
 gi|256689289|gb|ACV07091.1| LSU ribosomal protein L12P [Kytococcus sedentarius DSM 20547]
          Length = 129

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 91/129 (70%), Gaps = 6/129 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           +SN E ++E+   +TLIE +E  K+ E+ + V+A+APV+V     A AG A     EKTE
Sbjct: 4   LSNDE-LIEQFKEMTLIELSEFVKQFEEVFEVTAAAPVAVAGAAPAAAGDAGDAAEEKTE 62

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L    D  KKI VIKEVR +T LGLKEAK+LV+ APK++  G+SK+EA++ K+ LE
Sbjct: 63  FDVILAAAGD--KKIGVIKEVRGLTSLGLKEAKDLVDGAPKAVLEGVSKEEADKAKEALE 120

Query: 118 DAGATVELR 126
            AGATVE++
Sbjct: 121 GAGATVEVK 129


>gi|81609682|sp|Q65W43|RL7_MANSM RecName: Full=50S ribosomal protein L7/L12
 gi|52306317|gb|AAU36817.1| RplL protein [Mannheimia succiniciproducens MBEL55E]
          Length = 125

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A  +      A   +AA EKTEF+VVLK 
Sbjct: 9   EQIIEAIASKSVSEIVELISAMEEKFGVSAAAVAAAAPAAGA---AAAEEKTEFDVVLKA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +KK+LE AGA VE
Sbjct: 66  --AGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAESLKKELEAAGAEVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|75908769|ref|YP_323065.1| 50S ribosomal protein L7/L12 [Anabaena variabilis ATCC 29413]
 gi|109893746|sp|Q3MA16|RL7_ANAVT RecName: Full=50S ribosomal protein L7/L12
 gi|75702494|gb|ABA22170.1| LSU ribosomal protein L12P [Anabaena variabilis ATCC 29413]
          Length = 128

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 90/124 (72%), Gaps = 3/124 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           + I+++L SL+L+EAAEL K++E+ +GVSA+APV V     A A +A     +TEF+V+L
Sbjct: 6   DQILDQLKSLSLLEAAELVKQIEEAFGVSAAAPVGVAVAAPAAAAAAEPVEEQTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +      KKIAV+K VR IT LGLKEAK+LVE+APK++K  ++KD A + KK++E+AG  
Sbjct: 66  ESVP-ADKKIAVLKIVREITGLGLKEAKDLVEAAPKAVKEAIAKDAAEDAKKRIEEAGGK 124

Query: 123 VELR 126
           V ++
Sbjct: 125 VTIK 128


>gi|257454925|ref|ZP_05620173.1| ribosomal protein L7/L12 [Enhydrobacter aerosaccus SK60]
 gi|257447635|gb|EEV22630.1| ribosomal protein L7/L12 [Enhydrobacter aerosaccus SK60]
          Length = 123

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++  +++E  +L   +E+++GVSA+A  +  A        AA EK +F VVL G
Sbjct: 6   QEILDAIAEKSVMEIVDLISAMEEKFGVSAAALAAAPAAAGDA--PAAEEKDDFTVVLTG 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+AVIK VR IT LGLKEAK+LVE AP+++K G++K EA E+KKKLE+AGA+VE
Sbjct: 64  AGD--KKVAVIKAVREITGLGLKEAKDLVEGAPQTVKEGVAKAEAEELKKKLEEAGASVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|114778902|ref|ZP_01453699.1| ribosomal protein L7/L12 [Mariprofundus ferrooxydans PV-1]
 gi|114550871|gb|EAU53437.1| ribosomal protein L7/L12 [Mariprofundus ferrooxydans PV-1]
          Length = 127

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 91/124 (73%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           + +++ + S+T++E +EL   LE+++GVSA+APV+V A  AA  G+A +  EKTEF+VVL
Sbjct: 6   DELIQAIESMTVLELSELVSALEEKFGVSAAAPVAVAAGPAAAGGAADAAEEKTEFDVVL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KKI VIK VR  T LGLKEAK +V+ AP ++K G+SKD+A  +K KLE+AGAT
Sbjct: 66  ASAGD--KKIQVIKAVREATGLGLKEAKAVVDGAPGTVKEGVSKDDAEALKAKLEEAGAT 123

Query: 123 VELR 126
           VEL+
Sbjct: 124 VELK 127


>gi|325576516|ref|ZP_08147269.1| 50S ribosomal protein L7/L12 [Haemophilus parainfluenzae ATCC
           33392]
 gi|325161206|gb|EGC73320.1| 50S ribosomal protein L7/L12 [Haemophilus parainfluenzae ATCC
           33392]
          Length = 123

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A  +      A   +AA EKTEF+VVL  
Sbjct: 6   EQIIEAIASKSVTEIVELIAAMEEKFGVSAAAVAAAPTVGGAA--AAAEEKTEFDVVLA- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +KK+LE+AGA VE
Sbjct: 63  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAEALKKELEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|58584905|ref|YP_198478.1| 50S ribosomal protein L7/L12 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419221|gb|AAW71236.1| Ribosomal protein L7/L12 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 133

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 89/133 (66%), Gaps = 9/133 (6%)

Query: 1   MSNIES-IVEKLSSLTLIEAAELSKRLEKEWGVSASA----PVSVVAPVAAEAGSA-ASE 54
           MSN+ + +V+K+ SL L+EA+EL K LE++ G+ A +     VS  AP +  A S+ A E
Sbjct: 1   MSNVTNDLVDKILSLNLLEASELVKVLEEKIGLPAGSFVDGAVSSSAPTSDNAASSVAQE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           KTE +VV+K  D   KK+ +I+ VR I   LGLKEAKELVES PK L   + + EA ++K
Sbjct: 61  KTECKVVIKEID-ASKKMEIIRTVRKIDPTLGLKEAKELVESLPKDLTASVPRGEAEKIK 119

Query: 114 KKLEDAGAT-VEL 125
           ++L DAGAT VEL
Sbjct: 120 QQLIDAGATKVEL 132


>gi|306820724|ref|ZP_07454351.1| ribosomal protein L7/L12 [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551223|gb|EFM39187.1| ribosomal protein L7/L12 [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 126

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            IE I++ +  + ++E  EL K+ E+E+GVSA+APV+    VAA    +A EK+EF+V+L
Sbjct: 7   TIEQIIDAIKEMKVLELNELVKKAEEEFGVSAAAPVA--VGVAAGPAESAEEKSEFDVIL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K+ VIK VR +T LGLK+AK+LV+ APK +K G+SKDEA E+K KLE AGA 
Sbjct: 65  A--EAGASKVGVIKVVREVTGLGLKDAKDLVDGAPKPIKEGVSKDEAEEIKTKLEAAGAK 122

Query: 123 VELR 126
           VE++
Sbjct: 123 VEVK 126


>gi|300725142|ref|YP_003714470.1| 50S ribosomal subunit protein L7/L12 [Xenorhabdus nematophila ATCC
           19061]
 gi|297631687|emb|CBJ92400.1| 50S ribosomal subunit protein L7/L12 [Xenorhabdus nematophila ATCC
           19061]
          Length = 120

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 85/122 (69%), Gaps = 7/122 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E++ GVSA+A V+VVA           EKTEF+V+L G
Sbjct: 6   EQILDAVAEMSVMDVVELISMMEEKLGVSAAAAVAVVAAA-----EVVEEKTEFDVILAG 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP ++K G+SKD+A  +KK LE+AGA+VE
Sbjct: 61  V--GANKVAVIKAVRGATGLGLKEAKDLVESAPAAMKEGISKDDAEALKKSLEEAGASVE 118

Query: 125 LR 126
           ++
Sbjct: 119 IK 120


>gi|294101328|ref|YP_003553186.1| ribosomal protein L7/L12 [Aminobacterium colombiense DSM 12261]
 gi|293616308|gb|ADE56462.1| ribosomal protein L7/L12 [Aminobacterium colombiense DSM 12261]
          Length = 126

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E I++ +  +T++E +EL K LE ++GVSASAP   +  +   AG+A +    KTEF+VV
Sbjct: 4   EEIIQAIEGMTVLELSELVKALEDKFGVSASAPAMAMPMMMPGAGAAVAAEEEKTEFDVV 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LKG      KIA IK VR +T LGLKEAKELV++APK +K  +SK+EA+E+K KLE+AGA
Sbjct: 64  LKG--PGSNKIATIKVVRELTGLGLKEAKELVDNAPKPVKEAVSKEEADEIKAKLEEAGA 121

Query: 122 TVELR 126
            VE++
Sbjct: 122 EVEVK 126


>gi|161511007|ref|YP_087402.2| 50S ribosomal protein L7/L12 [Mannheimia succiniciproducens
           MBEL55E]
          Length = 122

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A  +      A   +AA EKTEF+VVLK 
Sbjct: 6   EQIIEAIASKSVSEIVELISAMEEKFGVSAAAVAAAAPAAGA---AAAEEKTEFDVVLKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +KK+LE AGA VE
Sbjct: 63  --AGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAESLKKELEAAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|22124398|ref|NP_667821.1| 50S ribosomal protein L7/L12 [Yersinia pestis KIM 10]
 gi|51594637|ref|YP_068828.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 32953]
 gi|108809611|ref|YP_653527.1| 50S ribosomal protein L7/L12 [Yersinia pestis Antiqua]
 gi|108810384|ref|YP_646151.1| 50S ribosomal protein L7/L12 [Yersinia pestis Nepal516]
 gi|145600989|ref|YP_001165065.1| 50S ribosomal protein L7/L12 [Yersinia pestis Pestoides F]
 gi|153949418|ref|YP_001402812.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 31758]
 gi|153997218|ref|ZP_02022325.1| 50S ribosomal protein L7/L12 [Yersinia pestis CA88-4125]
 gi|165928323|ref|ZP_02224155.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938174|ref|ZP_02226733.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166012060|ref|ZP_02232958.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214399|ref|ZP_02240434.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402407|ref|ZP_02307867.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422931|ref|ZP_02314684.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426797|ref|ZP_02318550.1| ribosomal protein L7/L12 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022596|ref|YP_001719101.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis YPIII]
 gi|186893638|ref|YP_001870750.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis PB1/+]
 gi|218930753|ref|YP_002348628.1| 50S ribosomal protein L7/L12 [Yersinia pestis CO92]
 gi|229837494|ref|ZP_04457656.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Pestoides A]
 gi|229899992|ref|ZP_04515132.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900559|ref|ZP_04515685.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Nepal516]
 gi|270488915|ref|ZP_06205989.1| ribosomal protein L7/L12 [Yersinia pestis KIM D27]
 gi|284987553|ref|NP_994404.2| ribosomal protein L7/L12 [Yersinia pestis biovar Microtus str.
           91001]
 gi|294505416|ref|YP_003569478.1| 50S ribosomal protein L7/L12 [Yersinia pestis Z176003]
 gi|20978565|sp|Q8ZAP4|RL7_YERPE RecName: Full=50S ribosomal protein L7/L12
 gi|81640667|sp|Q66FQ3|RL7_YERPS RecName: Full=50S ribosomal protein L7/L12
 gi|123072549|sp|Q1C1U0|RL7_YERPA RecName: Full=50S ribosomal protein L7/L12
 gi|123073625|sp|Q1CN79|RL7_YERPN RecName: Full=50S ribosomal protein L7/L12
 gi|166222228|sp|A4TS30|RL7_YERPP RecName: Full=50S ribosomal protein L7/L12
 gi|166990992|sp|A7FNI4|RL7_YERP3 RecName: Full=50S ribosomal protein L7/L12
 gi|226734498|sp|B2K111|RL7_YERPB RecName: Full=50S ribosomal protein L7/L12
 gi|226734500|sp|B1JJJ7|RL7_YERPY RecName: Full=50S ribosomal protein L7/L12
 gi|21957180|gb|AAM84072.1|AE013649_2 50S ribosomal subunit protein L7/L12 [Yersinia pestis KIM 10]
 gi|51587919|emb|CAH19522.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 32953]
 gi|108774032|gb|ABG16551.1| LSU ribosomal protein L12P [Yersinia pestis Nepal516]
 gi|108781524|gb|ABG15582.1| LSU ribosomal protein L12P [Yersinia pestis Antiqua]
 gi|115349364|emb|CAL22335.1| 50S ribosomal protein L7/L12 [Yersinia pestis CO92]
 gi|145212685|gb|ABP42092.1| LSU ribosomal protein L12P [Yersinia pestis Pestoides F]
 gi|149289326|gb|EDM39405.1| 50S ribosomal protein L7/L12 [Yersinia pestis CA88-4125]
 gi|152960913|gb|ABS48374.1| ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 31758]
 gi|165913835|gb|EDR32453.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165919662|gb|EDR36995.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989055|gb|EDR41356.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204403|gb|EDR48883.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166957142|gb|EDR55163.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048187|gb|EDR59595.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054179|gb|EDR64004.1| ribosomal protein L7/L12 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749130|gb|ACA66648.1| ribosomal protein L7/L12 [Yersinia pseudotuberculosis YPIII]
 gi|186696664|gb|ACC87293.1| ribosomal protein L7/L12 [Yersinia pseudotuberculosis PB1/+]
 gi|229682379|gb|EEO78469.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Nepal516]
 gi|229686977|gb|EEO79053.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229704182|gb|EEO91193.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Pestoides A]
 gi|262363482|gb|ACY60203.1| 50S ribosomal protein L7/L12 [Yersinia pestis D106004]
 gi|262367410|gb|ACY63967.1| 50S ribosomal protein L7/L12 [Yersinia pestis D182038]
 gi|270337419|gb|EFA48196.1| ribosomal protein L7/L12 [Yersinia pestis KIM D27]
 gi|294355875|gb|ADE66216.1| 50S ribosomal protein L7/L12 [Yersinia pestis Z176003]
 gi|320013656|gb|ADV97227.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 122

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 89/128 (69%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A        AA E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAV----EAAEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL  F +   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+
Sbjct: 57  DVVLASFGE--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKKSLEE 114

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 115 AGASVEIK 122


>gi|298206597|ref|YP_003714776.1| 50S ribosomal protein L7/L12 [Croceibacter atlanticus HTCC2559]
 gi|83849227|gb|EAP87095.1| 50S ribosomal protein L7/L12 [Croceibacter atlanticus HTCC2559]
          Length = 124

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L++E+G+  +A    VA         A E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAAGGGADAGGADEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LKG      K+AV+K V+ +T  GLK+AKELV++AP  +K G++KDEA  +K +LE+AG
Sbjct: 61  ILKGAG--ASKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGIAKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|146309863|ref|YP_001174937.1| 50S ribosomal protein L7/L12 [Enterobacter sp. 638]
 gi|166990985|sp|A4W5A6|RL7_ENT38 RecName: Full=50S ribosomal protein L7/L12
 gi|145316739|gb|ABP58886.1| LSU ribosomal protein L12P [Enterobacter sp. 638]
          Length = 121

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 89/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LKG
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKG 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|312131289|ref|YP_003998629.1| lsu ribosomal protein l12p [Leadbetterella byssophila DSM 17132]
 gi|311907835|gb|ADQ18276.1| LSU ribosomal protein L12P [Leadbetterella byssophila DSM 17132]
          Length = 126

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 89/128 (69%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++I++  E+L +LT+ E  EL++ L+ E+G+  +A  +VV    A    A +  EKT F
Sbjct: 1   MADIKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAGGAVVVAGPAAGADAPAAEEKTSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       K+ V+K V+ +T LGLKEAKE+V+ APK+LK G++KDEA+ +KK+LE+
Sbjct: 61  DVILKS--GGANKLQVVKLVKDLTGLGLKEAKEVVDGAPKALKEGVAKDEADALKKQLEE 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAEVEIK 126


>gi|53804625|ref|YP_113540.1| 50S ribosomal protein L7/L12 [Methylococcus capsulatus str. Bath]
 gi|81682420|sp|Q60A07|RL7_METCA RecName: Full=50S ribosomal protein L7/L12
 gi|53758386|gb|AAU92677.1| ribosomal protein L7/L12 [Methylococcus capsulatus str. Bath]
          Length = 125

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  +L   +E+++GVSA+A V+V    A  A  A  EKTEF+VV+  
Sbjct: 6   EDILETISNMTVMEIVDLISAMEEKFGVSAAAAVAVAPVAAGAAAPAVEEKTEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK +R IT LGLKEAK+LVE  P ++K G+SK EA+++KKKLE+AGA V+
Sbjct: 66  F--GANKVNVIKAIREITGLGLKEAKDLVEGVPSTVKEGISKAEADDIKKKLEEAGAAVD 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|30249987|ref|NP_842057.1| ribosomal protein L7/L12 domain-containing protein [Nitrosomonas
           europaea ATCC 19718]
 gi|81584589|sp|Q82T74|RL7_NITEU RecName: Full=50S ribosomal protein L7/L12
 gi|30139094|emb|CAD85958.1| Ribosomal protein L7/L12 C-terminal domain [Nitrosomonas europaea
           ATCC 19718]
          Length = 124

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 87/120 (72%), Gaps = 3/120 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I+E ++++T++E +EL K +E+++GVSA+A    VA   A A +A  E+TEF V+L    
Sbjct: 8   ILESIANMTVLELSELIKEMEEKFGVSAAAATVAVAAAPAAA-AAVEEQTEFSVILTAAG 66

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           D   K+ VIK VRA+T LGLKEAK+LV+ APK++K G+SK++A  +KK+L +AGA  E++
Sbjct: 67  D--NKVNVIKVVRAVTGLGLKEAKDLVDGAPKTVKEGISKEDAESLKKQLVEAGAGCEIK 124


>gi|42518511|ref|NP_964441.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii NCC 533]
 gi|116629033|ref|YP_814205.1| 50S ribosomal protein L7/L12 [Lactobacillus gasseri ATCC 33323]
 gi|227888777|ref|ZP_04006582.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii ATCC 33200]
 gi|238853600|ref|ZP_04643969.1| ribosomal protein L7/L12 [Lactobacillus gasseri 202-4]
 gi|268318931|ref|YP_003292587.1| ribosomal protein L7/L12 [Lactobacillus johnsonii FI9785]
 gi|282852738|ref|ZP_06262080.1| ribosomal protein L7/L12 [Lactobacillus gasseri 224-1]
 gi|300362317|ref|ZP_07058493.1| ribosomal protein L7/L12 [Lactobacillus gasseri JV-V03]
 gi|311111172|ref|ZP_07712569.1| ribosomal protein L7/L12 [Lactobacillus gasseri MV-22]
 gi|81668238|sp|Q74L08|RL7_LACJO RecName: Full=50S ribosomal protein L7/L12
 gi|122273969|sp|Q045V5|RL7_LACGA RecName: Full=50S ribosomal protein L7/L12
 gi|41582796|gb|AAS08407.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii NCC 533]
 gi|116094615|gb|ABJ59767.1| LSU ribosomal protein L12P [Lactobacillus gasseri ATCC 33323]
 gi|227850614|gb|EEJ60700.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii ATCC 33200]
 gi|238833744|gb|EEQ26012.1| ribosomal protein L7/L12 [Lactobacillus gasseri 202-4]
 gi|262397306|emb|CAX66320.1| ribosomal protein L7/L12 [Lactobacillus johnsonii FI9785]
 gi|282556480|gb|EFB62100.1| ribosomal protein L7/L12 [Lactobacillus gasseri 224-1]
 gi|300353308|gb|EFJ69180.1| ribosomal protein L7/L12 [Lactobacillus gasseri JV-V03]
 gi|311066326|gb|EFQ46666.1| ribosomal protein L7/L12 [Lactobacillus gasseri MV-22]
 gi|329666781|gb|AEB92729.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii DPC 6026]
          Length = 120

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 89/124 (71%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E L   +++E  +L K +E E+GVSA+APV+     AA A  A +EKTEF+V L
Sbjct: 4   DTEKIIEDLKGASILELNDLVKAIEDEFGVSAAAPVA-----AAGAAGAGAEKTEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--DVGQEKVKVIKVVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V ++
Sbjct: 117 VTVK 120


>gi|325104982|ref|YP_004274636.1| LSU ribosomal protein L12P [Pedobacter saltans DSM 12145]
 gi|324973830|gb|ADY52814.1| LSU ribosomal protein L12P [Pedobacter saltans DSM 12145]
          Length = 125

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  AA   +AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAPAAGGEAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +T LGLKEAK+LV+ APK LK G++KDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLTGLGLKEAKDLVDGAPKELKAGVAKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|290968181|ref|ZP_06559726.1| ribosomal protein L7/L12 [Megasphaera genomosp. type_1 str. 28L]
 gi|290781856|gb|EFD94439.1| ribosomal protein L7/L12 [Megasphaera genomosp. type_1 str. 28L]
          Length = 122

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ + ++T++E +EL K +E+++GVSA+APV+V A  A  A +A  EKTEF+VVL  
Sbjct: 4   EEIMQAIENMTVLELSELVKDMEEKFGVSAAAPVAVAAAPAGAA-AAGEEKTEFDVVLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VR  T LGLKEAK LV+ APK++K G +K +A  +K KLE+AGATVE
Sbjct: 63  AGD--KKINVIKVVREATGLGLKEAKALVDGAPKAVKEGAAKADAEALKAKLEEAGATVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|254412829|ref|ZP_05026602.1| ribosomal protein L7/L12 [Microcoleus chthonoplastes PCC 7420]
 gi|196180564|gb|EDX75555.1| ribosomal protein L7/L12 [Microcoleus chthonoplastes PCC 7420]
          Length = 126

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 87/127 (68%), Gaps = 9/127 (7%)

Query: 8   VEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--------KTEFE 59
           +EKL SLTL+EA+EL K++E  +GVSA+AP   +  +   A + A          KTEF+
Sbjct: 1   MEKLKSLTLLEASELVKQIEDTFGVSAAAPAGGMMMMPGMAAAGAPGAAAEEAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L+      KKIA++K VR +T LGLKEAK++VESAPK +K G++K+ A E KK+LE+A
Sbjct: 61  VILEEVP-ADKKIAILKVVRTMTGLGLKEAKDMVESAPKPIKEGVAKESAEEAKKQLEEA 119

Query: 120 GATVELR 126
           GA V ++
Sbjct: 120 GAKVSVK 126


>gi|153871196|ref|ZP_02000429.1| 50S ribosomal protein L7/L12 [Beggiatoa sp. PS]
 gi|152072336|gb|EDN69569.1| 50S ribosomal protein L7/L12 [Beggiatoa sp. PS]
          Length = 124

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++++T++E  EL K +E+++GVSA+APV+V     +E  +AA E+TEF V L  
Sbjct: 6   EDILESIANMTVMEVVELVKAMEEKFGVSAAAPVAVAV-ATSEGEAAAPEQTEFTVTLTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F +  KK+ VIK +R+IT LGLKEAKELVE  P  +K  + KDEA ++K +LE+AG + E
Sbjct: 65  FGE--KKVQVIKVIRSITGLGLKEAKELVEGVPSVVKEAIPKDEAEKIKTELEEAGGSAE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|227536130|ref|ZP_03966179.1| 50S ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227244027|gb|EEI94042.1| 50S ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 125

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ + E+L +LT+ E  EL+  L+ E+G+  +A    VA   AE G+AA+E KT F+
Sbjct: 1   MADLKQLAEQLVNLTVKEVKELADILKDEYGIEPAAAAVAVAAAPAEGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +  LGLKEAK+LV+ APK LKTG+SKDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLAGLGLKEAKDLVDGAPKELKTGVSKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|319639541|ref|ZP_07994288.1| 50S ribosomal protein L7/L12 [Neisseria mucosa C102]
 gi|317399112|gb|EFV79786.1| 50S ribosomal protein L7/L12 [Neisseria mucosa C102]
          Length = 123

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAVAVAVAGPAGAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|261364717|ref|ZP_05977600.1| ribosomal protein L7/L12 [Neisseria mucosa ATCC 25996]
 gi|288567013|gb|EFC88573.1| ribosomal protein L7/L12 [Neisseria mucosa ATCC 25996]
          Length = 123

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGGGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|225076432|ref|ZP_03719631.1| hypothetical protein NEIFLAOT_01478 [Neisseria flavescens
           NRL30031/H210]
 gi|241760445|ref|ZP_04758539.1| ribosomal protein L7/L12 [Neisseria flavescens SK114]
 gi|255067808|ref|ZP_05319663.1| ribosomal protein L7/L12 [Neisseria sicca ATCC 29256]
 gi|261378967|ref|ZP_05983540.1| ribosomal protein L7/L12 [Neisseria cinerea ATCC 14685]
 gi|261381385|ref|ZP_05985958.1| ribosomal protein L7/L12 [Neisseria subflava NJ9703]
 gi|298370600|ref|ZP_06981915.1| ribosomal protein L7/L12 [Neisseria sp. oral taxon 014 str. F0314]
 gi|14195171|sp|Q9F5M1|RL7_NEIPE RecName: Full=50S ribosomal protein L7/L12
 gi|11321430|gb|AAG34165.1|AF312973_1 ribosomal protein L7/L12 [Neisseria perflava]
 gi|224952232|gb|EEG33441.1| hypothetical protein NEIFLAOT_01478 [Neisseria flavescens
           NRL30031/H210]
 gi|241319114|gb|EER55607.1| ribosomal protein L7/L12 [Neisseria flavescens SK114]
 gi|255047899|gb|EET43363.1| ribosomal protein L7/L12 [Neisseria sicca ATCC 29256]
 gi|269144582|gb|EEZ71000.1| ribosomal protein L7/L12 [Neisseria cinerea ATCC 14685]
 gi|284795632|gb|EFC50979.1| ribosomal protein L7/L12 [Neisseria subflava NJ9703]
 gi|298281210|gb|EFI22700.1| ribosomal protein L7/L12 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 123

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|238765328|ref|ZP_04626254.1| 50S ribosomal protein L7/L12 [Yersinia kristensenii ATCC 33638]
 gi|238696455|gb|EEP89246.1| 50S ribosomal protein L7/L12 [Yersinia kristensenii ATCC 33638]
          Length = 122

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (68%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     A  E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAA----EAVEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F +   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+
Sbjct: 57  NVVLASFGE--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKKSLEE 114

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 115 AGASVEIK 122


>gi|152977729|ref|YP_001343358.1| 50S ribosomal protein L7/L12 [Actinobacillus succinogenes 130Z]
 gi|171472909|sp|A6VKC6|RL7_ACTSZ RecName: Full=50S ribosomal protein L7/L12
 gi|150839452|gb|ABR73423.1| ribosomal protein L7/L12 [Actinobacillus succinogenes 130Z]
          Length = 122

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E ++S ++ E  EL   +E+++GVSA+   +  A   A   +AA EKTEF VVL  
Sbjct: 6   EQLIEAIASKSVSEIVELIAAMEEKFGVSAAVAAAAPAAGGA---AAAEEKTEFNVVLT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA E+KK LE+AGA VE
Sbjct: 62  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKGEAEELKKALEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|289209337|ref|YP_003461403.1| ribosomal protein L7/L12 [Thioalkalivibrio sp. K90mix]
 gi|288944968|gb|ADC72667.1| ribosomal protein L7/L12 [Thioalkalivibrio sp. K90mix]
          Length = 126

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+E + ++T++E  +L   +E+++GVSA+A V+     A    +AA+E K EF+VV+ 
Sbjct: 6   EDILEAIGNMTVLEIVDLISEMEEKFGVSAAAAVAAAPAAAGGGEAAAAEAKDEFDVVMS 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F +   K+ VIK VR +T LGLKEAKE+VE  P ++K G +KDEA +MK +LE+AGATV
Sbjct: 66  SFGE--NKVGVIKVVRGLTGLGLKEAKEMVEGVPATVKEGAAKDEAEKMKAELEEAGATV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|297587470|ref|ZP_06946114.1| ribosomal protein L7/L12 [Finegoldia magna ATCC 53516]
 gi|297574159|gb|EFH92879.1| ribosomal protein L7/L12 [Finegoldia magna ATCC 53516]
          Length = 123

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 90/124 (72%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +I+ I+E +  LT++E  EL ++ E+++GVSA+APV+V     A  G+AA EK+EF+V+L
Sbjct: 2   SIDEILEAVEGLTVLELNELVEKAEEKFGVSAAAPVAVAGAAPAAGGAAAEEKSEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K K  VIK V+ +T LGLK+AK +V+ APK++K G SK+EA E+K KLE+ GAT
Sbjct: 62  ASAGDAKMK--VIKAVKDLTGLGLKDAKAIVDEAPKAIKEGASKEEAEELKAKLEEVGAT 119

Query: 123 VELR 126
           +EL+
Sbjct: 120 IELK 123


>gi|42527923|ref|NP_973021.1| 50S ribosomal protein L7/L12 [Treponema denticola ATCC 35405]
 gi|81570127|sp|Q73JJ6|RL7_TREDE RecName: Full=50S ribosomal protein L7/L12
 gi|41818968|gb|AAS12940.1| ribosomal protein L7/L12 [Treponema denticola ATCC 35405]
 gi|325474852|gb|EGC78038.1| 50S ribosomal protein L7/L12 [Treponema denticola F0402]
          Length = 129

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/122 (55%), Positives = 88/122 (72%), Gaps = 1/122 (0%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +   T++E +EL K +E+++GV+A+APV+VVA  AA  G+A  EKTEF V LKG
Sbjct: 7   EQIIEAIGEKTILELSELIKAMEEKFGVTAAAPVAVVAGGAAGGGAAEEEKTEFTVTLKG 66

Query: 65  FDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             DP KKI VIKEVR  I  LGLKEAKELVE APK LK  +SK+EA ++K+ +  AG  V
Sbjct: 67  LSDPGKKIGVIKEVRNVIPGLGLKEAKELVEGAPKVLKEDVSKEEAAKIKEAITAAGGEV 126

Query: 124 EL 125
           E+
Sbjct: 127 EI 128


>gi|78044942|ref|YP_361129.1| 50S ribosomal protein L7/L12 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|109893754|sp|Q3A9Q5|RL7_CARHZ RecName: Full=50S ribosomal protein L7/L12
 gi|77997057|gb|ABB15956.1| ribosomal protein L7/L12 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 127

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 92/129 (71%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           MS ++ I+E + SLT++E AEL K  E+E+GVSA+APV+V A  AA A +AA    EKTE
Sbjct: 1   MSKVQEILEAVKSLTVLELAELVKAFEEEFGVSAAAPVAVAAAPAAGAAAAAPAQEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L       +K+ VIK VR IT LGLKE+K+LV+ APK +K  +SK +A  +K KLE
Sbjct: 61  FDVIL--VSPGAQKVNVIKVVREITGLGLKESKDLVDGAPKPVKEKVSKADAEAIKAKLE 118

Query: 118 DAGATVELR 126
           + GATVE++
Sbjct: 119 EVGATVEIK 127


>gi|39997955|ref|NP_953906.1| 50S ribosomal protein L7/L12 [Geobacter sulfurreducens PCA]
 gi|81701324|sp|Q748Y5|RL7_GEOSL RecName: Full=50S ribosomal protein L7/L12
 gi|39984900|gb|AAR36256.1| ribosomal protein L7/L12 [Geobacter sulfurreducens PCA]
 gi|298506896|gb|ADI85619.1| ribosomal protein L7/L12 [Geobacter sulfurreducens KN400]
          Length = 127

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 89/121 (73%), Gaps = 3/121 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLKGF 65
           ++  + ++T++E AEL K LE ++GVSA+APV+V A  A  A + A+ EKTEF+V+LK  
Sbjct: 9   VISFIENMTVLELAELVKELEDKFGVSAAAPVAVAAAAAPAAAAEAAEEKTEFDVILK-- 66

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                KI VIK VRA+T LGLKEAK+LV+ APK +K G+SK+EA E KK+L ++GA VE+
Sbjct: 67  SAGANKIGVIKVVRALTGLGLKEAKDLVDGAPKPVKNGVSKEEAEEAKKQLVESGAEVEI 126

Query: 126 R 126
           +
Sbjct: 127 K 127


>gi|295401930|ref|ZP_06811893.1| ribosomal protein L7/L12 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109251|ref|YP_003987567.1| ribosomal protein L7/L12 [Geobacillus sp. Y4.1MC1]
 gi|294976060|gb|EFG51675.1| ribosomal protein L7/L12 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214352|gb|ADP72956.1| ribosomal protein L7/L12 [Geobacillus sp. Y4.1MC1]
          Length = 122

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 90/122 (73%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA    AA+EKTEF+V+L  
Sbjct: 4   EQIIEAIKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGG-DAAAEKTEFDVILA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+LV++ PK LK G+SK+EA E+K KLE+ GA+VE
Sbjct: 62  -DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEGVSKEEAEEIKAKLEEVGASVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|257458179|ref|ZP_05623333.1| ribosomal protein L7/L12 [Treponema vincentii ATCC 35580]
 gi|257444473|gb|EEV19562.1| ribosomal protein L7/L12 [Treponema vincentii ATCC 35580]
          Length = 129

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 87/120 (72%), Gaps = 1/120 (0%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + + T++E +EL K +E+ +GV+A+APV+VVA  AA   +AA E+TEF V LKG
Sbjct: 7   EQIIEAIKAKTILELSELIKSMEEVFGVTAAAPVAVVAGGAAGGTAAAEEQTEFTVTLKG 66

Query: 65  FDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             DP KKI VIKEVR  +  LGLKEAKELVE APK LK  +SK+EA ++K+ +  AGA +
Sbjct: 67  LTDPSKKIGVIKEVRNVVAGLGLKEAKELVEGAPKVLKENVSKEEAQKIKEAMTAAGAEI 126


>gi|120553644|ref|YP_957995.1| 50S ribosomal protein L7/L12 [Marinobacter aquaeolei VT8]
 gi|166222181|sp|A1TYI9|RL7_MARAV RecName: Full=50S ribosomal protein L7/L12
 gi|120323493|gb|ABM17808.1| LSU ribosomal protein L12P [Marinobacter aquaeolei VT8]
          Length = 124

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++E  EL + +E+++ VSA+A V+     AA    AA EKTEF+VVL G
Sbjct: 6   DDILNAIAEMSVMEVVELVEAMEEKFNVSAAAAVAAAPAAAAAG-EAAEEKTEFDVVLTG 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             +  KK+ VIK VR +T LGLKEAKE+V+ AP ++K G SKDEA E KKKLE+AGA+VE
Sbjct: 65  AGE--KKVNVIKAVRELTGLGLKEAKEMVDGAPSTVKEGASKDEAEEAKKKLEEAGASVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|163755835|ref|ZP_02162953.1| 50S ribosomal protein L7/L12 [Kordia algicida OT-1]
 gi|161324356|gb|EDP95687.1| 50S ribosomal protein L7/L12 [Kordia algicida OT-1]
          Length = 124

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 82/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    V P A     A  E+TEF+V
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELADILKDEYGIEPAAAAVAVGPAAPGDADAGDEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLK+AK +V+SAP  +K G+SKDEA  +K  LE+AG
Sbjct: 61  ILKAA--GGSKLAVVKLVKELTGLGLKDAKGIVDSAPAPIKEGVSKDEAEGLKASLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|311693263|gb|ADP96136.1| ribosomal protein L7/L12 [marine bacterium HP15]
          Length = 125

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 89/126 (70%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E I+  ++ +++++   L + +E+++GVSA+A V+     A    +AA E+TEF+V
Sbjct: 3   LSN-EDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAAAPAAAGGGEAAAEEQTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL G    +KK+ VIK VR +T LGLKEAKE+V+SAP  +K   SKD+A E KKKLE+AG
Sbjct: 62  VLTG--PGEKKVNVIKAVRELTGLGLKEAKEMVDSAPSVIKEAASKDDAEEAKKKLEEAG 119

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 120 ASVELK 125


>gi|149376694|ref|ZP_01894453.1| ribosomal protein L7/L12 [Marinobacter algicola DG893]
 gi|149359067|gb|EDM47532.1| ribosomal protein L7/L12 [Marinobacter algicola DG893]
          Length = 125

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 89/126 (70%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E I+  ++ +++++   L + +E+++GVSA+A V+     A    +AA E+TEF+V
Sbjct: 3   LSN-EDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAAAPAAAGGEAAAAEEQTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL G    +KK+ VIK VR +T LGLKEAKE+V+SAP  +K   SKD+A E KKKLE+AG
Sbjct: 62  VLTG--PGEKKVNVIKAVRELTGLGLKEAKEMVDSAPSVIKEAASKDDAEEAKKKLEEAG 119

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 120 ASVELK 125


>gi|240948032|ref|ZP_04752449.1| 50S ribosomal protein L7/L12 [Actinobacillus minor NM305]
 gi|240297648|gb|EER48125.1| 50S ribosomal protein L7/L12 [Actinobacillus minor NM305]
          Length = 122

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E ++S ++ E  EL   +E+++GVSA+A V+      A   +AA EKTEF+VVL  
Sbjct: 6   EQLIEAIASKSVSEIVELIAAMEEKFGVSAAAAVAAAPAAGA---AAAEEKTEFDVVLA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 62  -DAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAEAEALKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|254516897|ref|ZP_05128955.1| ribosomal protein L7/L12 [gamma proteobacterium NOR5-3]
 gi|219674402|gb|EED30770.1| ribosomal protein L7/L12 [gamma proteobacterium NOR5-3]
          Length = 125

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++E  EL   +E+++GV+A+A V+     A +AG+AA E+TEF+V+L  
Sbjct: 6   DDILTAIAEMSVMEVVELIDAMEEKFGVTAAAAVAAAPAAAGDAGAAAEEQTEFDVMLTA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+ VIK VRA+T LGLKEAK LV+ AP ++K G SKDEA ++KK+LE+AG + E
Sbjct: 66  AGD--KKVNVIKVVRAVTGLGLKEAKGLVDGAPSAIKEGASKDEAEDIKKQLEEAGGSAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|156744230|ref|YP_001434359.1| 50S ribosomal protein L7/L12 [Roseiflexus castenholzii DSM 13941]
 gi|156235558|gb|ABU60341.1| ribosomal protein L7/L12 [Roseiflexus castenholzii DSM 13941]
          Length = 140

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/137 (45%), Positives = 84/137 (61%), Gaps = 16/137 (11%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA--------------AEAG 49
           +ES++  + +L ++E  EL K LE  WGV+A+APV  +  +               A A 
Sbjct: 6   VESVIASIEALNVLELVELKKELESRWGVTAAAPVMPMGGMVMPAAAAAPAAGDGGAAAA 65

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A  EKTEF+V+L        KI VIK VR +T+LGLKEAK+LVE APK +K G+SK+EA
Sbjct: 66  PAVEEKTEFDVILSAVGP--NKIQVIKAVRELTNLGLKEAKDLVEGAPKPVKEGVSKEEA 123

Query: 110 NEMKKKLEDAGATVELR 126
              K KL +AGATVE++
Sbjct: 124 EAAKAKLVEAGATVEIK 140


>gi|32307498|gb|AAP79154.1| ribosomal protein rpL12 [Bigelowiella natans]
          Length = 150

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 80/125 (64%), Gaps = 6/125 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTEF 58
           +  IVEKL +++LIEA++L K +E+ +GV ASA       +AA   +  +      K  F
Sbjct: 24  VSEIVEKLKTMSLIEASQLVKEIEETFGVDASAAAGGAVMMAAPGAAGGAAAEEEAKDSF 83

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+G DD K+ +A +K +R +T +GLKEAKE +   PK++K GLSKD+A E +K L +
Sbjct: 84  DVILEGVDDSKR-VAALKAIRGVTGVGLKEAKEFISGFPKAIKEGLSKDDAEEAQKSLAE 142

Query: 119 AGATV 123
           AG  V
Sbjct: 143 AGLKV 147


>gi|300742093|ref|ZP_07072114.1| ribosomal protein L7/L12 [Rothia dentocariosa M567]
 gi|311112011|ref|YP_003983233.1| ribosomal protein L7/L12 [Rothia dentocariosa ATCC 17931]
 gi|300381278|gb|EFJ77840.1| ribosomal protein L7/L12 [Rothia dentocariosa M567]
 gi|310943505|gb|ADP39799.1| ribosomal protein L7/L12 [Rothia dentocariosa ATCC 17931]
          Length = 125

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 89/124 (71%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +IE ++     L+L+E +E  K  E+E+ V+A+APV+VVA  A     AA EK+EF+V+L
Sbjct: 5   SIEELIAAFKELSLVEVSEFVKAFEEEFDVTAAAPVAVVAGGAGGG-DAAEEKSEFDVIL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +   D  KKIAVIKEVRA+T LGLKEAK+LV+ APK +  G SK++A + K++LE AGAT
Sbjct: 64  ESAGD--KKIAVIKEVRALTSLGLKEAKDLVDGAPKPILEGASKEDAEKAKEQLEGAGAT 121

Query: 123 VELR 126
           V L+
Sbjct: 122 VTLK 125


>gi|261854942|ref|YP_003262225.1| ribosomal protein L7/L12 [Halothiobacillus neapolitanus c2]
 gi|261835411|gb|ACX95178.1| ribosomal protein L7/L12 [Halothiobacillus neapolitanus c2]
          Length = 125

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S+++++E  +L   +E+++GVSA+A V+V  P AA   +A  EKTEF+VVLK 
Sbjct: 6   DDILEAISNMSVMEVVDLISAMEEKFGVSAAAAVAVAGPAAAGPAAAVEEKTEFDVVLKS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK VR +T LGLKEAK++VE AP ++K G S  +A  MK KL +AGA VE
Sbjct: 66  F--GANKVGVIKAVRELTGLGLKEAKDMVEGAPATIKEGASAADAEAMKAKLTEAGAEVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|152972844|ref|YP_001337990.1| 50S ribosomal protein L7/L12 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206576265|ref|YP_002241077.1| ribosomal protein L7/L12 [Klebsiella pneumoniae 342]
 gi|238892456|ref|YP_002917190.1| 50S ribosomal protein L7/L12 [Klebsiella pneumoniae NTUH-K2044]
 gi|288937722|ref|YP_003441781.1| ribosomal protein L7/L12 [Klebsiella variicola At-22]
 gi|290513230|ref|ZP_06552591.1| 50S ribosomal protein L7/L12 [Klebsiella sp. 1_1_55]
 gi|330005013|ref|ZP_08305084.1| ribosomal protein L7/L12 [Klebsiella sp. MS 92-3]
 gi|166222177|sp|A6TGN9|RL7_KLEP7 RecName: Full=50S ribosomal protein L7/L12
 gi|226733699|sp|B5XYF6|RL7_KLEP3 RecName: Full=50S ribosomal protein L7/L12
 gi|150957693|gb|ABR79723.1| 50S ribosomal protein L7/L12 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206565323|gb|ACI07099.1| ribosomal protein L7/L12 [Klebsiella pneumoniae 342]
 gi|238544772|dbj|BAH61123.1| 50S ribosomal protein L7/L12 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|288892431|gb|ADC60749.1| ribosomal protein L7/L12 [Klebsiella variicola At-22]
 gi|289774327|gb|EFD82334.1| 50S ribosomal protein L7/L12 [Klebsiella sp. 1_1_55]
 gi|328536455|gb|EGF62804.1| ribosomal protein L7/L12 [Klebsiella sp. MS 92-3]
          Length = 121

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|284039327|ref|YP_003389257.1| ribosomal protein L7/L12 [Spirosoma linguale DSM 74]
 gi|283818620|gb|ADB40458.1| ribosomal protein L7/L12 [Spirosoma linguale DSM 74]
          Length = 128

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV----SASAPVSVVAPVAAEAGSAASEKT 56
           M+++++  E+L SLT+ E  EL+  L+ E+G+    +A   V+     A +A  A +EKT
Sbjct: 1   MADLKAFAEQLVSLTVKEVNELATILKDEYGIEPAAAAPVMVAGGGAGAGDAAPAVAEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+VVLK       K+AV+K V+ +T LGLKEAKELV++APK +K G+SKDEA+ ++K+L
Sbjct: 61  SFDVVLKSA--GAAKLAVVKLVKDLTGLGLKEAKELVDTAPKPVKEGVSKDEADALRKQL 118

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 119 EEAGAEVEVK 128


>gi|157964205|ref|YP_001499029.1| 50S ribosomal protein L7/L12 [Rickettsia massiliae MTU5]
 gi|157843981|gb|ABV84482.1| 50S ribosomal protein L7/L12 [Rickettsia massiliae MTU5]
          Length = 142

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-AASEKTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV+V A  AA   +   +EKTEFE
Sbjct: 18  MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAAGAAAPAAETVAEKTEFE 77

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D K ++     V+ IT LGL EAK+LV+ APK +K+ + K EA+E+K KLE A
Sbjct: 78  VVLTAAGDKKVEVIK--VVKDITGLGLIEAKKLVDEAPKPIKSNMKKAEADEIKGKLEAA 135

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 136 GAKVELK 142


>gi|52783961|ref|YP_089790.1| 50S ribosomal protein L7/L12 [Bacillus licheniformis ATCC 14580]
 gi|161760691|ref|YP_077390.2| 50S ribosomal protein L7/L12 [Bacillus licheniformis ATCC 14580]
 gi|319649126|ref|ZP_08003334.1| 50S ribosomal protein L7/L12 [Bacillus sp. BT1B_CT2]
 gi|81609334|sp|Q65PB7|RL7_BACLD RecName: Full=50S ribosomal protein L7/L12
 gi|52346463|gb|AAU39097.1| RplL [Bacillus licheniformis ATCC 14580]
 gi|145902692|gb|AAU21752.2| ribosomal protein L12 (BL9) [Bacillus licheniformis ATCC 14580]
 gi|317388826|gb|EFV69645.1| 50S ribosomal protein L7/L12 [Bacillus sp. BT1B_CT2]
          Length = 123

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 84/124 (67%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   T++E  +L K +E+E+    +A   V     A AG AA EKTEF++VL
Sbjct: 4   NIEEIIASVKEATVLELNDLVKAIEEEF--GVTAAAPVAVAGGAAAGGAAEEKTEFDLVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G  D  +KI VIK VR IT LGLKEAKELV++ PK LK G++K+EA E+K KLE+ GA+
Sbjct: 62  AGAGD--QKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGAS 119

Query: 123 VELR 126
           VE++
Sbjct: 120 VEVK 123


>gi|288573178|ref|ZP_06391535.1| ribosomal protein L7/L12 [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568919|gb|EFC90476.1| ribosomal protein L7/L12 [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 124

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I++ +  ++++E +EL K LE ++GVSA+AP  ++A  AA A  AA E KTEF VVLK
Sbjct: 4   EDIIKAIEEMSVLELSELVKELEDKFGVSAAAPAMMMAAPAAGAAVAAEEEKTEFNVVLK 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +   +KI VIK VR IT LGLKEAKELV++  K++K G++KDEA  +KK+LE+ GATV
Sbjct: 64  --EAGSQKIKVIKVVREITGLGLKEAKELVDNPGKAIKEGVAKDEAETVKKQLEEVGATV 121

Query: 124 EL 125
           EL
Sbjct: 122 EL 123


>gi|297567058|ref|YP_003686030.1| 50S ribosomal protein L7/L12 [Meiothermus silvanus DSM 9946]
 gi|296851507|gb|ADH64522.1| ribosomal protein L7/L12 [Meiothermus silvanus DSM 9946]
          Length = 126

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 5/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
           +I +I ++LS+ T++E  +L   L++EWGV+A+APV+V A   A A +A +  EKTEF+V
Sbjct: 4   DIAAIKQQLSNATVLELKQLIDELKEEWGVTAAAPVAVAAVPGAAAAAAPAVEEKTEFDV 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    K+ VIKEVRAIT LGLKEAK+L E     +K G+SK+EA ++KK+LEDAG
Sbjct: 64  VLK--EAGANKLNVIKEVRAITGLGLKEAKDLTEQGG-VIKEGVSKEEAEKIKKQLEDAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|296100614|ref|YP_003610760.1| 50S ribosomal protein L7/L12 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055073|gb|ADF59811.1| 50S ribosomal protein L7/L12 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 122

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A  AA    AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPAA---DAAEEKTEFDVILKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 63  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|254445976|ref|ZP_05059452.1| ribosomal protein L7/L12 [Verrucomicrobiae bacterium DG1235]
 gi|198260284|gb|EDY84592.1| ribosomal protein L7/L12 [Verrucomicrobiae bacterium DG1235]
          Length = 128

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/130 (53%), Positives = 94/130 (72%), Gaps = 6/130 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKT 56
           M++I  E ++E LS  ++++ A L K LE++WGVSA+APV+V A   A   +AA   EKT
Sbjct: 1   MADITKEDVIEWLSGQSVLDIAGLVKDLEEKWGVSAAAPVAVAAAPGAGGDAAAPAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L    D  KKI  IKEVR+IT LGLKEAK+LVE APK +K G++K+EA E+K KL
Sbjct: 61  EFDVILVAAGD--KKINAIKEVRSITGLGLKEAKDLVEGAPKPVKEGVTKEEAEEIKSKL 118

Query: 117 EDAGATVELR 126
           E AGA VE++
Sbjct: 119 EAAGAKVEVK 128


>gi|169830048|ref|YP_001700206.1| 50S ribosomal protein L7/L12 [Lysinibacillus sphaericus C3-41]
 gi|254806380|sp|B1HMZ8|RL7_LYSSC RecName: Full=50S ribosomal protein L7/L12
 gi|168994536|gb|ACA42076.1| 50S ribosomal protein L7/L12 (MA1/MA2) [Lysinibacillus sphaericus
           C3-41]
          Length = 119

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E  +L K +E+E+GV+A+AP      V A   +AA EKTEF+VVL
Sbjct: 2   NKEQILEAIKAMTVLELNDLVKAIEEEFGVTAAAP----VAVVAGGAAAAEEKTEFDVVL 57

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR IT LGLKEAKE+V++APK+LK G+SKDEA E+K KLE+ GA+
Sbjct: 58  ASA--GAEKIKVIKVVREITGLGLKEAKEVVDNAPKALKEGVSKDEAEEIKTKLEEVGAS 115

Query: 123 VELR 126
           VE++
Sbjct: 116 VEVK 119


>gi|222529517|ref|YP_002573399.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456364|gb|ACM60626.1| ribosomal protein L7/L12 [Caldicellulosiruptor bescii DSM 6725]
          Length = 129

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 68/126 (53%), Positives = 93/126 (73%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEV 60
           ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A SAA    EKTEF V
Sbjct: 6   VQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQSAAPAAEEKTEFNV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D    KI VIK VR IT LGLKEAK+LV+SAPK +K  +SKDEA ++KKKLE+ G
Sbjct: 66  ILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDSAPKPIKENVSKDEAEQIKKKLEEVG 123

Query: 121 ATVELR 126
           A VEL+
Sbjct: 124 AKVELK 129


>gi|291533630|emb|CBL06743.1| LSU ribosomal protein L12P [Megamonas hypermegale ART12/1]
          Length = 122

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E +EL K +E+++GVSA+APV+V A  AA   +AA EKTEF+V+L  
Sbjct: 4   EEIMQAIEEMTVLELSELVKAMEEKFGVSAAAPVAVAAAPAAGG-AAAEEKTEFDVILAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VR +T LGLKEAK LV+ AP  +K G SK++A  +K KLE+AGATVE
Sbjct: 63  AGD--KKINVIKVVREVTGLGLKEAKALVDGAPAPVKEGASKEDAEALKAKLEEAGATVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|157147220|ref|YP_001454539.1| 50S ribosomal protein L7/L12 [Citrobacter koseri ATCC BAA-895]
 gi|283787341|ref|YP_003367206.1| 50S ribosomal subunit protein L7/L12 [Citrobacter rodentium ICC168]
 gi|166222156|sp|A8AKU0|RL7_CITK8 RecName: Full=50S ribosomal protein L7/L12
 gi|157084425|gb|ABV14103.1| hypothetical protein CKO_03003 [Citrobacter koseri ATCC BAA-895]
 gi|282950795|emb|CBG90471.1| 50S ribosomal subunit protein L7/L12 [Citrobacter rodentium ICC168]
          Length = 121

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|225423641|ref|XP_002275461.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|225467512|ref|XP_002268912.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 206

 Score = 84.7 bits (208), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/137 (43%), Positives = 87/137 (63%), Gaps = 14/137 (10%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP--VAAEAGS---AAS--- 53
           + +  +V++++ LTL+E AELS  L K+ G+     V+++ P  VAA +G    AAS   
Sbjct: 70  ARVFRLVDEIAGLTLVEVAELSSILRKKLGMKEPPVVAIMKPGAVAAVSGGGMKAASAAK 129

Query: 54  -----EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
                EKT FE+ L+ ++    KI +IKEVR+ TDLGLKEAK+LVE AP  LK G+SK+E
Sbjct: 130 EEKKPEKTVFELKLESYEA-ASKIKIIKEVRSFTDLGLKEAKDLVEKAPSVLKAGVSKEE 188

Query: 109 ANEMKKKLEDAGATVEL 125
             ++ +KL+  GA V L
Sbjct: 189 GEQLVEKLKALGAKVVL 205


>gi|289551660|ref|YP_003472564.1| LSU ribosomal protein L7/L12 (L23e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659119|ref|ZP_07911984.1| ribosomal protein L7/L12 [Staphylococcus lugdunensis M23590]
 gi|289181191|gb|ADC88436.1| LSU ribosomal protein L7/L12 (L23e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495843|gb|EFU84173.1| ribosomal protein L7/L12 [Staphylococcus lugdunensis M23590]
          Length = 122

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+           AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAAGAAGGG--DAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L      K  I V+K V+  T LGLK+AKELV+ APK +K GL+KDEA ++K++LE+ G
Sbjct: 59  ELTSAGSSK--IKVVKAVKEATGLGLKDAKELVDGAPKVIKEGLAKDEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|182418861|ref|ZP_02950119.1| ribosomal protein L7/L12 [Clostridium butyricum 5521]
 gi|237666389|ref|ZP_04526374.1| ribosomal protein L7/L12 [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182377286|gb|EDT74853.1| ribosomal protein L7/L12 [Clostridium butyricum 5521]
 gi|237657588|gb|EEP55143.1| ribosomal protein L7/L12 [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 121

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +++++  EL K  E+E+    SA  +VVA  A   G+A  EKTEF+VVL  
Sbjct: 4   EDIIQAIKEMSVLDLNELVKACEEEF--GVSAAAAVVAGGAVAGGAAGEEKTEFDVVLAN 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   KI VIK VR IT LGLKEAKE+V+ APK+LK G+SKDEA +MK KL + GATVE
Sbjct: 62  AGD--NKIKVIKAVREITGLGLKEAKEIVDGAPKTLKEGVSKDEAEDMKAKLAEVGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|308272987|emb|CBX29591.1| 50S ribosomal protein L7/L12 [uncultured Desulfobacterium sp.]
          Length = 127

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 93/129 (72%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG-SAASEKTE 57
           MS+I  E ++E ++++++++ +EL K LE ++GVSA+APV++VA     A  S   E+TE
Sbjct: 1   MSDITKEDVIEFIATMSVLDLSELVKELEDKFGVSAAAPVAMVAAAGPAAAESQPEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+L    D  KKI +IKEVRAIT LGLKEAK LV+  PK +K  +SK+EA ++K +LE
Sbjct: 61  FSVILLSHGD--KKIQIIKEVRAITGLGLKEAKTLVDEIPKPVKEAISKEEAEKIKAQLE 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAQVEIK 127


>gi|239993451|ref|ZP_04713975.1| 50S ribosomal protein L7/L12 [Alteromonas macleodii ATCC 27126]
 gi|226733634|sp|B4RRP7|RL7_ALTMD RecName: Full=50S ribosomal protein L7/L12
          Length = 125

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ + ++E  EL +  E+++ VSA+A V+V  P A    +AA EKTEF+VV+  
Sbjct: 6   EDILNAIAEMPVMELVELIEAAEEKFNVSAAAAVAVAGPAAGGDAAAAEEKTEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAKE+VESAPK++K G+SKDEA  +KK+LE+AGA VE
Sbjct: 66  FGG--NKVAVIKAVRGATGLGLKEAKEVVESAPKAIKEGVSKDEAEALKKELEEAGAEVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|118602789|ref|YP_904004.1| 50S ribosomal protein L7/L12 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166222205|sp|A1AX76|RL7_RUTMC RecName: Full=50S ribosomal protein L7/L12
 gi|118567728|gb|ABL02533.1| LSU ribosomal protein L12P [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 125

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ ++++   EL   +E+++GVSA+   +              EK EF+V+L  
Sbjct: 7   EDILNAIADMSVMNVVELVSAMEEKFGVSAAPVAAPPVVADT-IDDVVVEKDEFDVMLTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   KKK+AVIK  R+IT LGLKEAK++VESAP  +K G SK EA +++K+LE+AGA+VE
Sbjct: 66  F--GKKKVAVIKMARSITGLGLKEAKDMVESAPVVIKEGASKVEAEDIQKQLEEAGASVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|258512680|ref|YP_003186114.1| 50S ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479406|gb|ACV59725.1| ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 123

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 84/120 (70%), Gaps = 2/120 (1%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I+E + ++T++E  EL K +E+E+GV+A+APV+          +A +E+TEF+V+L    
Sbjct: 6   ILEAVKNMTVLELNELVKAIEEEFGVTAAAPVAFAGAAPGAGEAAQAEQTEFDVILA--S 63

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
               KI VIK VR IT LGLKEAKELV+ APK +K  +SK+EA  +K KLE+AGA+VE++
Sbjct: 64  AGASKINVIKVVREITGLGLKEAKELVDGAPKPIKEKVSKEEAESIKAKLEEAGASVEIK 123


>gi|327399531|ref|YP_004340400.1| 50S ribosomal protein L7/L12 [Hippea maritima DSM 10411]
 gi|327182160|gb|AEA34341.1| 50S ribosomal protein L7/L12 [Hippea maritima DSM 10411]
          Length = 129

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 88/125 (70%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E ++  + ++T++E AE  K LE ++GVSA+AP++ VA  AA A    +   EKTEF+VV
Sbjct: 7   EDVIAFIENMTVVELAEFVKELEDKFGVSAAAPIAAVAAAAAPAAGGEAAAEEKTEFDVV 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D  KKI VIK VR IT LGLKEAK LV+SAPK++K  +SK+EA ++K KLE+ GA
Sbjct: 67  LNKAGD--KKIQVIKVVREITGLGLKEAKALVDSAPKAVKEKVSKEEAEQIKAKLEEVGA 124

Query: 122 TVELR 126
            +E++
Sbjct: 125 EIEIK 129


>gi|299541917|ref|ZP_07052240.1| 50S ribosomal protein L7/L12 [Lysinibacillus fusiformis ZC1]
 gi|298725655|gb|EFI66296.1| 50S ribosomal protein L7/L12 [Lysinibacillus fusiformis ZC1]
          Length = 119

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E  +L K +E+E+GV+A+AP      V A   +AA EKTEF+VVL
Sbjct: 2   NKEQILEAIKAMTVLELNDLVKAIEEEFGVTAAAP----VAVVAGGAAAAEEKTEFDVVL 57

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR IT LGLKEAKE+V++APK+LK G+SKDEA E+K KLE+ GA+
Sbjct: 58  ASA--GAEKIKVIKVVREITGLGLKEAKEVVDNAPKALKEGVSKDEAEEIKAKLEEVGAS 115

Query: 123 VELR 126
           VE++
Sbjct: 116 VEVK 119


>gi|291295560|ref|YP_003506958.1| 50S ribosomal protein L7/L12 [Meiothermus ruber DSM 1279]
 gi|290470519|gb|ADD27938.1| ribosomal protein L7/L12 [Meiothermus ruber DSM 1279]
          Length = 126

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 5/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
           +I +I  +LSS T++E  +L   L++EWGV+A+APV+V  P AA   +A +  EKTEF+V
Sbjct: 4   DIAAIKAQLSSATVLELKQLIDELKEEWGVTAAAPVAVAVPGAAAGAAAPAAEEKTEFDV 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D   +K+ VIKE+RAIT LGLKEAK+L E     +K G+SK+EA ++KK+LEDAG
Sbjct: 64  ILK--DAGAQKLNVIKELRAITGLGLKEAKDLAEQGG-PVKEGVSKEEAEKIKKQLEDAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|298531093|ref|ZP_07018494.1| ribosomal protein L7/L12 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509116|gb|EFI33021.1| ribosomal protein L7/L12 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 130

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 92/132 (69%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           MS+I  E +++ +S++T++E +E  K LE ++GVSA+APV+ +A   A  G  A+     
Sbjct: 1   MSDITKEQVIDFISNMTVLELSEFIKELEDKFGVSAAAPVAAMAAAPAAGGGEAAAEEEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVLK  D    KI VIK VRA+T+LGLKEAK  V+  P  +K  +SKD+A E KK
Sbjct: 61  QTEFDVVLK--DVGSNKIGVIKAVRALTNLGLKEAKAKVDELPSPIKEAVSKDDAAEAKK 118

Query: 115 KLEDAGATVELR 126
           +LE+AGATVE++
Sbjct: 119 QLEEAGATVEVK 130


>gi|329118713|ref|ZP_08247413.1| 50S ribosomal protein L7/L12 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465148|gb|EGF11433.1| 50S ribosomal protein L7/L12 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 123

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA   A   +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAAGPAAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRA+T LGLKEAK+LV+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAVTGLGLKEAKDLVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|148657435|ref|YP_001277640.1| 50S ribosomal protein L7/L12 [Roseiflexus sp. RS-1]
 gi|148569545|gb|ABQ91690.1| LSU ribosomal protein L12P [Roseiflexus sp. RS-1]
          Length = 140

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/139 (43%), Positives = 85/139 (61%), Gaps = 16/139 (11%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA--------------AE 47
           + +E+++  + +L ++E  EL K LE  WGV+A+APV  +  +               A 
Sbjct: 4   AKVEAVIASIEALNVLELVELKKELESRWGVTAAAPVMPMGGMVMPAAAAAPAGGDGAAA 63

Query: 48  AGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
           A  A  EKTEF+V+L        KI VIK VR +T+LGLKEAK+LVE APK +K G+SK+
Sbjct: 64  AAPAVEEKTEFDVILSAIGP--NKIQVIKAVRELTNLGLKEAKDLVEGAPKPVKEGVSKE 121

Query: 108 EANEMKKKLEDAGATVELR 126
           EA   K KL +AGATVE++
Sbjct: 122 EAEAAKAKLVEAGATVEIK 140


>gi|322834822|ref|YP_004214849.1| ribosomal protein L7/L12 [Rahnella sp. Y9602]
 gi|321170023|gb|ADW75722.1| ribosomal protein L7/L12 [Rahnella sp. Y9602]
          Length = 121

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +++L+++E  EL   +E+++GVSA+A V+  A  A     A  EKTEF+VVL  
Sbjct: 6   EQIIEGVAALSVMEIVELISAMEEKFGVSAAAAVAGPAAAA----EAVEEKTEFDVVLAA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA+VE
Sbjct: 62  VG--ANKVAVIKAVRTATGLGLKEAKDLVESAPAALKEGISKDDAEALKKSLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|32265861|ref|NP_859893.1| 50S ribosomal protein L7/L12 [Helicobacter hepaticus ATCC 51449]
 gi|81666346|sp|Q7VJ81|RL7_HELHP RecName: Full=50S ribosomal protein L7/L12
 gi|32261910|gb|AAP76959.1| ribosomal protein L7/L12 [Helicobacter hepaticus ATCC 51449]
          Length = 126

 Score = 84.3 bits (207), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E +++ + +L+++E +EL K  E+++GVSA AP  V   VA  AG  A+  EKT+F VVL
Sbjct: 6   EEVLDYIGNLSVLELSELVKAFEEKFGVSA-APTVVAGAVAGGAGGGAAAEEKTDFNVVL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIK VR IT LGLKEAK+  E  P +LK G+SK++A   KKKLE+AGA 
Sbjct: 65  --VDAGANKINVIKAVREITGLGLKEAKDATEQTPSTLKEGVSKEDAENFKKKLEEAGAK 122

Query: 123 VELR 126
           VE++
Sbjct: 123 VEIK 126


>gi|325133044|gb|EGC55716.1| ribosomal protein L7/L12 [Neisseria meningitidis M6190]
 gi|325139023|gb|EGC61569.1| ribosomal protein L7/L12 [Neisseria meningitidis ES14902]
          Length = 123

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A      A EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAVDAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|15676059|ref|NP_273189.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis MC58]
 gi|121634008|ref|YP_974253.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis FAM18]
 gi|161870924|ref|YP_001600104.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis 053442]
 gi|218767182|ref|YP_002341694.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis Z2491]
 gi|254805824|ref|YP_003084045.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha14]
 gi|304388931|ref|ZP_07370978.1| ribosomal protein L7/L12 [Neisseria meningitidis ATCC 13091]
 gi|60393725|sp|P0A0X0|RL7_NEIMA RecName: Full=50S ribosomal protein L7/L12
 gi|60393726|sp|P0A0X1|RL7_NEIMB RecName: Full=50S ribosomal protein L7/L12
 gi|166222184|sp|A1KRG5|RL7_NEIMF RecName: Full=50S ribosomal protein L7/L12
 gi|189043002|sp|A9M3X5|RL7_NEIM0 RecName: Full=50S ribosomal protein L7/L12
 gi|7225348|gb|AAF40590.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis MC58]
 gi|120865714|emb|CAM09441.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis FAM18]
 gi|121051190|emb|CAM07461.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis Z2491]
 gi|161596477|gb|ABX74137.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis 053442]
 gi|254669366|emb|CBA08475.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha14]
 gi|254671129|emb|CBA08147.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha153]
 gi|254672708|emb|CBA06635.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha275]
 gi|261391668|emb|CAX49116.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis 8013]
 gi|304337065|gb|EFM03252.1| ribosomal protein L7/L12 [Neisseria meningitidis ATCC 13091]
 gi|308388348|gb|ADO30668.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha710]
 gi|316985973|gb|EFV64912.1| ribosomal protein L7/L12 [Neisseria meningitidis H44/76]
 gi|319411387|emb|CBY91798.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis WUE 2594]
 gi|325127124|gb|EGC50078.1| ribosomal protein L7/L12 [Neisseria meningitidis N1568]
 gi|325131072|gb|EGC53795.1| ribosomal protein L7/L12 [Neisseria meningitidis OX99.30304]
 gi|325135136|gb|EGC57762.1| ribosomal protein L7/L12 [Neisseria meningitidis M13399]
 gi|325137189|gb|EGC59784.1| ribosomal protein L7/L12 [Neisseria meningitidis M0579]
 gi|325141145|gb|EGC63645.1| ribosomal protein L7/L12 [Neisseria meningitidis CU385]
 gi|325143223|gb|EGC65562.1| ribosomal protein L7/L12 [Neisseria meningitidis 961-5945]
 gi|325145328|gb|EGC67605.1| ribosomal protein L7/L12 [Neisseria meningitidis M01-240013]
 gi|325197419|gb|ADY92875.1| ribosomal protein L7/L12 [Neisseria meningitidis G2136]
 gi|325199344|gb|ADY94799.1| ribosomal protein L7/L12 [Neisseria meningitidis H44/76]
 gi|325203035|gb|ADY98489.1| ribosomal protein L7/L12 [Neisseria meningitidis M01-240149]
 gi|325203250|gb|ADY98703.1| ribosomal protein L7/L12 [Neisseria meningitidis M01-240355]
 gi|325205223|gb|ADZ00676.1| ribosomal protein L7/L12 [Neisseria meningitidis M04-240196]
 gi|325207166|gb|ADZ02618.1| ribosomal protein L7/L12 [Neisseria meningitidis NZ-05/33]
          Length = 123

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    + A EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAADAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|86149002|ref|ZP_01067234.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88597039|ref|ZP_01100275.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218562132|ref|YP_002343911.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|14195178|sp|Q9PI32|RL7_CAMJE RecName: Full=50S ribosomal protein L7/L12
 gi|85840360|gb|EAQ57617.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88190728|gb|EAQ94701.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359838|emb|CAL34625.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|284925744|gb|ADC28096.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|315928194|gb|EFV07511.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315929769|gb|EFV08939.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 305]
          Length = 125

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +     VA  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAVAGGAVAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|52694908|gb|AAU85605.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 60/79 (75%), Gaps = 3/79 (3%)

Query: 49  GSAASE-KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
           GS  SE +TEF+V+L  F D K  I VIKEVR+IT LGL EAK LVESAPK++K GLSK 
Sbjct: 48  GSTDSEEQTEFDVILMSFGDSK--INVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKS 105

Query: 108 EANEMKKKLEDAGATVELR 126
           +A E+KKKLE  GA VE++
Sbjct: 106 DAEELKKKLEAVGAKVEVK 124


>gi|322513227|ref|ZP_08066353.1| 50S ribosomal protein L7/L12 [Actinobacillus ureae ATCC 25976]
 gi|322121003|gb|EFX92844.1| 50S ribosomal protein L7/L12 [Actinobacillus ureae ATCC 25976]
          Length = 121

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A V+  AP A    +AA EKTEF+V+L  
Sbjct: 6   EQIIEAIASKSVSEIVELITAMEEKFGVSAAAAVAAAAPAA----AAAEEKTEFDVILA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 61  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKGEAEALKKELEEAGAKVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|283955899|ref|ZP_06373389.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792559|gb|EFC31338.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 1336]
          Length = 125

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 88/123 (71%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    A    +AA+E KTEF++VL 
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAATGGAAAAAEEKTEFDIVLT 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA V
Sbjct: 65  --DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|86151568|ref|ZP_01069782.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|121613176|ref|YP_001000184.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148925856|ref|ZP_01809543.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157414770|ref|YP_001482026.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167005142|ref|ZP_02270900.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|315124020|ref|YP_004066024.1| hypothetical protein ICDCCJ07001_440 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|166222154|sp|A1VYJ3|RL7_CAMJJ RecName: Full=50S ribosomal protein L7/L12
 gi|172047074|sp|A8FKR2|RL7_CAMJ8 RecName: Full=50S ribosomal protein L7/L12
 gi|85841197|gb|EAQ58445.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|87250007|gb|EAQ72965.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|107784840|gb|ABF83911.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. doylei]
 gi|145844842|gb|EDK21946.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157385734|gb|ABV52049.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747409|gb|ADN90679.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           M1]
 gi|315017742|gb|ADT65835.1| hypothetical protein ICDCCJ07001_440 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315931082|gb|EFV10056.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 327]
          Length = 125

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/123 (53%), Positives = 89/123 (72%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA APV V    AA   +AA+E KTEF++VL 
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSA-APVMVAGGAAAGGAAAAAEEKTEFDIVLT 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA V
Sbjct: 65  --DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|254361435|ref|ZP_04977575.1| ribosomal protein L7/L12 [Mannheimia haemolytica PHL213]
 gi|261491933|ref|ZP_05988510.1| ribosomal protein L7/L12 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261496263|ref|ZP_05992668.1| ribosomal protein L7/L12 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|153092945|gb|EDN73971.1| ribosomal protein L7/L12 [Mannheimia haemolytica PHL213]
 gi|261308094|gb|EEY09392.1| ribosomal protein L7/L12 [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261312400|gb|EEY13526.1| ribosomal protein L7/L12 [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 122

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A V+      A   +AA EKTEF+VVL  
Sbjct: 6   EQIIEAIASKSVSEIVELITAMEEKFGVSAAAAVAAAPAAGA---AAAEEKTEFDVVLA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 62  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKAEAEALKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|242309993|ref|ZP_04809148.1| 50S ribosomal protein L7/L12 [Helicobacter pullorum MIT 98-5489]
 gi|239523290|gb|EEQ63156.1| 50S ribosomal protein L7/L12 [Helicobacter pullorum MIT 98-5489]
          Length = 125

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+  V     VA  A     EKTEF+++L  
Sbjct: 6   EEVLEYIGNLSVMELSELVKAFEEKFGVSAAPTVVAGGAVAGGAAGGGEEKTEFDIILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR +T LGLKEAK+ VE  P ++K G+ K++A  +K K E+AGA VE
Sbjct: 65  -DSGDKKINVIKVVREVTGLGLKEAKDAVEKTPFTVKEGVKKEDAEAIKAKFEEAGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|7524913|ref|NP_045915.1| ribosomal protein L12 [Chlorella vulgaris]
 gi|3024542|sp|P56345|RK12_CHLVU RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|2224507|dbj|BAA57991.1| 50S ribosomal protein L12 [Chlorella vulgaris]
          Length = 131

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 78/124 (62%), Gaps = 6/124 (4%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----VVAPVAAEAGSAASEKTEFEVV 61
           I++ L S+TL+EAAEL  ++E+ +GV ASAPV              A     EKT F+V+
Sbjct: 8   ILDILKSITLLEAAELVSQIEETFGVDASAPVGGGFMAAPGGAGTAAAEIVEEKTTFDVI 67

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           ++      K++ V+K VR +T L LKEAKE + S PK ++ G+SKD+A   KK+LEDAGA
Sbjct: 68  IEDVA-SDKRVPVLKVVRNLTSLDLKEAKEAITSLPKVIQQGVSKDDAEASKKQLEDAGA 126

Query: 122 TVEL 125
            V++
Sbjct: 127 KVKI 130


>gi|220904900|ref|YP_002480212.1| ribosomal protein L7/L12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254806369|sp|B8J1A7|RL7_DESDA RecName: Full=50S ribosomal protein L7/L12
 gi|219869199|gb|ACL49534.1| ribosomal protein L7/L12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 128

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 88/125 (70%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E +VE +S++T++E +E  K LE+++GVSA+AP + +   A  AG AA    EKTEF+V+
Sbjct: 6   EEVVEFISNMTVLELSEFIKELEEKFGVSAAAPAAAMMVAAPAAGGAADAAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +    KI VIK VRA+T LGLKEAKE V+  P +LK  +SK+EA + KK+L +AGA
Sbjct: 66  LK--EAGANKIGVIKVVRALTSLGLKEAKEKVDGCPSTLKEAVSKEEAEDAKKQLTEAGA 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 VVEVK 128


>gi|330444701|ref|YP_004377687.1| 50S ribosomal protein L7/L12 [Chlamydophila pecorum E58]
 gi|328807811|gb|AEB41984.1| ribosomal protein L7/L12 [Chlamydophila pecorum E58]
          Length = 131

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFEV 60
           ++E++VE LS+LT++E ++L K LE++W V+A+APV     A  AA   +A++E TEF V
Sbjct: 5   SLETLVETLSNLTVLELSQLKKLLEEKWDVTAAAPVMAIAGAGAAAGGDAASAEPTEFAV 64

Query: 61  VLKGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +L+  D P  KKI V+K VR IT L LKEAKE+ E  PK++K   SK +A E  KKL++A
Sbjct: 65  ILE--DVPADKKIGVLKVVREITGLALKEAKEMTEGLPKTVKEKTSKLDAEETVKKLQEA 122

Query: 120 GA 121
           GA
Sbjct: 123 GA 124


>gi|270160337|ref|ZP_06188990.1| ribosomal protein L7/L12 [Legionella longbeachae D-4968]
 gi|289163822|ref|YP_003453960.1| 50S ribosomal subunit protein L7/L12 [Legionella longbeachae
           NSW150]
 gi|269987149|gb|EEZ93407.1| ribosomal protein L7/L12 [Legionella longbeachae D-4968]
 gi|288856995|emb|CBJ10809.1| 50S ribosomal subunit protein L7/L12 [Legionella longbeachae
           NSW150]
          Length = 124

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 86/120 (71%), Gaps = 3/120 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I+E +++++++E  EL + +E+++ VSA+A    VA  AA A +A  E+TEF VV+  F 
Sbjct: 8   ILETIANMSVMEVVELIEAMEEKFNVSAAAAAVAVAAPAAAA-AAVEEQTEFTVVMTSF- 65

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
               K+ VIK VR IT LGLKEAK+LVE AP ++K  +SKDEA  +KK+LE+AGA+VE++
Sbjct: 66  -GANKVNVIKAVRGITGLGLKEAKDLVEGAPSTIKEAVSKDEAANIKKELEEAGASVEVK 124


>gi|126654236|ref|ZP_01726030.1| 50S ribosomal protein L7/L12 [Bacillus sp. B14905]
 gi|126589294|gb|EAZ83451.1| 50S ribosomal protein L7/L12 [Bacillus sp. B14905]
          Length = 119

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E  +L K +E+E+GV+A+AP      V A   +AA EKTEF+VVL
Sbjct: 2   NKEQILEAIKAMTVLELNDLVKAIEEEFGVTAAAP----VAVVAGGAAAAEEKTEFDVVL 57

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR IT LGLKEAKE+V++APK+LK G+SKDEA ++K KLE+ GA+
Sbjct: 58  ASA--GAEKIKVIKVVREITGLGLKEAKEVVDNAPKALKEGVSKDEAEQIKTKLEEVGAS 115

Query: 123 VELR 126
           VE++
Sbjct: 116 VEVK 119


>gi|93007002|ref|YP_581439.1| 50S ribosomal protein L7/L12 [Psychrobacter cryohalolentis K5]
 gi|109893788|sp|Q1Q8P8|RL7_PSYCK RecName: Full=50S ribosomal protein L7/L12
 gi|92394680|gb|ABE75955.1| LSU ribosomal protein L12P [Psychrobacter cryohalolentis K5]
          Length = 123

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++  ++ +++++  EL   +E+++GV+A+   +  A   A   +AA EK EF+VVL  
Sbjct: 6   DDVLNAIAEMSVMDIVELISAMEEKFGVTAAVAAAPAAAGPAA--AAAEEKDEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F +  KK+ VIK VR  T LGLKEAK+LVESAP  +K G++K EA E+KKKLE+AGATVE
Sbjct: 64  FGE--KKVGVIKAVREATGLGLKEAKDLVESAPAPIKEGVNKAEAEELKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|320540635|ref|ZP_08040285.1| 50S ribosomal subunit protein L7/L12 [Serratia symbiotica str.
           Tucson]
 gi|320029566|gb|EFW11595.1| 50S ribosomal subunit protein L7/L12 [Serratia symbiotica str.
           Tucson]
          Length = 121

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A      A EKTEF+VVL  
Sbjct: 6   DQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGPA----EVAEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK G+SKD+A+ +KK LE+AGA+VE
Sbjct: 62  V--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGISKDDADALKKSLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|118579111|ref|YP_900361.1| 50S ribosomal protein L7/L12 [Pelobacter propionicus DSM 2379]
 gi|166222190|sp|A1ALT3|RL7_PELPD RecName: Full=50S ribosomal protein L7/L12
 gi|118501821|gb|ABK98303.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Pelobacter
           propionicus DSM 2379]
          Length = 127

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 92/123 (74%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           + ++E +  ++++E +EL K LE+++GVSA+APV+V A   A A +AA+E KTEF+V+LK
Sbjct: 7   QDVIEYIEKMSVLELSELVKELEEKFGVSAAAPVAVAAAGPATADAAAAEEKTEFDVILK 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+LV+ AP ++KTG+SK EA + +K+L +AGA V
Sbjct: 67  AA--GANKINVIKVVRALTSLGLKEAKDLVDGAPGAVKTGVSKQEAEDAQKQLVEAGAEV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|237749508|ref|ZP_04579988.1| large subunit ribosomal protein L7/L12 [Oxalobacter formigenes
           OXCC13]
 gi|229380870|gb|EEO30961.1| large subunit ribosomal protein L7/L12 [Oxalobacter formigenes
           OXCC13]
          Length = 126

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+E + +++++E  +L K  E+++GVSA+A        A  AG AA+E +TEF +VL 
Sbjct: 6   EDILEAVGAMSVMELNDLVKAFEEKFGVSAAAMAVAGPAGAGAAGGAAAEEQTEFTIVLA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K++VIK VR IT LGLKEAK++V+SAPK +K G+SK +A E KKKLE+AGA V
Sbjct: 66  EFG--ANKVSVIKAVREITGLGLKEAKDMVDSAPKPIKEGVSKADAEEAKKKLEEAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|297618394|ref|YP_003703553.1| ribosomal protein L7/L12 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146231|gb|ADI02988.1| ribosomal protein L7/L12 [Syntrophothermus lipocalidus DSM 12680]
          Length = 126

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 87/128 (67%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS--ASAPVSVVAPVAAEAGSAASEKTEF 58
           MS ++ ++E + ++T++E +EL K LE+E+GVS  A   V+    VAA    A  E+TEF
Sbjct: 1   MSRVQEVIEIIKNMTVLELSELVKALEEEFGVSAAAPVAVAAGPAVAAAPAEAEEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L    D  KK+ VIK VR +T LGLKE+K LV+ APK +K  +SK+EA  +K K+E+
Sbjct: 61  DVILTSSGD--KKVNVIKVVRELTGLGLKESKALVDEAPKPIKEKVSKEEAEAIKAKIEE 118

Query: 119 AGATVELR 126
           AG TVE++
Sbjct: 119 AGGTVEIK 126


>gi|188532313|ref|YP_001906110.1| 50S ribosomal protein L7/L12 [Erwinia tasmaniensis Et1/99]
 gi|259906928|ref|YP_002647284.1| 50S ribosomal protein L7/L12 [Erwinia pyrifoliae Ep1/96]
 gi|292486726|ref|YP_003529596.1| 50S ribosomal protein L7/L12 [Erwinia amylovora CFBP1430]
 gi|292897959|ref|YP_003537328.1| 50S ribosomal protein L7/L12 [Erwinia amylovora ATCC 49946]
 gi|226733687|sp|B2VG95|RL7_ERWT9 RecName: Full=50S ribosomal protein L7/L12
 gi|188027355|emb|CAO95200.1| 50S ribosomal protein L7/L12 [Erwinia tasmaniensis Et1/99]
 gi|224962550|emb|CAX54005.1| 50S ribosomal protein L7/L12 [Erwinia pyrifoliae Ep1/96]
 gi|283476721|emb|CAY72550.1| 50S ribosomal protein L7/L12 [Erwinia pyrifoliae DSM 12163]
 gi|291197807|emb|CBJ44902.1| 50S ribosomal subunit protein L7/L12 [Erwinia amylovora ATCC 49946]
 gi|291552143|emb|CBA19180.1| 50S ribosomal protein L7/L12 [Erwinia amylovora CFBP1430]
 gi|310766073|gb|ADP11023.1| 50S ribosomal protein L7/L12 [Erwinia sp. Ejp617]
 gi|312170792|emb|CBX79053.1| 50S ribosomal protein L7/L12 [Erwinia amylovora ATCC BAA-2158]
          Length = 121

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A V+  A  A     A  EKTEF+VVLK 
Sbjct: 6   DQIIEGVAALSVMEIVELISAMEEKFGVSAAAAVAGPAAAA----EAVEEKTEFDVVLKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKKVLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|220909374|ref|YP_002484685.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 7425]
 gi|254806368|sp|B8HVL2|RL7_CYAP4 RecName: Full=50S ribosomal protein L7/L12
 gi|219865985|gb|ACL46324.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 7425]
          Length = 131

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 80/114 (70%), Gaps = 8/114 (7%)

Query: 19  AAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EKTEFEVVLKGFDDP-KKKI 72
           AAEL K++E+ +GVSA+AP   +  +A  AG+AA      EKT F+VVL   D P  KKI
Sbjct: 20  AAELVKQIEEAFGVSAAAPAGGMVMMAPGAGAAAPAEEVEEKTAFDVVLD--DVPADKKI 77

Query: 73  AVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           AV+K VR +T LGLKEAKE+VES PK +K G+SK++A   KK+LEDAG  V ++
Sbjct: 78  AVLKIVRELTGLGLKEAKEVVESTPKPIKEGISKEDAEAAKKQLEDAGGKVSIK 131


>gi|52694894|gb|AAU85598.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
 gi|52694918|gb|AAU85610.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
          Length = 124

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 60/79 (75%), Gaps = 3/79 (3%)

Query: 49  GSAASE-KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
           GS  SE +TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK 
Sbjct: 48  GSTDSEEQTEFDVILMSFGDSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKS 105

Query: 108 EANEMKKKLEDAGATVELR 126
           +A E+KKKLE  GA VE++
Sbjct: 106 DAEELKKKLEAVGAKVEVK 124


>gi|302380930|ref|ZP_07269392.1| ribosomal protein L7/L12 [Finegoldia magna ACS-171-V-Col3]
 gi|303234832|ref|ZP_07321457.1| ribosomal protein L7/L12 [Finegoldia magna BVS033A4]
 gi|302311308|gb|EFK93327.1| ribosomal protein L7/L12 [Finegoldia magna ACS-171-V-Col3]
 gi|302493950|gb|EFL53731.1| ribosomal protein L7/L12 [Finegoldia magna BVS033A4]
          Length = 123

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 90/124 (72%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +I+ I+E +  LT++E  EL ++ E+++GVSA+APV+V     A  G+AA EK+EF+V+L
Sbjct: 2   SIDEILEAVEGLTVLELNELVEKAEEKFGVSAAAPVAVAGAAPAAGGAAAEEKSEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               + K K  VIK V+ +T LGLK+AK LV+ APK++K G SK+EA E+K KLE+ GAT
Sbjct: 62  ASAGEAKMK--VIKAVKDLTGLGLKDAKALVDEAPKAIKEGASKEEAEELKAKLEEVGAT 119

Query: 123 VELR 126
           +EL+
Sbjct: 120 IELK 123


>gi|169824240|ref|YP_001691851.1| 50S ribosomal protein L7/L12 [Finegoldia magna ATCC 29328]
 gi|226733689|sp|B0S065|RL7_FINM2 RecName: Full=50S ribosomal protein L7/L12
 gi|167831045|dbj|BAG07961.1| 50S ribosomal protein L7/L12 [Finegoldia magna ATCC 29328]
          Length = 123

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 90/124 (72%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +I+ I+E +  LT++E  EL ++ E+++GVSA+APV+V     A  G+AA EK+EF+V+L
Sbjct: 2   SIDEILEAVEGLTVLELNELVEKAEEKFGVSAAAPVAVAGGAPAAGGAAAEEKSEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               + K K  VIK V+ +T LGLK+AK LV+ APK++K G SK+EA E+K KLE+ GAT
Sbjct: 62  ASAGEAKMK--VIKAVKDLTGLGLKDAKALVDEAPKAIKEGASKEEAEELKAKLEEVGAT 119

Query: 123 VELR 126
           +EL+
Sbjct: 120 IELK 123


>gi|18314326|sp|P02397|RL7_RHOSH RecName: Full=50S ribosomal protein L7/L12; Short=RA
          Length = 125

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 83/128 (64%), Gaps = 5/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M+++  + E +  LTL+EA EL   L+ ++G+  +A   V +  P A  A  A  EKTEF
Sbjct: 1   MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGPAAGAAAPAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K  ++K +A  MKKKLE+
Sbjct: 61  DVGLT--DAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAVAKADAEAMKKKLEE 117

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 118 AGAKVELK 125


>gi|260432419|ref|ZP_05786390.1| ribosomal protein L7/L12 [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416247|gb|EEX09506.1| ribosomal protein L7/L12 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 125

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 86/127 (67%), Gaps = 5/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++ + E++  LTL+EA EL   L+ E+G+  +A   V V A   A  G+A  EKTEF
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMVAAGGDAAGGAAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K  +SKDEA E+K KLE 
Sbjct: 61  DVVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEAVSKDEAEEIKGKLEA 117

Query: 119 AGATVEL 125
           AGA VEL
Sbjct: 118 AGAEVEL 124


>gi|114561328|ref|YP_748841.1| ribosomal protein L7/L12 [Shewanella frigidimarina NCIMB 400]
 gi|122301121|sp|Q089R2|RL7_SHEFN RecName: Full=50S ribosomal protein L7/L12
 gi|114332621|gb|ABI70003.1| LSU ribosomal protein L12P [Shewanella frigidimarina NCIMB 400]
          Length = 121

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E  ++++++E  EL + +E+++GVSA+A V      A     AA E+TEF+VVL  
Sbjct: 6   DQMLEAFAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGGDAV----AAEEQTEFDVVLTS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F +   K+AVIK +R+ T LGLKEAK + ES+P ++K  +SK+EA  +K  LE AGA+VE
Sbjct: 62  FGE--NKVAVIKALRSATGLGLKEAKTMAESSPIAVKEAVSKEEAATLKADLEAAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|221632697|ref|YP_002521918.1| 50S ribosomal protein L7/L12 [Thermomicrobium roseum DSM 5159]
 gi|221157085|gb|ACM06212.1| ribosomal protein L7/L12 [Thermomicrobium roseum DSM 5159]
          Length = 132

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (67%), Gaps = 6/127 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTEFE 59
           +E I++ +  +T++E ++L K LE+ +GV+A+      AP A  A +AA+    EKTEF+
Sbjct: 8   LEEIIQAIEQMTVLELSQLVKALEERFGVTAAPVAVAAAPAAGAAPAAAAPAEEEKTEFD 67

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIK VR +T LGLKEAK+LVE+APK +K G+SK EA  +K+KLE  
Sbjct: 68  VILS--DVGPNKIQVIKVVRELTQLGLKEAKDLVEAAPKPVKQGVSKQEAETIKQKLEAV 125

Query: 120 GATVELR 126
           GA VE++
Sbjct: 126 GAKVEIK 132


>gi|325108565|ref|YP_004269633.1| 50S ribosomal protein L12P [Planctomyces brasiliensis DSM 5305]
 gi|324968833|gb|ADY59611.1| LSU ribosomal protein L12P [Planctomyces brasiliensis DSM 5305]
          Length = 138

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/125 (44%), Positives = 80/125 (64%), Gaps = 6/125 (4%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEFEVV 61
           ++ +++  LTL++A  L+  L++  G+  +    V+A   A  G         KTEF+VV
Sbjct: 16  TLGDQIVGLTLLQAKNLADYLKEVHGIEPAGGGVVMAAGPAGGGDEGGAAAEEKTEFDVV 75

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D  +KI VIK VRAIT LGLKEAKELVE APK++K G+SK++A ++K  LE AGA
Sbjct: 76  LTAIGD--QKIGVIKAVRAITGLGLKEAKELVEGAPKAVKEGVSKEDAEKIKGDLEAAGA 133

Query: 122 TVELR 126
           T E++
Sbjct: 134 TAEIK 138


>gi|42524384|ref|NP_969764.1| 50S ribosomal protein L7/L12 [Bdellovibrio bacteriovorus HD100]
 gi|81616512|sp|Q6MJ06|RL7_BDEBA RecName: Full=50S ribosomal protein L7/L12
 gi|39576593|emb|CAE80757.1| 50S ribosomal protein L7/L12 [Bdellovibrio bacteriovorus HD100]
          Length = 122

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + IVE LS+ T++E AEL K LE++WGVSA+APV+  A   A   +A  EKT F+V+L  
Sbjct: 6   DQIVEALSAKTVLEIAELVKTLEEKWGVSAAAPVAAAAAGPA---AAVEEKTAFDVIL-- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIKEVR +T LGL EAK LVE+  K++K G +K++A ++KK LE AGA V 
Sbjct: 61  VDAGANKINVIKEVRGLTGLGLAEAKALVEAGNKAVKEGATKEDAEKIKKALEAAGAKVT 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|94984746|ref|YP_604110.1| 50S ribosomal protein L7/L12 [Deinococcus geothermalis DSM 11300]
 gi|123257274|sp|Q1J0P3|RL7_DEIGD RecName: Full=50S ribosomal protein L7/L12
 gi|94555027|gb|ABF44941.1| ribosomal protein L7/L12 [Deinococcus geothermalis DSM 11300]
          Length = 122

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 86/122 (70%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++++++LS+LT++E A+L   L+++WGV+A+  V+     AA    AA EKTEF+V+L  
Sbjct: 6   QALIDQLSTLTIMELADLIDGLKEQWGVTAAVAVAGPGAGAAA--PAAEEKTEFDVIL-- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIKE+RAIT LGLKEAK+L E    ++K G+SK++A + K +LE AGA VE
Sbjct: 62  VDAGASKINVIKELRAITGLGLKEAKDLSEKGG-AIKEGVSKEDAEKFKAQLEGAGAKVE 120

Query: 125 LR 126
           +R
Sbjct: 121 IR 122


>gi|124024990|ref|YP_001014106.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. NATL1A]
 gi|166222193|sp|A2C031|RL7_PROM1 RecName: Full=50S ribosomal protein L7/L12
 gi|123960058|gb|ABM74841.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. NATL1A]
          Length = 131

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 18  EAAELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKI 72
           EA+EL K++E+ +GVSA+A   VV     A    +   AA EKTEFEVVL+ FD    KI
Sbjct: 19  EASELVKQIEEAFGVSAAASAGVVMAAPGAAAGGDGADAAEEKTEFEVVLESFD-ASSKI 77

Query: 73  AVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
            V+KEVR  T LGL EAK LVE+APK++K G +K++A  +KK +E  G  V L+
Sbjct: 78  KVLKEVRNATGLGLGEAKALVEAAPKTIKEGATKEDAEALKKAIEAVGGKVTLK 131


>gi|312147748|gb|ADQ30407.1| ribosomal protein L7/L12 [Borrelia burgdorferi JD1]
          Length = 124

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+K
Sbjct: 54  EQTEFDVILMSFGDSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELK 111

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 112 KKLEAVGAKVEVK 124


>gi|15616664|ref|NP_239876.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681421|ref|YP_002467806.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219681977|ref|YP_002468361.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471096|ref|ZP_05635095.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11134303|sp|P57147|RL7_BUCAI RecName: Full=50S ribosomal protein L7/L12
 gi|254806267|sp|B8D8J7|RL7_BUCA5 RecName: Full=50S ribosomal protein L7/L12
 gi|254806268|sp|B8D6V1|RL7_BUCAT RecName: Full=50S ribosomal protein L7/L12
 gi|25295074|pir||B84934 50S ribosomal protein L7/L12 [imported] - Buchnera sp.  (strain
           APS)
 gi|10038727|dbj|BAB12762.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621710|gb|ACL29866.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624264|gb|ACL30419.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311085783|gb|ADP65865.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086358|gb|ADP66439.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311086936|gb|ADP67016.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087522|gb|ADP67601.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 122

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 77/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S ++++   +L   +E+++GVSAS  ++              EKTEF++ LK 
Sbjct: 6   EQILEAISEMSVMNVVDLITAMEEKFGVSASMSIN---SNNHNEKDLREEKTEFDIFLKV 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++VIK VR+ T LGLKEAK+LVESAP  LK  +SK++A  +KK LED GA +E
Sbjct: 63  I--GPNKVSVIKTVRSATGLGLKEAKDLVESAPTVLKENISKEDAESLKKTLEDVGAEIE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|57237531|ref|YP_178545.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni RM1221]
 gi|205355350|ref|ZP_03222121.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|81557565|sp|Q5HVZ0|RL7_CAMJR RecName: Full=50S ribosomal protein L7/L12
 gi|57166335|gb|AAW35114.1| ribosomal protein L7/L12 [Campylobacter jejuni RM1221]
 gi|205346584|gb|EDZ33216.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315057897|gb|ADT72226.1| LSU ribosomal protein L7/L12 (L23e) [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 125

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMIAGGAAAGGAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|86153900|ref|ZP_01072103.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85842861|gb|EAQ60073.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 125

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMIAGGAAAGSAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|119962698|ref|YP_948669.1| ribosomal protein L7/L12 [Arthrobacter aurescens TC1]
 gi|119949557|gb|ABM08468.1| ribosomal protein L7/L12 [Arthrobacter aurescens TC1]
          Length = 125

 Score = 83.6 bits (205), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E ++E    LT+IE +E  K  E+ + V+A+A           A  AA EKTEF+V
Sbjct: 4   LSN-EELIEAFKELTIIELSEFVKLFEETFEVTAAAVAVAGPAAGGAA-EAAEEKTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+   D  KKIAVIKEVRAIT LGLKEAK+LV+SAPK++  G +K+ A + K +LE+AG
Sbjct: 62  VLEAAGD--KKIAVIKEVRAITSLGLKEAKDLVDSAPKAVLEGATKEAAEKAKAQLEEAG 119

Query: 121 ATVELR 126
           ATV L+
Sbjct: 120 ATVTLK 125


>gi|300087462|ref|YP_003757984.1| 50S ribosomal protein L7/L12 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527195|gb|ADJ25663.1| ribosomal protein L7/L12 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 125

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 4/125 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVV 61
           +  I+ ++  L ++E +EL K LE+E+GVSA+ P++  AP A    +AA    +TEF+V+
Sbjct: 3   VNDIISQIKELNVMELSELVKALEEEFGVSAAVPMAAAAPAAGGGEAAAPAEEQTEFDVI 62

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  D    KI VI+ VR +T LGLKE+K+LVE+APK++K G SK+E+  +K+KLE AGA
Sbjct: 63  LK--DVGANKINVIRVVRELTGLGLKESKDLVEAAPKAVKEGASKEESASIKEKLEAAGA 120

Query: 122 TVELR 126
           TVE++
Sbjct: 121 TVEVK 125


>gi|254490696|ref|ZP_05103881.1| ribosomal protein L7/L12 [Methylophaga thiooxidans DMS010]
 gi|224464152|gb|EEF80416.1| ribosomal protein L7/L12 [Methylophaga thiooxydans DMS010]
          Length = 125

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++T++E  +L + +E+++GV+A+APV+  A  A    +AA+E+TEF+VV+  
Sbjct: 6   DDILEAISNMTVVEVVDLIEAMEEKFGVTAAAPVAAAAAPAEGGAAAAAEQTEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   K++VIK VR +T LGLKEAKE+VE  P ++K G+ K EA ++ K+L +AGA  E
Sbjct: 66  FGD--NKVSVIKVVRGLTGLGLKEAKEMVEGVPATVKEGVEKAEAEDVVKQLTEAGAAAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|216264537|ref|ZP_03436529.1| ribosomal protein L7/L12 [Borrelia burgdorferi 156a]
 gi|215981010|gb|EEC21817.1| ribosomal protein L7/L12 [Borrelia burgdorferi 156a]
          Length = 124

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+K
Sbjct: 54  EQTEFDVILMSFGDSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELK 111

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 112 KKLEAVGAKVEVK 124


>gi|195941260|ref|ZP_03086642.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi 80a]
 gi|218249764|ref|YP_002374907.1| ribosomal protein L7/L12 [Borrelia burgdorferi ZS7]
 gi|221217702|ref|ZP_03589170.1| ribosomal protein L7/L12 [Borrelia burgdorferi 72a]
 gi|223888737|ref|ZP_03623328.1| ribosomal protein L7/L12 [Borrelia burgdorferi 64b]
 gi|224533012|ref|ZP_03673619.1| ribosomal protein L7/L12 [Borrelia burgdorferi WI91-23]
 gi|224533747|ref|ZP_03674335.1| ribosomal protein L7/L12 [Borrelia burgdorferi CA-11.2a]
 gi|225549168|ref|ZP_03770143.1| ribosomal protein L7/L12 [Borrelia burgdorferi 94a]
 gi|225550119|ref|ZP_03771079.1| ribosomal protein L7/L12 [Borrelia burgdorferi 118a]
 gi|225552298|ref|ZP_03773238.1| ribosomal protein L7/L12 [Borrelia sp. SV1]
 gi|226320539|ref|ZP_03796101.1| ribosomal protein L7/L12 [Borrelia burgdorferi 29805]
 gi|226321705|ref|ZP_03797231.1| ribosomal protein L7/L12 [Borrelia burgdorferi Bol26]
 gi|226733644|sp|B7J1W2|RL7_BORBZ RecName: Full=50S ribosomal protein L7/L12
 gi|52694884|gb|AAU85593.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi]
 gi|52694886|gb|AAU85594.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi]
 gi|52694888|gb|AAU85595.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi]
 gi|218164952|gb|ACK75013.1| ribosomal protein L7/L12 [Borrelia burgdorferi ZS7]
 gi|221192379|gb|EEE18598.1| ribosomal protein L7/L12 [Borrelia burgdorferi 72a]
 gi|223885553|gb|EEF56652.1| ribosomal protein L7/L12 [Borrelia burgdorferi 64b]
 gi|224512072|gb|EEF82466.1| ribosomal protein L7/L12 [Borrelia burgdorferi WI91-23]
 gi|224513040|gb|EEF83403.1| ribosomal protein L7/L12 [Borrelia burgdorferi CA-11.2a]
 gi|225369231|gb|EEG98684.1| ribosomal protein L7/L12 [Borrelia burgdorferi 118a]
 gi|225370394|gb|EEG99832.1| ribosomal protein L7/L12 [Borrelia burgdorferi 94a]
 gi|225371296|gb|EEH00726.1| ribosomal protein L7/L12 [Borrelia sp. SV1]
 gi|226232894|gb|EEH31647.1| ribosomal protein L7/L12 [Borrelia burgdorferi Bol26]
 gi|226234051|gb|EEH32770.1| ribosomal protein L7/L12 [Borrelia burgdorferi 29805]
 gi|312149227|gb|ADQ29298.1| ribosomal protein L7/L12 [Borrelia burgdorferi N40]
          Length = 124

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+K
Sbjct: 54  EQTEFDVILMSFGDSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELK 111

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 112 KKLEAVGAKVEVK 124


>gi|15594735|ref|NP_212524.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi B31]
 gi|3914766|sp|O51351|RL7_BORBU RecName: Full=50S ribosomal protein L7/L12
 gi|2688292|gb|AAB91500.1| ribosomal protein L7/L12 (rplL) [Borrelia burgdorferi B31]
 gi|52694882|gb|AAU85592.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi]
 gi|52694890|gb|AAU85596.1| 50S ribosomal protein L7/L12 [Borrelia burgdorferi]
          Length = 124

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+K
Sbjct: 54  EQTEFDVILMSFGDSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELK 111

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 112 KKLEAVGAKVEVK 124


>gi|153805949|ref|ZP_01958617.1| hypothetical protein BACCAC_00194 [Bacteroides caccae ATCC 43185]
 gi|160883074|ref|ZP_02064077.1| hypothetical protein BACOVA_01037 [Bacteroides ovatus ATCC 8483]
 gi|237717391|ref|ZP_04547872.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D1]
 gi|237718751|ref|ZP_04549232.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_2_4]
 gi|255692642|ref|ZP_05416317.1| ribosomal protein L7/L12 [Bacteroides finegoldii DSM 17565]
 gi|260175408|ref|ZP_05761820.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D2]
 gi|262406156|ref|ZP_06082706.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_22]
 gi|293372127|ref|ZP_06618518.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CMC 3f]
 gi|294644051|ref|ZP_06721828.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CC 2a]
 gi|294810203|ref|ZP_06768870.1| ribosomal protein L7/L12 [Bacteroides xylanisolvens SD CC 1b]
 gi|298483056|ref|ZP_07001237.1| ribosomal protein L7/L12 [Bacteroides sp. D22]
 gi|299144631|ref|ZP_07037699.1| ribosomal protein L7/L12 [Bacteroides sp. 3_1_23]
 gi|315923638|ref|ZP_07919878.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|149130626|gb|EDM21832.1| hypothetical protein BACCAC_00194 [Bacteroides caccae ATCC 43185]
 gi|156111546|gb|EDO13291.1| hypothetical protein BACOVA_01037 [Bacteroides ovatus ATCC 8483]
 gi|229443374|gb|EEO49165.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D1]
 gi|229451883|gb|EEO57674.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_2_4]
 gi|260621618|gb|EEX44489.1| ribosomal protein L7/L12 [Bacteroides finegoldii DSM 17565]
 gi|262357031|gb|EEZ06121.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_22]
 gi|292632919|gb|EFF51506.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CMC 3f]
 gi|292640575|gb|EFF58816.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CC 2a]
 gi|294442615|gb|EFG11415.1| ribosomal protein L7/L12 [Bacteroides xylanisolvens SD CC 1b]
 gi|295085436|emb|CBK66959.1| LSU ribosomal protein L12P [Bacteroides xylanisolvens XB1A]
 gi|298270800|gb|EFI12380.1| ribosomal protein L7/L12 [Bacteroides sp. D22]
 gi|298515122|gb|EFI39003.1| ribosomal protein L7/L12 [Bacteroides sp. 3_1_23]
 gi|313697513|gb|EFS34348.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 124

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK     K  + V+K V+    LGLKEAK+LV+ AP ++K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKSAGAAK--LQVVKAVKEACGLGLKEAKDLVDGAPSTVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|46446237|ref|YP_007602.1| 50S ribosomal protein L7/L12 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|81627412|sp|Q6MDM2|RL7_PARUW RecName: Full=50S ribosomal protein L7/L12
 gi|46399878|emb|CAF23327.1| probable 50S ribosomal protein L7/L12 [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 129

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 65/123 (52%), Positives = 83/123 (67%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +V+ LS LT++E AEL   LE +WGV A+APV+V AP A    +A  E T+F+V L  
Sbjct: 7   EELVDALSELTVLEMAELKTLLEDKWGVKAAAPVAVAAPAAGAPAAAVVESTDFQVTL-- 64

Query: 65  FDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            + P  KKI +IK VR IT LGLKEAK+LVE+APK LK    K EA ++KKK+E AG  V
Sbjct: 65  TEAPADKKIGIIKVVREITGLGLKEAKDLVEAAPKELKPTAPKAEAEDIKKKIETAGGKV 124

Query: 124 ELR 126
            L+
Sbjct: 125 TLK 127


>gi|74314480|ref|YP_312899.1| 50S ribosomal protein L7/L12 [Shigella sonnei Ss046]
 gi|194434775|ref|ZP_03067026.1| ribosomal protein L7/L12 [Shigella dysenteriae 1012]
 gi|109893802|sp|Q3YUZ8|RL7_SHISS RecName: Full=50S ribosomal protein L7/L12
 gi|73857957|gb|AAZ90664.1| 50S ribosomal subunit protein L7/L12 [Shigella sonnei Ss046]
 gi|194416999|gb|EDX33117.1| ribosomal protein L7/L12 [Shigella dysenteriae 1012]
 gi|320179553|gb|EFW54504.1| 50S ribosomal protein L7/L12 [Shigella boydii ATCC 9905]
 gi|323167456|gb|EFZ53164.1| ribosomal protein L7/L12 [Shigella sonnei 53G]
 gi|332083874|gb|EGI89087.1| ribosomal protein L7/L12 [Shigella boydii 5216-82]
 gi|332090998|gb|EGI96088.1| ribosomal protein L7/L12 [Shigella dysenteriae 155-74]
          Length = 121

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|56707313|ref|YP_169209.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669783|ref|YP_666340.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|81598039|sp|Q5NID3|RL7_FRATT RecName: Full=50S ribosomal protein L7/L12
 gi|123169675|sp|Q14JT6|RL7_FRAT1 RecName: Full=50S ribosomal protein L7/L12
 gi|56603805|emb|CAG44776.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320116|emb|CAL08159.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|282158438|gb|ADA77829.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 125

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  +L K +E ++GVSA+A V+V A   A    AA EKTEF+VVL  
Sbjct: 6   EDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAAVAVAAGPVAGPAEAAEEKTEFDVVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KIA IK VR  T LGLKEAK+ VE  P ++K   SK+EA  +KK+LE+AGA VE
Sbjct: 64  VDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKEEAEVLKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|284047645|ref|YP_003397984.1| ribosomal protein L7/L12 [Acidaminococcus fermentans DSM 20731]
 gi|283951866|gb|ADB46669.1| ribosomal protein L7/L12 [Acidaminococcus fermentans DSM 20731]
          Length = 121

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + ++T++E A+L K +E ++GVSA+APV+     A  AG+AA+EKTEF+VVLK 
Sbjct: 4   DQIMEAIENMTVLELADLVKAMEDKFGVSAAAPVA--VAAAPAAGAAAAEKTEFDVVLK- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR +T LGLKEAK  V++AP ++K  ++K +A  MK KLE+AGATVE
Sbjct: 61  -DAGASKINVIKVVRELTGLGLKEAKAAVDAAPNAIKEHVAKADAEAMKAKLEEAGATVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|218290025|ref|ZP_03494192.1| ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239859|gb|EED07047.1| ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius LAA1]
          Length = 123

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/120 (47%), Positives = 84/120 (70%), Gaps = 2/120 (1%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFD 66
           I+E + ++T++E  EL K +E+E+GV+A+APV+          +A +E+TEF+V+L    
Sbjct: 6   ILEAVKNMTVLELNELVKAIEEEFGVTAAAPVAFAGAAPGAGEAAQAEQTEFDVILASAG 65

Query: 67  DPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
               KI VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +K KLE+AGA+VE++
Sbjct: 66  --ASKINVIKVVREITGLGLKEAKDLVDGAPKPIKEKVSKEEAESIKAKLEEAGASVEIK 123


>gi|15234393|ref|NP_195360.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|13878063|gb|AAK44109.1|AF370294_1 putative ribosomal protein [Arabidopsis thaliana]
 gi|4006919|emb|CAB16813.1| ribosomal protein [Arabidopsis thaliana]
 gi|7270590|emb|CAB80308.1| ribosomal protein [Arabidopsis thaliana]
 gi|15450415|gb|AAK96501.1| At4g36420/C7A10_940 [Arabidopsis thaliana]
 gi|17104653|gb|AAL34215.1| putative ribosomal protein [Arabidopsis thaliana]
          Length = 179

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/136 (41%), Positives = 84/136 (61%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
           N+  IV +LS+LTL+E  +L++ L ++  +S    ++ + P  +  GS AS+        
Sbjct: 44  NVSKIVNELSNLTLLETMDLTEILRQKLNISELPVMAAMMPGMSLPGSGASKSAGGEGKE 103

Query: 55  -----KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
                KT F+V+L+ +D    KI VIKEVR IT LGLKEAK+LVE AP  LK G+SK+EA
Sbjct: 104 KKKEAKTAFDVMLQAYD-AVSKIKVIKEVRTITALGLKEAKDLVEKAPTLLKKGVSKEEA 162

Query: 110 NEMKKKLEDAGATVEL 125
            ++ +KL+  GA V +
Sbjct: 163 EKIIEKLKAVGAKVAM 178


>gi|291276551|ref|YP_003516323.1| 50S ribosomal protein L7 /L12 [Helicobacter mustelae 12198]
 gi|290963745|emb|CBG39580.1| 50S ribosomal protein L7 /L12 [Helicobacter mustelae 12198]
          Length = 123

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 81/122 (66%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +S L+++E +EL K  E+++GVSA+  V   A   A  G+A  EKTEF VVL  
Sbjct: 6   EEILDYISGLSVLELSELVKAFEEKFGVSAAPTVV--AGAVAAGGAAVEEKTEFNVVLT- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR IT LGLKEAKE  E+ P  LK G++K++A   KKKLE+AGA VE
Sbjct: 63  -DAGANKINVIKVVREITGLGLKEAKEATEATPSVLKEGVNKEDAENFKKKLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|157690888|ref|YP_001485350.1| 50S ribosomal protein L7/L12 [Bacillus pumilus SAFR-032]
 gi|194017446|ref|ZP_03056057.1| ribosomal protein L7/L12 [Bacillus pumilus ATCC 7061]
 gi|166990982|sp|A8F973|RL7_BACP2 RecName: Full=50S ribosomal protein L7/L12
 gi|157679646|gb|ABV60790.1| ribosomal protein L7/L12 [Bacillus pumilus SAFR-032]
 gi|194010718|gb|EDW20289.1| ribosomal protein L7/L12 [Bacillus pumilus ATCC 7061]
          Length = 121

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   T++E  +L K +E+E+GV+A+APV+V A       +AA EKT+F++VL
Sbjct: 4   NIEEIIASVKEATVLELNDLVKAIEEEFGVTAAAPVAVAAAGG----AAAEEKTDFDLVL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G  D  +KI VIK VR IT LGLKEAKELV++ PK LK G++K+EA E+K KLE+ GA+
Sbjct: 60  AGAGD--QKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGAS 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|15807037|ref|NP_295766.1| 50S ribosomal protein L7/L12 [Deinococcus radiodurans R1]
 gi|14195182|sp|Q9RST0|RL7_DEIRA RecName: Full=50S ribosomal protein L7/L12
 gi|190613548|pdb|2ZJQ|5 Chain 5, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 gi|6459831|gb|AAF11590.1|AE002040_7 ribosomal protein L7/L12 [Deinococcus radiodurans R1]
          Length = 122

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++++++L  LT++E A+L   L++ WGV+A+  VS     AA    AA EKTEF+VVL  
Sbjct: 6   QALIDQLGQLTIMELADLIDGLKETWGVTAAVAVSGGGAGAAS--PAAEEKTEFDVVL-- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIKE+R IT LGLKEAK++ E     LK G++KDEA +MK +LE AGA VE
Sbjct: 62  IDAGASKINVIKEIRGITGLGLKEAKDMSEKGG-VLKEGVAKDEAEKMKAQLEAAGARVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|303239014|ref|ZP_07325544.1| ribosomal protein L7/L12 [Acetivibrio cellulolyticus CD2]
 gi|302593352|gb|EFL63070.1| ribosomal protein L7/L12 [Acetivibrio cellulolyticus CD2]
          Length = 125

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 91/123 (73%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           +  ++E++ +LT++E +EL K LE+E+GVSA+APV+V A  AA A + A EKTEF+V+LK
Sbjct: 6   VTKLIEEVKALTVLELSELVKALEEEFGVSAAAPVAVAAAPAAAA-APAEEKTEFDVILK 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR IT LGLKEAK+LV+ APK++K  ++K +A+ M  K ++ GATV
Sbjct: 65  --DAGADKIKVIKVVREITGLGLKEAKDLVDGAPKTVKENVAKADADAMVAKFKEVGATV 122

Query: 124 ELR 126
           E++
Sbjct: 123 EVK 125


>gi|226355461|ref|YP_002785201.1| 50S ribosomal protein L7/L12 [Deinococcus deserti VCD115]
 gi|259491641|sp|C1D0S3|RL7_DEIDV RecName: Full=50S ribosomal protein L7/L12
 gi|226317451|gb|ACO45447.1| putative 50S ribosomal protein L7/L12 [Deinococcus deserti VCD115]
          Length = 121

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++++++L  LT++E A+L   L++ WGV+A+      A   A   +AA EKTEF+VVL  
Sbjct: 6   QALIDQLGQLTIMELADLIDGLKETWGVTAAVAAGPAAAGPA---AAAEEKTEFDVVL-- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIKE+RAIT LGLKEAK++ E     LK G+SKD+A ++K +LE AGA VE
Sbjct: 61  VDAGASKINVIKEIRAITGLGLKEAKDMSEKGG-VLKEGISKDDAEKIKAQLEGAGAKVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|37524447|ref|NP_927791.1| 50S ribosomal protein L7/L12 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81572739|sp|Q7N9A5|RL7_PHOLL RecName: Full=50S ribosomal protein L7/L12
 gi|36783871|emb|CAE12733.1| 50S ribosomal protein L7/L12 (L8) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 123

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/125 (48%), Positives = 88/125 (70%), Gaps = 6/125 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I++ ++++++++  EL   +E ++GVSA+A V+V A  AA    A  E+TEF+VVL
Sbjct: 4   NKEQILDAVATMSVMDVVELITAMEDKFGVSAAAAVAVAAGGAA---EAVEEQTEFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPK-SLKTGLSKDEANEMKKKLEDAGA 121
                   K+AVIK VR  T LGLKEAK+LVESAP  +LK G+SKD+A  +KK LE+AGA
Sbjct: 61  SAI--GGNKVAVIKAVRGATGLGLKEAKDLVESAPNATLKEGISKDDAEALKKSLEEAGA 118

Query: 122 TVELR 126
           +VE++
Sbjct: 119 SVEIK 123


>gi|15804576|ref|NP_290617.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 EDL933]
 gi|15834163|ref|NP_312936.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 str. Sakai]
 gi|16131816|ref|NP_418413.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K-12
           substr. MG1655]
 gi|24115271|ref|NP_709781.1| 50S ribosomal protein L7/L12 [Shigella flexneri 2a str. 301]
 gi|26250757|ref|NP_756797.1| 50S ribosomal protein L7/L12 [Escherichia coli CFT073]
 gi|30064731|ref|NP_838902.1| 50S ribosomal protein L7/L12 [Shigella flexneri 2a str. 2457T]
 gi|82546328|ref|YP_410275.1| 50S ribosomal protein L7/L12 [Shigella boydii Sb227]
 gi|82778839|ref|YP_405188.1| 50S ribosomal protein L7/L12 [Shigella dysenteriae Sd197]
 gi|89110053|ref|AP_003833.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K-12
           substr. W3110]
 gi|91212808|ref|YP_542794.1| 50S ribosomal protein L7/L12 [Escherichia coli UTI89]
 gi|110644321|ref|YP_672051.1| 50S ribosomal protein L7/L12 [Escherichia coli 536]
 gi|110807836|ref|YP_691356.1| 50S ribosomal protein L7/L12 [Shigella flexneri 5 str. 8401]
 gi|157156657|ref|YP_001465479.1| 50S ribosomal protein L7/L12 [Escherichia coli E24377A]
 gi|157163454|ref|YP_001460772.1| 50S ribosomal protein L7/L12 [Escherichia coli HS]
 gi|170022011|ref|YP_001726965.1| 50S ribosomal protein L7/L12 [Escherichia coli ATCC 8739]
 gi|170083446|ref|YP_001732766.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170681674|ref|YP_001746370.1| 50S ribosomal protein L7/L12 [Escherichia coli SMS-3-5]
 gi|187732407|ref|YP_001882671.1| 50S ribosomal protein L7/L12 [Shigella boydii CDC 3083-94]
 gi|187776397|ref|ZP_02802410.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4196]
 gi|188025248|ref|ZP_02777072.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4113]
 gi|188494336|ref|ZP_03001606.1| ribosomal protein L7/L12 [Escherichia coli 53638]
 gi|189010209|ref|ZP_02805376.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4076]
 gi|189402625|ref|ZP_02783628.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4401]
 gi|189403597|ref|ZP_02796463.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4486]
 gi|189404452|ref|ZP_02789571.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4501]
 gi|189405432|ref|ZP_02815351.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC869]
 gi|189405646|ref|ZP_02823389.2| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC508]
 gi|191174296|ref|ZP_03035804.1| ribosomal protein L7/L12 [Escherichia coli F11]
 gi|193066407|ref|ZP_03047454.1| ribosomal protein L7/L12 [Escherichia coli E22]
 gi|193067835|ref|ZP_03048801.1| ribosomal protein L7/L12 [Escherichia coli E110019]
 gi|194429970|ref|ZP_03062479.1| ribosomal protein L7/L12 [Escherichia coli B171]
 gi|194439774|ref|ZP_03071841.1| ribosomal protein L7/L12 [Escherichia coli 101-1]
 gi|195939611|ref|ZP_03084993.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4024]
 gi|208807057|ref|ZP_03249394.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4206]
 gi|208812468|ref|ZP_03253797.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4045]
 gi|208821043|ref|ZP_03261363.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4042]
 gi|209397838|ref|YP_002273502.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4115]
 gi|209921464|ref|YP_002295548.1| 50S ribosomal protein L7/L12 [Escherichia coli SE11]
 gi|215489318|ref|YP_002331749.1| 50S ribosomal protein L7/L12 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217325759|ref|ZP_03441843.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. TW14588]
 gi|218551030|ref|YP_002384821.1| 50S ribosomal protein L7/L12 [Escherichia fergusonii ATCC 35469]
 gi|218556540|ref|YP_002389454.1| 50S ribosomal protein L7/L12 [Escherichia coli IAI1]
 gi|218561052|ref|YP_002393965.1| 50S ribosomal protein L7/L12 [Escherichia coli S88]
 gi|218697693|ref|YP_002405360.1| 50S ribosomal protein L7/L12 [Escherichia coli 55989]
 gi|218702616|ref|YP_002410245.1| 50S ribosomal protein L7/L12 [Escherichia coli IAI39]
 gi|218707604|ref|YP_002415123.1| 50S ribosomal protein L7/L12 [Escherichia coli UMN026]
 gi|227885485|ref|ZP_04003290.1| 50S ribosomal protein L7/L12 [Escherichia coli 83972]
 gi|237702754|ref|ZP_04533235.1| ribosomal protein L7/L12 [Escherichia sp. 3_2_53FAA]
 gi|238903042|ref|YP_002928838.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli BW2952]
 gi|253775385|ref|YP_003038216.1| 50S ribosomal protein L7/L12 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254039242|ref|ZP_04873291.1| ribosomal protein L7/L12 [Escherichia sp. 1_1_43]
 gi|254163927|ref|YP_003047035.1| 50S ribosomal protein L7/L12 [Escherichia coli B str. REL606]
 gi|254795984|ref|YP_003080821.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 str.
           TW14359]
 gi|256021694|ref|ZP_05435559.1| 50S ribosomal protein L7/L12 [Shigella sp. D9]
 gi|256026301|ref|ZP_05440166.1| 50S ribosomal protein L7/L12 [Escherichia sp. 4_1_40B]
 gi|260846786|ref|YP_003224564.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O103:H2 str.
           12009]
 gi|260858095|ref|YP_003231986.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O26:H11 str.
           11368]
 gi|260870697|ref|YP_003237099.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O111:H- str.
           11128]
 gi|261227303|ref|ZP_05941584.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261257050|ref|ZP_05949583.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291285400|ref|YP_003502218.1| 50S ribosomal protein L7/L12 [Escherichia coli O55:H7 str. CB9615]
 gi|293407602|ref|ZP_06651520.1| rpl12 [Escherichia coli FVEC1412]
 gi|293413422|ref|ZP_06656082.1| 50S ribosomal protein L7/L12 [Escherichia coli B354]
 gi|293417489|ref|ZP_06660112.1| 50S ribosomal protein L7/L12 [Escherichia coli B185]
 gi|293474292|ref|ZP_06664701.1| 50S ribosomal protein L7/L12 [Escherichia coli B088]
 gi|297518011|ref|ZP_06936397.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli OP50]
 gi|298383350|ref|ZP_06992942.1| rpl12 [Escherichia coli FVEC1302]
 gi|300819796|ref|ZP_07099983.1| ribosomal protein L7/L12 [Escherichia coli MS 107-1]
 gi|300824635|ref|ZP_07104743.1| ribosomal protein L7/L12 [Escherichia coli MS 119-7]
 gi|300897601|ref|ZP_07116009.1| ribosomal protein L7/L12 [Escherichia coli MS 198-1]
 gi|300919401|ref|ZP_07135907.1| ribosomal protein L7/L12 [Escherichia coli MS 115-1]
 gi|300925851|ref|ZP_07141696.1| ribosomal protein L7/L12 [Escherichia coli MS 182-1]
 gi|300928803|ref|ZP_07144312.1| ribosomal protein L7/L12 [Escherichia coli MS 187-1]
 gi|300938790|ref|ZP_07153502.1| ribosomal protein L7/L12 [Escherichia coli MS 21-1]
 gi|300947411|ref|ZP_07161602.1| ribosomal protein L7/L12 [Escherichia coli MS 116-1]
 gi|300954785|ref|ZP_07167214.1| ribosomal protein L7/L12 [Escherichia coli MS 175-1]
 gi|300979576|ref|ZP_07174619.1| ribosomal protein L7/L12 [Escherichia coli MS 45-1]
 gi|300985571|ref|ZP_07177487.1| ribosomal protein L7/L12 [Escherichia coli MS 200-1]
 gi|301019398|ref|ZP_07183575.1| ribosomal protein L7/L12 [Escherichia coli MS 69-1]
 gi|301023352|ref|ZP_07187144.1| ribosomal protein L7/L12 [Escherichia coli MS 196-1]
 gi|301047719|ref|ZP_07194779.1| ribosomal protein L7/L12 [Escherichia coli MS 185-1]
 gi|301302203|ref|ZP_07208335.1| ribosomal protein L7/L12 [Escherichia coli MS 124-1]
 gi|301326083|ref|ZP_07219481.1| ribosomal protein L7/L12 [Escherichia coli MS 78-1]
 gi|301645760|ref|ZP_07245680.1| ribosomal protein L7/L12 [Escherichia coli MS 146-1]
 gi|306812001|ref|ZP_07446209.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli NC101]
 gi|307140677|ref|ZP_07500033.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli H736]
 gi|307315041|ref|ZP_07594627.1| ribosomal protein L7/L12 [Escherichia coli W]
 gi|309783937|ref|ZP_07678582.1| ribosomal protein L7/L12 [Shigella dysenteriae 1617]
 gi|309797689|ref|ZP_07692075.1| ribosomal protein L7/L12 [Escherichia coli MS 145-7]
 gi|312965361|ref|ZP_07779594.1| ribosomal protein L7/L12 [Escherichia coli 2362-75]
 gi|312974228|ref|ZP_07788398.1| ribosomal protein L7/L12 [Escherichia coli 1827-70]
 gi|331644720|ref|ZP_08345838.1| ribosomal protein L7/L12 [Escherichia coli H736]
 gi|331649839|ref|ZP_08350917.1| ribosomal protein L7/L12 [Escherichia coli M605]
 gi|331655683|ref|ZP_08356673.1| ribosomal protein L7/L12 [Escherichia coli M718]
 gi|331660545|ref|ZP_08361478.1| ribosomal protein L7/L12 [Escherichia coli TA206]
 gi|331665640|ref|ZP_08366536.1| ribosomal protein L7/L12 [Escherichia coli TA143]
 gi|331670838|ref|ZP_08371673.1| ribosomal protein L7/L12 [Escherichia coli TA271]
 gi|331675472|ref|ZP_08376221.1| ribosomal protein L7/L12 [Escherichia coli TA280]
 gi|331680106|ref|ZP_08380767.1| ribosomal protein L7/L12 [Escherichia coli H591]
 gi|331685727|ref|ZP_08386309.1| ribosomal protein L7/L12 [Escherichia coli H299]
 gi|67472249|sp|P0A7K2|RL7_ECOLI RecName: Full=50S ribosomal protein L7/L12; AltName: Full=L8
 gi|67472252|sp|P0A7K3|RL7_ECOL6 RecName: Full=50S ribosomal protein L7/L12; AltName: Full=L8
 gi|67472253|sp|P0A7K4|RL7_ECO57 RecName: Full=50S ribosomal protein L7/L12; AltName: Full=L8
 gi|67472254|sp|P0A7K5|RL7_SHIFL RecName: Full=50S ribosomal protein L7/L12; AltName: Full=L8
 gi|109893800|sp|Q31U11|RL7_SHIBS RecName: Full=50S ribosomal protein L7/L12
 gi|109893801|sp|Q32AF8|RL7_SHIDS RecName: Full=50S ribosomal protein L7/L12
 gi|123048609|sp|Q0TA79|RL7_ECOL5 RecName: Full=50S ribosomal protein L7/L12
 gi|123084371|sp|Q1R5V1|RL7_ECOUT RecName: Full=50S ribosomal protein L7/L12
 gi|123342224|sp|Q0SY14|RL7_SHIF8 RecName: Full=50S ribosomal protein L7/L12
 gi|166990983|sp|A7ZUK0|RL7_ECO24 RecName: Full=50S ribosomal protein L7/L12
 gi|166990984|sp|A8A785|RL7_ECOHS RecName: Full=50S ribosomal protein L7/L12
 gi|189042993|sp|B1IUR1|RL7_ECOLC RecName: Full=50S ribosomal protein L7/L12
 gi|226733678|sp|B7MIX2|RL7_ECO45 RecName: Full=50S ribosomal protein L7/L12
 gi|226733679|sp|B5Z082|RL7_ECO5E RecName: Full=50S ribosomal protein L7/L12
 gi|226733680|sp|B7NRR4|RL7_ECO7I RecName: Full=50S ribosomal protein L7/L12
 gi|226733681|sp|B7M733|RL7_ECO8A RecName: Full=50S ribosomal protein L7/L12
 gi|226733682|sp|B1XBY8|RL7_ECODH RecName: Full=50S ribosomal protein L7/L12
 gi|226733683|sp|B7NFS6|RL7_ECOLU RecName: Full=50S ribosomal protein L7/L12
 gi|226733684|sp|B6I5J6|RL7_ECOSE RecName: Full=50S ribosomal protein L7/L12
 gi|226733685|sp|B1LNT8|RL7_ECOSM RecName: Full=50S ribosomal protein L7/L12
 gi|226733688|sp|B7LUL6|RL7_ESCF3 RecName: Full=50S ribosomal protein L7/L12
 gi|226734478|sp|B2TWH2|RL7_SHIB3 RecName: Full=50S ribosomal protein L7/L12
 gi|254806372|sp|B7UPE1|RL7_ECO27 RecName: Full=50S ribosomal protein L7/L12
 gi|254806373|sp|B7LA79|RL7_ECO55 RecName: Full=50S ribosomal protein L7/L12
 gi|259491645|sp|C5A0S6|RL7_ECOBW RecName: Full=50S ribosomal protein L7/L12
 gi|313754042|pdb|2XTG|L Chain L, Trna Tranlocation On The 70s Ribosome: The        Pre-
           Translocational Translocation Intermediate Ti(Pre)
 gi|313754100|pdb|2XUX|L Chain L, Trna Tranlocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 gi|12518911|gb|AAG59182.1|AE005630_2 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           EDL933]
 gi|26111188|gb|AAN83371.1|AE016770_171 50S ribosomal protein L7/L12 [Escherichia coli CFT073]
 gi|42817|emb|CAA23624.1| rplL (L7/L12) [Escherichia coli]
 gi|396325|gb|AAC43084.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K-12
           substr. MG1655]
 gi|1790418|gb|AAC76960.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K-12
           substr. MG1655]
 gi|13364385|dbj|BAB38332.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           Sakai]
 gi|24054564|gb|AAN45488.1| 50S ribosomal subunit protein L7/L12 [Shigella flexneri 2a str.
           301]
 gi|30042991|gb|AAP18713.1| 50S ribosomal subunit protein L7/L12 [Shigella flexneri 2a str.
           2457T]
 gi|81242987|gb|ABB63697.1| 50S ribosomal subunit protein L7/L12 [Shigella dysenteriae Sd197]
 gi|81247739|gb|ABB68447.1| 50S ribosomal subunit protein L7/L12 [Shigella boydii Sb227]
 gi|85676084|dbj|BAE77334.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K12
           substr. W3110]
 gi|91074382|gb|ABE09263.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli UTI89]
 gi|110345913|gb|ABG72150.1| 50S ribosomal protein L7/L12 [Escherichia coli 536]
 gi|110617384|gb|ABF06051.1| 50S ribosomal subunit protein L7/L12 [Shigella flexneri 5 str.
           8401]
 gi|157069134|gb|ABV08389.1| ribosomal protein L7/L12 [Escherichia coli HS]
 gi|157078687|gb|ABV18395.1| ribosomal protein L7/L12 [Escherichia coli E24377A]
 gi|169756939|gb|ACA79638.1| ribosomal protein L7/L12 [Escherichia coli ATCC 8739]
 gi|169891281|gb|ACB04988.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli str. K-12
           substr. DH10B]
 gi|170519392|gb|ACB17570.1| ribosomal protein L7/L12 [Escherichia coli SMS-3-5]
 gi|187429399|gb|ACD08673.1| ribosomal protein L7/L12 [Shigella boydii CDC 3083-94]
 gi|187767360|gb|EDU31204.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4196]
 gi|188014018|gb|EDU52140.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4113]
 gi|188489535|gb|EDU64638.1| ribosomal protein L7/L12 [Escherichia coli 53638]
 gi|189001806|gb|EDU70792.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4076]
 gi|189354608|gb|EDU73027.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4401]
 gi|189359760|gb|EDU78179.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4486]
 gi|189365450|gb|EDU83866.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4501]
 gi|189370166|gb|EDU88582.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC869]
 gi|189379136|gb|EDU97552.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC508]
 gi|190905428|gb|EDV65059.1| ribosomal protein L7/L12 [Escherichia coli F11]
 gi|192925931|gb|EDV80578.1| ribosomal protein L7/L12 [Escherichia coli E22]
 gi|192958810|gb|EDV89247.1| ribosomal protein L7/L12 [Escherichia coli E110019]
 gi|194411999|gb|EDX28312.1| ribosomal protein L7/L12 [Escherichia coli B171]
 gi|194421271|gb|EDX37291.1| ribosomal protein L7/L12 [Escherichia coli 101-1]
 gi|208726858|gb|EDZ76459.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4206]
 gi|208733745|gb|EDZ82432.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4045]
 gi|208741166|gb|EDZ88848.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4042]
 gi|209159238|gb|ACI36671.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC4115]
 gi|209751818|gb|ACI74216.1| RNA polymerase beta subunit [Escherichia coli]
 gi|209751820|gb|ACI74217.1| RNA polymerase beta subunit [Escherichia coli]
 gi|209751822|gb|ACI74218.1| RNA polymerase beta subunit [Escherichia coli]
 gi|209751824|gb|ACI74219.1| RNA polymerase beta subunit [Escherichia coli]
 gi|209751826|gb|ACI74220.1| RNA polymerase beta subunit [Escherichia coli]
 gi|209914723|dbj|BAG79797.1| 50S ribosomal protein L7/L12 [Escherichia coli SE11]
 gi|215267390|emb|CAS11841.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217321980|gb|EEC30404.1| ribosomal protein L7/L12 [Escherichia coli O157:H7 str. TW14588]
 gi|218354425|emb|CAV01226.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli 55989]
 gi|218358571|emb|CAQ91219.1| 50S ribosomal subunit protein L7/L12 [Escherichia fergusonii ATCC
           35469]
 gi|218363309|emb|CAR00959.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli IAI1]
 gi|218367821|emb|CAR05616.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli S88]
 gi|218372602|emb|CAR20477.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli IAI39]
 gi|218434701|emb|CAR15633.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli UMN026]
 gi|222035697|emb|CAP78442.1| 50S ribosomal protein L7/L12 [Escherichia coli LF82]
 gi|226838477|gb|EEH70507.1| ribosomal protein L7/L12 [Escherichia sp. 1_1_43]
 gi|226903067|gb|EEH89326.1| ribosomal protein L7/L12 [Escherichia sp. 3_2_53FAA]
 gi|227837559|gb|EEJ48025.1| 50S ribosomal protein L7/L12 [Escherichia coli 83972]
 gi|238859879|gb|ACR61877.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli BW2952]
 gi|242379516|emb|CAQ34332.1| 50S ribosomal subunit protein L12, subunit of 50S ribosomal subunit
           protein L7/L12 dimer, 50S ribosomal protein complex L8,
           50S ribosomal subunit and ribosome [Escherichia coli
           BL21(DE3)]
 gi|253326429|gb|ACT31031.1| ribosomal protein L7/L12 [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|253975828|gb|ACT41499.1| 50S ribosomal protein L7/L12 [Escherichia coli B str. REL606]
 gi|253979984|gb|ACT45654.1| 50S ribosomal protein L7/L12 [Escherichia coli BL21(DE3)]
 gi|254595384|gb|ACT74745.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           TW14359]
 gi|257756744|dbj|BAI28246.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O26:H11 str.
           11368]
 gi|257761933|dbj|BAI33430.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O103:H2 str.
           12009]
 gi|257767053|dbj|BAI38548.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O111:H- str.
           11128]
 gi|260451187|gb|ACX41609.1| ribosomal protein L7/L12 [Escherichia coli DH1]
 gi|281181050|dbj|BAI57380.1| 50S ribosomal protein L7/L12 [Escherichia coli SE15]
 gi|281603372|gb|ADA76356.1| 50S ribosomal protein L7/L12 [Shigella flexneri 2002017]
 gi|284924078|emb|CBG37177.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli 042]
 gi|290765273|gb|ADD59234.1| 50S ribosomal protein L7/L12 [Escherichia coli O55:H7 str. CB9615]
 gi|291321322|gb|EFE60763.1| 50S ribosomal protein L7/L12 [Escherichia coli B088]
 gi|291425370|gb|EFE98410.1| rpl12 [Escherichia coli FVEC1412]
 gi|291430816|gb|EFF03813.1| 50S ribosomal protein L7/L12 [Escherichia coli B185]
 gi|291468017|gb|EFF10516.1| 50S ribosomal protein L7/L12 [Escherichia coli B354]
 gi|294491997|gb|ADE90753.1| ribosomal protein L7/L12 [Escherichia coli IHE3034]
 gi|298276229|gb|EFI17750.1| rpl12 [Escherichia coli FVEC1302]
 gi|299880912|gb|EFI89123.1| ribosomal protein L7/L12 [Escherichia coli MS 196-1]
 gi|300300404|gb|EFJ56789.1| ribosomal protein L7/L12 [Escherichia coli MS 185-1]
 gi|300306517|gb|EFJ61037.1| ribosomal protein L7/L12 [Escherichia coli MS 200-1]
 gi|300318254|gb|EFJ68038.1| ribosomal protein L7/L12 [Escherichia coli MS 175-1]
 gi|300358648|gb|EFJ74518.1| ribosomal protein L7/L12 [Escherichia coli MS 198-1]
 gi|300399282|gb|EFJ82820.1| ribosomal protein L7/L12 [Escherichia coli MS 69-1]
 gi|300409480|gb|EFJ93018.1| ribosomal protein L7/L12 [Escherichia coli MS 45-1]
 gi|300413536|gb|EFJ96846.1| ribosomal protein L7/L12 [Escherichia coli MS 115-1]
 gi|300418076|gb|EFK01387.1| ribosomal protein L7/L12 [Escherichia coli MS 182-1]
 gi|300452980|gb|EFK16600.1| ribosomal protein L7/L12 [Escherichia coli MS 116-1]
 gi|300456274|gb|EFK19767.1| ribosomal protein L7/L12 [Escherichia coli MS 21-1]
 gi|300463214|gb|EFK26707.1| ribosomal protein L7/L12 [Escherichia coli MS 187-1]
 gi|300522884|gb|EFK43953.1| ribosomal protein L7/L12 [Escherichia coli MS 119-7]
 gi|300527617|gb|EFK48679.1| ribosomal protein L7/L12 [Escherichia coli MS 107-1]
 gi|300842366|gb|EFK70126.1| ribosomal protein L7/L12 [Escherichia coli MS 124-1]
 gi|300847176|gb|EFK74936.1| ribosomal protein L7/L12 [Escherichia coli MS 78-1]
 gi|301075971|gb|EFK90777.1| ribosomal protein L7/L12 [Escherichia coli MS 146-1]
 gi|305854606|gb|EFM55042.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli NC101]
 gi|306905546|gb|EFN36079.1| ribosomal protein L7/L12 [Escherichia coli W]
 gi|307628397|gb|ADN72701.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli UM146]
 gi|308118701|gb|EFO55963.1| ribosomal protein L7/L12 [Escherichia coli MS 145-7]
 gi|308928308|gb|EFP73770.1| ribosomal protein L7/L12 [Shigella dysenteriae 1617]
 gi|309704401|emb|CBJ03750.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli ETEC H10407]
 gi|310331395|gb|EFP98660.1| ribosomal protein L7/L12 [Escherichia coli 1827-70]
 gi|312290035|gb|EFR17922.1| ribosomal protein L7/L12 [Escherichia coli 2362-75]
 gi|312948560|gb|ADR29387.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O83:H1 str.
           NRG 857C]
 gi|313648636|gb|EFS13076.1| ribosomal protein L7/L12 [Shigella flexneri 2a str. 2457T]
 gi|315063311|gb|ADT77638.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli W]
 gi|315138542|dbj|BAJ45701.1| 50S ribosomal protein L7/L12 [Escherichia coli DH1]
 gi|315253058|gb|EFU33026.1| ribosomal protein L7/L12 [Escherichia coli MS 85-1]
 gi|315288354|gb|EFU47752.1| ribosomal protein L7/L12 [Escherichia coli MS 110-3]
 gi|315294332|gb|EFU53683.1| ribosomal protein L7/L12 [Escherichia coli MS 153-1]
 gi|315300759|gb|EFU59984.1| ribosomal protein L7/L12 [Escherichia coli MS 16-3]
 gi|320172753|gb|EFW47987.1| 50S ribosomal protein L7/L12 [Shigella dysenteriae CDC 74-1112]
 gi|320185976|gb|EFW60724.1| 50S ribosomal protein L7/L12 [Shigella flexneri CDC 796-83]
 gi|320190918|gb|EFW65568.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 str. EC1212]
 gi|320197119|gb|EFW71737.1| 50S ribosomal protein L7/L12 [Escherichia coli WV_060327]
 gi|320200175|gb|EFW74764.1| 50S ribosomal protein L7/L12 [Escherichia coli EC4100B]
 gi|320639076|gb|EFX08716.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           G5101]
 gi|320644470|gb|EFX13533.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H- str.
           493-89]
 gi|320649789|gb|EFX18310.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H- str.
           H 2687]
 gi|320655122|gb|EFX23078.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320660766|gb|EFX28220.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320665884|gb|EFX32915.1| 50S ribosomal subunit protein L7/L12 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323155522|gb|EFZ41700.1| ribosomal protein L7/L12 [Escherichia coli EPECa14]
 gi|323161292|gb|EFZ47202.1| ribosomal protein L7/L12 [Escherichia coli E128010]
 gi|323174505|gb|EFZ60130.1| ribosomal protein L7/L12 [Escherichia coli LT-68]
 gi|323177539|gb|EFZ63124.1| ribosomal protein L7/L12 [Escherichia coli 1180]
 gi|323182083|gb|EFZ67493.1| ribosomal protein L7/L12 [Escherichia coli 1357]
 gi|323190157|gb|EFZ75435.1| ribosomal protein L7/L12 [Escherichia coli RN587/1]
 gi|323380625|gb|ADX52893.1| ribosomal protein L7/L12 [Escherichia coli KO11]
 gi|323933972|gb|EGB30446.1| ribosomal protein L7/L12 [Escherichia coli E1520]
 gi|323938897|gb|EGB35117.1| ribosomal protein L7/L12 [Escherichia coli E482]
 gi|323943597|gb|EGB39706.1| ribosomal protein L7/L12 [Escherichia coli H120]
 gi|323948842|gb|EGB44739.1| ribosomal protein L7/L12 [Escherichia coli H252]
 gi|323953801|gb|EGB49608.1| ribosomal protein L7/L12 [Escherichia coli H263]
 gi|323958912|gb|EGB54587.1| ribosomal protein L7/L12 [Escherichia coli H489]
 gi|323963796|gb|EGB59295.1| ribosomal protein L7/L12 [Escherichia coli M863]
 gi|323969059|gb|EGB64367.1| ribosomal protein L7/L12 [Escherichia coli TA007]
 gi|323974186|gb|EGB69318.1| ribosomal protein L7/L12 [Escherichia coli TW10509]
 gi|324009467|gb|EGB78686.1| ribosomal protein L7/L12 [Escherichia coli MS 57-2]
 gi|324015281|gb|EGB84500.1| ribosomal protein L7/L12 [Escherichia coli MS 60-1]
 gi|324017331|gb|EGB86550.1| ribosomal protein L7/L12 [Escherichia coli MS 117-3]
 gi|324110898|gb|EGC04890.1| ribosomal protein L7/L12 [Escherichia fergusonii B253]
 gi|324115417|gb|EGC09362.1| ribosomal protein L7/L12 [Escherichia coli E1167]
 gi|325499282|gb|EGC97141.1| 50S ribosomal protein L7/L12 [Escherichia fergusonii ECD227]
 gi|326347164|gb|EGD70894.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 str. 1125]
 gi|326347585|gb|EGD71307.1| 50S ribosomal protein L7/L12 [Escherichia coli O157:H7 str. 1044]
 gi|327250456|gb|EGE62166.1| ribosomal protein L7/L12 [Escherichia coli STEC_7v]
 gi|330908303|gb|EGH36822.1| LSU ribosomal protein L7/L12 (P1/P2) [Escherichia coli AA86]
 gi|331036020|gb|EGI08257.1| ribosomal protein L7/L12 [Escherichia coli H736]
 gi|331041305|gb|EGI13457.1| ribosomal protein L7/L12 [Escherichia coli M605]
 gi|331046608|gb|EGI18695.1| ribosomal protein L7/L12 [Escherichia coli M718]
 gi|331052328|gb|EGI24366.1| ribosomal protein L7/L12 [Escherichia coli TA206]
 gi|331057158|gb|EGI29150.1| ribosomal protein L7/L12 [Escherichia coli TA143]
 gi|331061926|gb|EGI33850.1| ribosomal protein L7/L12 [Escherichia coli TA271]
 gi|331067350|gb|EGI38756.1| ribosomal protein L7/L12 [Escherichia coli TA280]
 gi|331072261|gb|EGI43595.1| ribosomal protein L7/L12 [Escherichia coli H591]
 gi|331077037|gb|EGI48253.1| ribosomal protein L7/L12 [Escherichia coli H299]
 gi|332092330|gb|EGI97405.1| ribosomal protein L7/L12 [Shigella boydii 3594-74]
 gi|332105288|gb|EGJ08634.1| 50S ribosomal subunit protein L7/L12 [Shigella sp. D9]
          Length = 121

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|300772102|ref|ZP_07081972.1| ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC 33861]
 gi|300760405|gb|EFK57231.1| ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC 33861]
          Length = 125

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ + E+L +LT+ E  EL+  L+ E+G+  +A    VA   AE G+AA+E KT F+
Sbjct: 1   MADLKQLAEQLVNLTVKEVKELADILKDEYGIEPAAAAVAVAAAPAEGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +  LGLKEAK+LV+ APK LK G+SKDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLAGLGLKEAKDLVDGAPKELKAGVSKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|325964177|ref|YP_004242083.1| 50S ribosomal protein L12P [Arthrobacter phenanthrenivorans Sphe3]
 gi|323470264|gb|ADX73949.1| LSU ribosomal protein L12P [Arthrobacter phenanthrenivorans Sphe3]
          Length = 125

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E ++E    LT+IE +E  K  E+ + V+A+A         A A     EKT+F+V
Sbjct: 4   LSN-EELIEAFKELTIIELSEFVKLFEETFEVTAAAVAVAGPAGGAAA-EEVEEKTDFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+   D  KKIAVIKEVRAIT LGLKEAK+LV+SAPK++  G +K+ A + K++LE AG
Sbjct: 62  VLEAAGD--KKIAVIKEVRAITSLGLKEAKDLVDSAPKAVLEGATKEAAEKAKEQLEAAG 119

Query: 121 ATVELR 126
           ATV L+
Sbjct: 120 ATVTLK 125


>gi|319953898|ref|YP_004165165.1| lsu ribosomal protein l12p [Cellulophaga algicola DSM 14237]
 gi|319422558|gb|ADV49667.1| LSU ribosomal protein L12P [Cellulophaga algicola DSM 14237]
          Length = 123

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA    +A + A E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELANILKDEYGIEPAAAAVAVAAGGGDA-AVAEEQTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAK++V+SAPK++K G+SKDEA  + K LE+AG
Sbjct: 60  ILKAA--GASKLAVVKLVKELTGLGLKEAKDIVDSAPKAIKEGISKDEAEGILKSLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AEVELK 123


>gi|46015538|pdb|1RQU|A Chain A, Nmr Structure Of L7 Dimer From E.Coli
 gi|46015539|pdb|1RQU|B Chain B, Nmr Structure Of L7 Dimer From E.Coli
 gi|46015540|pdb|1RQV|A Chain A, Spatial Model Of L7 Dimer From E.Coli With One Hinge
           Region In Helical State
 gi|46015541|pdb|1RQV|B Chain B, Spatial Model Of L7 Dimer From E.Coli With One Hinge
           Region In Helical State
          Length = 120

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 5   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 61  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVE 118

Query: 125 LR 126
           ++
Sbjct: 119 VK 120


>gi|227115006|ref|ZP_03828662.1| 50S ribosomal protein L7/L12 [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 121

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A      A EKTEF+VVLK 
Sbjct: 6   DQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGPA----EVAEEKTEFDVVLKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|157738104|ref|YP_001490788.1| 50S ribosomal protein L7/L12 [Arcobacter butzleri RM4018]
 gi|315636456|ref|ZP_07891698.1| ribosomal protein L7/L12 [Arcobacter butzleri JV22]
 gi|166990981|sp|A8EVZ5|RL7_ARCB4 RecName: Full=50S ribosomal protein L7/L12
 gi|157699958|gb|ABV68118.1| 50S ribosomal protein L7/L12 [Arcobacter butzleri RM4018]
 gi|315479237|gb|EFU69928.1| ribosomal protein L7/L12 [Arcobacter butzleri JV22]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 79/122 (64%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S L+++E +EL K  E+++GVSA         VAA    A  EKTEF+V++  
Sbjct: 6   EDVLEFISGLSVLELSELVKEFEEKFGVSAQPVAVAGGAVAAV--EAVEEKTEFDVII-- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIKE+RAIT LGLKEAK+  E  P ++K G+SK +A   K +LE AGA VE
Sbjct: 62  VDSGDKKINVIKEIRAITGLGLKEAKDAAEQTPSTIKEGISKADAEAFKAQLEAAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|59802173|ref|YP_208885.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA 1090]
 gi|194099907|ref|YP_002003044.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae NCCP11945]
 gi|239997912|ref|ZP_04717836.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 35/02]
 gi|240015109|ref|ZP_04722022.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI18]
 gi|240017558|ref|ZP_04724098.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA6140]
 gi|240081701|ref|ZP_04726244.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA19]
 gi|240113977|ref|ZP_04728467.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae MS11]
 gi|240116713|ref|ZP_04730775.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID18]
 gi|240118935|ref|ZP_04732997.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID1]
 gi|240122180|ref|ZP_04735142.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID24-1]
 gi|240124473|ref|ZP_04737429.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID332]
 gi|240124659|ref|ZP_04737545.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-92-679]
 gi|240129147|ref|ZP_04741808.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494733|ref|ZP_05107904.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 1291]
 gi|260439528|ref|ZP_05793344.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI2]
 gi|268593763|ref|ZP_06127930.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 35/02]
 gi|268597798|ref|ZP_06131965.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA19]
 gi|268600041|ref|ZP_06134208.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae MS11]
 gi|268602383|ref|ZP_06136550.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID18]
 gi|268604645|ref|ZP_06138812.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID1]
 gi|268683103|ref|ZP_06149965.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID332]
 gi|268683234|ref|ZP_06150096.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-92-679]
 gi|268687530|ref|ZP_06154392.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042764|ref|ZP_06568505.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI2]
 gi|293398216|ref|ZP_06642421.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae F62]
 gi|75432354|sp|Q5F5R4|RL7_NEIG1 RecName: Full=50S ribosomal protein L7/L12
 gi|226733712|sp|B4RQW1|RL7_NEIG2 RecName: Full=50S ribosomal protein L7/L12
 gi|59719068|gb|AAW90473.1| putative 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA
           1090]
 gi|193935197|gb|ACF31021.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae NCCP11945]
 gi|226513773|gb|EEH63118.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 1291]
 gi|268547152|gb|EEZ42570.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 35/02]
 gi|268551586|gb|EEZ46605.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA19]
 gi|268584172|gb|EEZ48848.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae MS11]
 gi|268586514|gb|EEZ51190.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID18]
 gi|268588776|gb|EEZ53452.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID1]
 gi|268623387|gb|EEZ55787.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID332]
 gi|268623518|gb|EEZ55918.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-92-679]
 gi|268627814|gb|EEZ60214.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-93-1035]
 gi|291013198|gb|EFE05164.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI2]
 gi|291611479|gb|EFF40549.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae F62]
 gi|317165364|gb|ADV08905.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    + A EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAADAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE AGA VE
Sbjct: 64  AGD--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEAAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|56418631|ref|YP_145949.1| 50S ribosomal protein L7/L12 [Geobacillus kaustophilus HTA426]
 gi|81558138|sp|Q5L407|RL7_GEOKA RecName: Full=50S ribosomal protein L7/L12
 gi|56378473|dbj|BAD74381.1| 50S ribosomal protein L7/L12 (BL13) [Geobacillus kaustophilus
           HTA426]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M   E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA A  AA+EKTEF+V
Sbjct: 1   MMTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGA-EAAAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIK VR IT LGLKEAK+LV++ PK +K G++K+EA E+K KLE+AG
Sbjct: 60  ILA--DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEEAEEIKAKLEEAG 117

Query: 121 ATVELR 126
           A VE++
Sbjct: 118 AKVEIK 123


>gi|239825683|ref|YP_002948307.1| 50S ribosomal protein L7/L12 [Geobacillus sp. WCH70]
 gi|239805976|gb|ACS23041.1| ribosomal protein L7/L12 [Geobacillus sp. WCH70]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M   E I+E + ++T++E  EL K +E+E+    +A   VV    A  G AA+EKTEF+V
Sbjct: 1   MMTKEQIIEAVKNMTVLELNELVKAIEEEF--GVTAAAPVVVAGGAAGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIK VR IT LGLKEAK+LV++ PK +K G+SK+EA E+K KLE+ G
Sbjct: 59  ILA--DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGVSKEEAEEIKAKLEEVG 116

Query: 121 ATVELR 126
           A+VE++
Sbjct: 117 ASVEVK 122


>gi|124024468|ref|YP_001018775.1| hypothetical protein P9303_27801 [Prochlorococcus marinus str. MIT
           9303]
 gi|123964754|gb|ABM79510.1| Hypothetical protein P9303_27801 [Prochlorococcus marinus str. MIT
           9303]
          Length = 179

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 83/127 (65%), Gaps = 6/127 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFE 59
           + I++ L +L+L+EA+EL K++E  +GVSA+    VV           A  AA E+TEF+
Sbjct: 54  DDILDSLKTLSLLEASELVKQIEDAFGVSAAPSAGVVMAAGGGAAGGAAAEAAEEQTEFD 113

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL+ FD    KI V+K VR  T LGL +AK +VE+APK++K G++K++A  +KK +E+ 
Sbjct: 114 VVLESFD-ASAKIKVLKAVREATGLGLGDAKAMVEAAPKTIKEGIAKNDAEALKKAIEEV 172

Query: 120 GATVELR 126
           G  V L+
Sbjct: 173 GGKVSLK 179


>gi|118594008|ref|ZP_01551355.1| probable 50s ribosomal subunit protein l7/l12 (acetylation
           methylation)(l8) [Methylophilales bacterium HTCC2181]
 gi|118439786|gb|EAV46413.1| probable 50s ribosomal subunit protein l7/l12 (acetylation
           methylation)(l8) [Methylophilales bacterium HTCC2181]
          Length = 125

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+++++ +EL K +E+++GVSA+A  +  A  AA   +AA EKTEF++ L G
Sbjct: 6   EDILEAIGSMSVLDLSELIKEMEEKFGVSAAAAAAAPAAAAAGGAAAAEEKTEFDLHLSG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               + K+ VIK VR IT LGLKEAK++V++APK +K  L K  A+E  KKL +AGAT E
Sbjct: 66  I--GENKVNVIKAVREITGLGLKEAKDIVDAAPKVVKEALDKASADEALKKLTEAGATAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|116667433|pdb|2GYA|3 Chain 3, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667434|pdb|2GYA|5 Chain 5, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 gi|116667485|pdb|2GYC|3 Chain 3, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
 gi|116667486|pdb|2GYC|5 Chain 5, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 119

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A        AA EKTEF+V+LK 
Sbjct: 4   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPV----EAAEEKTEFDVILKA 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 60  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|237727880|ref|ZP_04558361.1| 50S ribosomal protein L7/L12 [Citrobacter sp. 30_2]
 gi|226910437|gb|EEH96355.1| 50S ribosomal protein L7/L12 [Citrobacter sp. 30_2]
          Length = 121

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 88/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|62262766|gb|AAX78101.1| unknown protein [synthetic construct]
          Length = 160

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  +L K +E ++GVSA+A V+V A   A    AA EKTEF+VVL  
Sbjct: 32  EDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAAVAVAAGPVAGPAEAAEEKTEFDVVL-- 89

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KIA IK VR  T LGLKEAK+ VE  P ++K   SK+EA  +KK+LE+AGA VE
Sbjct: 90  VDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKEEAEVLKKQLEEAGAKVE 149

Query: 125 LR 126
           L+
Sbjct: 150 LK 151


>gi|220913446|ref|YP_002488755.1| ribosomal protein L7/L12 [Arthrobacter chlorophenolicus A6]
 gi|219860324|gb|ACL40666.1| ribosomal protein L7/L12 [Arthrobacter chlorophenolicus A6]
          Length = 125

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E ++E    LT+IE +E  K  E+ + V+A+A           A   A EKT+F+V
Sbjct: 4   LSN-EELIEAFKELTIIELSEFVKLFEETFEVTAAAVAVAGPAGGGAA-EEAEEKTDFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+   D  KKIAVIKEVRAIT LGLKEAK+LV+SAPK++  G +K+ A + K++LE AG
Sbjct: 62  ILESAGD--KKIAVIKEVRAITSLGLKEAKDLVDSAPKAVLEGANKEAAEKAKEQLEAAG 119

Query: 121 ATVELR 126
           ATV L+
Sbjct: 120 ATVTLK 125


>gi|253987831|ref|YP_003039187.1| 50S ribosomal protein L7/L12 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779281|emb|CAQ82442.1| 50s ribosomal subunit protein l7/l12 [Photorhabdus asymbiotica]
          Length = 121

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++++++++  EL   +E+++GVSA+A       V A A  A  EKTEF+VVL  
Sbjct: 6   EQILDTVATMSVMDVVELITAMEEKFGVSAAAA----VAVVAGAAEAVEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK  +SKD+A  +KK LE+AGA+VE
Sbjct: 62  I--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDDAEALKKSLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|153951978|ref|YP_001398486.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. doylei
           269.97]
 gi|166222153|sp|A7H4Q6|RL7_CAMJD RecName: Full=50S ribosomal protein L7/L12
 gi|152939424|gb|ABS44165.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 125

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA   +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAVPVMVAGGAAAGGAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|294668293|ref|ZP_06733397.1| hypothetical protein NEIELOOT_00206 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309747|gb|EFE50990.1| hypothetical protein NEIELOOT_00206 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             +  +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  AGE--QKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|225012653|ref|ZP_03703088.1| ribosomal protein L7/L12 [Flavobacteria bacterium MS024-2A]
 gi|225003186|gb|EEG41161.1| ribosomal protein L7/L12 [Flavobacteria bacterium MS024-2A]
          Length = 125

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA  G  A E KTEF+
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELANILKDEYGIEPAAAAVAVAGPAAAGGDDAGEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLKEAKELV+SAP  LK G++KDEA  + K LE+A
Sbjct: 61  VILKAAG--ASKLAVVKLVKELTGLGLKEAKELVDSAPSPLKEGIAKDEAEALVKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|126663351|ref|ZP_01734349.1| 50S ribosomal protein L7/L12 [Flavobacteria bacterium BAL38]
 gi|126625009|gb|EAZ95699.1| 50S ribosomal protein L7/L12 [Flavobacteria bacterium BAL38]
          Length = 123

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 88/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A   VVA    +A  AA+E+TEF V
Sbjct: 1   MADLKQFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVVVAAGGGDA-GAAAEQTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    K+ V+K V+ +T LGLKEAK+LV++AP ++K G+SKDEA  +KK LE+AG
Sbjct: 60  VLK--EAGASKLGVVKAVKELTGLGLKEAKDLVDAAPTNVKEGVSKDEAEGLKKALEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AVVELK 123


>gi|301093686|ref|XP_002997688.1| 50S ribosomal protein L7/L12, putative [Phytophthora infestans
           T30-4]
 gi|262109937|gb|EEY67989.1| 50S ribosomal protein L7/L12, putative [Phytophthora infestans
           T30-4]
          Length = 178

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (63%), Gaps = 6/127 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASA-----PVSVVAPVAAEAGSAASEKTEF 58
           ++++++++  L ++E AELS  ++ ++G++ SA             A  A  A  EKT F
Sbjct: 52  VQTVLDQILDLNMVEIAELSHAIQTKFGIAESAFQVGMGGGAAGGAAPAAEEAKEEKTAF 111

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L  FD  K KI VIKEVRAIT LGLKEAKELVE AP +LK  + K++A+ + ++L+ 
Sbjct: 112 DVKLASFD-AKSKIKVIKEVRAITGLGLKEAKELVEGAPSTLKKDVKKEDADALIEQLKA 170

Query: 119 AGATVEL 125
            GA VEL
Sbjct: 171 VGAVVEL 177


>gi|260596085|ref|YP_003208656.1| 50S ribosomal protein L7/L12 [Cronobacter turicensis z3032]
 gi|260215262|emb|CBA27169.1| 50S ribosomal protein L7/L12 [Cronobacter turicensis z3032]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A  AA    AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPAA---EAAEEKTEFDVILKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 63  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|156935816|ref|YP_001439732.1| 50S ribosomal protein L7/L12 [Cronobacter sakazakii ATCC BAA-894]
 gi|166222165|sp|A7MQP6|RL7_ENTS8 RecName: Full=50S ribosomal protein L7/L12
 gi|156534070|gb|ABU78896.1| hypothetical protein ESA_03692 [Cronobacter sakazakii ATCC BAA-894]
          Length = 122

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 88/122 (72%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A   A    AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAAGPA---EAAEEKTEFDVILKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 63  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|15232274|ref|NP_189421.1| RPL12-A (RIBOSOMAL PROTEIN L12-A); structural constituent of
           ribosome [Arabidopsis thaliana]
 gi|548653|sp|P36210|RK121_ARATH RecName: Full=50S ribosomal protein L12-1, chloroplastic; AltName:
           Full=CL12-A; Flags: Precursor
 gi|468771|emb|CAA48181.1| ribosomal protein L12 [Arabidopsis thaliana]
 gi|11994488|dbj|BAB02529.1| 50S ribosomal protein L12-like [Arabidopsis thaliana]
 gi|15450974|gb|AAK96758.1| 50s ribosomal protein L12-like [Arabidopsis thaliana]
 gi|15810119|gb|AAL07203.1| putative 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|22530940|gb|AAM96974.1| 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|23198422|gb|AAN15738.1| 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|29824165|gb|AAP04043.1| putative 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|30102916|gb|AAP21376.1| At3g27830 [Arabidopsis thaliana]
          Length = 191

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 11/129 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------EKT 56
           IE I  ++SSLTL EA  L   L+ ++GVS   P+S+    AA A  A         E+T
Sbjct: 66  IEKIGSEISSLTLEEARILVDYLQDKFGVS---PLSLAPAAAAVAAPADGGAAAVVEEQT 122

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK L
Sbjct: 123 EFDVVINEVPS-SSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTL 181

Query: 117 EDAGATVEL 125
           E+AGA V +
Sbjct: 182 EEAGAKVSI 190


>gi|269215903|ref|ZP_06159757.1| ribosomal protein L7/L12 [Slackia exigua ATCC 700122]
 gi|269130853|gb|EEZ61929.1| ribosomal protein L7/L12 [Slackia exigua ATCC 700122]
          Length = 134

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 86/122 (70%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  +TL+EA+EL K +E+ +GVSA+AP +V A  A    +AA+E+TEF+VVL+G
Sbjct: 16  EEILEALKEMTLLEASELVKAIEETFGVSAAAPAAVAAAPAEGG-AAAAEQTEFDVVLEG 74

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KIAVIK VR IT LGLKEAK  VE AP  +   + K +A E+K+KLE AGA V 
Sbjct: 75  FGD--NKIAVIKVVREITGLGLKEAKAAVEGAPAPIVEAVDKAKAEEVKEKLEAAGAAVT 132

Query: 125 LR 126
           ++
Sbjct: 133 VK 134


>gi|16762301|ref|NP_457918.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16767406|ref|NP_463021.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29143789|ref|NP_807131.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56415979|ref|YP_153054.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161617289|ref|YP_001591255.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|162139513|ref|YP_219023.2| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|194442513|ref|YP_002043404.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194448299|ref|YP_002048139.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194472940|ref|ZP_03078924.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194735282|ref|YP_002117055.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195874361|ref|ZP_02701753.2| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197248222|ref|YP_002149063.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197262243|ref|ZP_03162317.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197364906|ref|YP_002144543.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198245041|ref|YP_002218069.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200387789|ref|ZP_03214401.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205354445|ref|YP_002228246.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205360801|ref|ZP_02686566.2| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|207859330|ref|YP_002245981.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213163871|ref|ZP_03349581.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213418781|ref|ZP_03351847.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213582506|ref|ZP_03364332.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213622759|ref|ZP_03375542.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213852736|ref|ZP_03382268.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224585694|ref|YP_002639493.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|238913731|ref|ZP_04657568.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|283836722|ref|ZP_06356463.1| ribosomal protein L7/L12 [Citrobacter youngae ATCC 29220]
 gi|289810153|ref|ZP_06540782.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|289826712|ref|ZP_06545677.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|61233299|sp|P0A299|RL7_SALTY RecName: Full=50S ribosomal protein L7/L12; AltName: Full=L8
 gi|61233305|sp|P0A2A0|RL7_SALTI RecName: Full=50S ribosomal protein L7/L12; AltName: Full=L8
 gi|81599688|sp|Q5PK94|RL7_SALPA RecName: Full=50S ribosomal protein L7/L12
 gi|109893798|sp|Q57H70|RL7_SALCH RecName: Full=50S ribosomal protein L7/L12
 gi|189043008|sp|A9N0J3|RL7_SALPB RecName: Full=50S ribosomal protein L7/L12
 gi|226733730|sp|B5F0W6|RL7_SALA4 RecName: Full=50S ribosomal protein L7/L12
 gi|226733731|sp|B5FQJ8|RL7_SALDC RecName: Full=50S ribosomal protein L7/L12
 gi|226733732|sp|B5QYD7|RL7_SALEP RecName: Full=50S ribosomal protein L7/L12
 gi|226733733|sp|B5RFK2|RL7_SALG2 RecName: Full=50S ribosomal protein L7/L12
 gi|226734102|sp|B4TCS3|RL7_SALHS RecName: Full=50S ribosomal protein L7/L12
 gi|226734473|sp|B4T0Y8|RL7_SALNS RecName: Full=50S ribosomal protein L7/L12
 gi|226734474|sp|B5BJQ2|RL7_SALPK RecName: Full=50S ribosomal protein L7/L12
 gi|226734475|sp|B4TQJ4|RL7_SALSV RecName: Full=50S ribosomal protein L7/L12
 gi|254806392|sp|C0Q2R6|RL7_SALPC RecName: Full=50S ribosomal protein L7/L12
 gi|25295084|pir||AF0933 50S ribosomal chain protein L7/L12 [imported] - Salmonella enterica
           subsp. enterica serovar Typhi (strain CT18)
 gi|47917|emb|CAA37246.1| unnamed protein product [Salmonella enterica subsp. enterica
           serovar Typhimurium]
 gi|6960338|gb|AAF33498.1| Salmonella typhimurium 50S ribosomal protein L7 (RPLL) (SW:P18981);
           contains similarity to Pfam domain PF00542
           (Ribosomal_L12), Score=133.2, E=4.6e-36, N=1 [Salmonella
           enterica subsp. enterica serovar Typhimurium str. LT2]
 gi|16422710|gb|AAL22980.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|16504605|emb|CAD09488.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Typhi]
 gi|29139424|gb|AAO70991.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56130236|gb|AAV79742.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|161366653|gb|ABX70421.1| hypothetical protein SPAB_05140 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194401176|gb|ACF61398.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194406603|gb|ACF66822.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194459304|gb|EDX48143.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194710784|gb|ACF90005.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195629009|gb|EDX48401.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197096383|emb|CAR61988.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|197211925|gb|ACH49322.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197240498|gb|EDY23118.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197939557|gb|ACH76890.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|199604887|gb|EDZ03432.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Virchow str. SL491]
 gi|205274226|emb|CAR39245.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|205346973|gb|EDZ33604.1| ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206711133|emb|CAR35507.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|224470222|gb|ACN48052.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261249256|emb|CBG27118.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. D23580]
 gi|267996450|gb|ACY91335.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|291067269|gb|EFE05378.1| ribosomal protein L7/L12 [Citrobacter youngae ATCC 29220]
 gi|301160648|emb|CBW20179.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312915257|dbj|BAJ39231.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320088583|emb|CBY98342.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
 gi|321223352|gb|EFX48419.1| LSU ribosomal protein L7/L12 P1/P2 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322616262|gb|EFY13172.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617295|gb|EFY14197.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625933|gb|EFY22748.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626669|gb|EFY23471.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631504|gb|EFY28261.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635217|gb|EFY31935.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642616|gb|EFY39210.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646789|gb|EFY43293.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322650788|gb|EFY47181.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322655913|gb|EFY52214.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322657312|gb|EFY53591.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665574|gb|EFY61759.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669757|gb|EFY65902.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670964|gb|EFY67096.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322679212|gb|EFY75265.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322679370|gb|EFY75417.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322688137|gb|EFY84101.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322717102|gb|EFZ08673.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323132487|gb|ADX19917.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323193405|gb|EFZ78615.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323200675|gb|EFZ85748.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202164|gb|EFZ87220.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323209275|gb|EFZ94210.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211600|gb|EFZ96437.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323218062|gb|EGA02775.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323221351|gb|EGA05773.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323225722|gb|EGA09943.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230990|gb|EGA15107.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323235772|gb|EGA19854.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323240086|gb|EGA24132.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323242581|gb|EGA26603.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249711|gb|EGA33618.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323252594|gb|EGA36435.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256912|gb|EGA40624.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323262066|gb|EGA45630.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323263929|gb|EGA47443.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323268458|gb|EGA51928.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326625862|gb|EGE32207.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|326629578|gb|EGE35921.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 121

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 88/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|113460318|ref|YP_718379.1| 50S ribosomal protein L7/L12 [Haemophilus somnus 129PT]
 gi|170718529|ref|YP_001783394.1| 50S ribosomal protein L7/L12 [Haemophilus somnus 2336]
 gi|123131885|sp|Q0I0U9|RL7_HAES1 RecName: Full=50S ribosomal protein L7/L12
 gi|189042998|sp|B0UUZ7|RL7_HAES2 RecName: Full=50S ribosomal protein L7/L12
 gi|112822361|gb|ABI24450.1| LSU ribosomal protein L12P [Haemophilus somnus 129PT]
 gi|168826658|gb|ACA32029.1| ribosomal protein L7/L12 [Haemophilus somnus 2336]
          Length = 122

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S T+ E  EL   +E+++GVSA+A    VA   A     A EKTEF+VVL  
Sbjct: 6   EQIIEAIASKTVTEIVELISAMEEKFGVSAAAAAVAVAAGPA---EVAEEKTEFDVVLA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 62  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKAEAEALKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|255262992|ref|ZP_05342334.1| ribosomal protein L7/L12 [Thalassiobium sp. R2A62]
 gi|255105327|gb|EET48001.1| ribosomal protein L7/L12 [Thalassiobium sp. R2A62]
          Length = 124

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  A+    +VA      G+AA EKTEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMVAGGGDAGGAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +   +KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA ++K KLE A
Sbjct: 61  VVLK--NAGAQKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|270308259|ref|YP_003330317.1| ribosomal protein L7/L12 [Dehalococcoides sp. VS]
 gi|270154151|gb|ACZ61989.1| ribosomal protein L7/L12 [Dehalococcoides sp. VS]
          Length = 124

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 87/124 (70%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           I+ ++  +  +T+IE +EL K LEKE+GVSA+  V+  A     A +AA E KTEF V+L
Sbjct: 3   IDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAAPAAGGGAAVAAAEEEKTEFNVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K  D    KI VIK VR +T LGLKEAK++VE+APK++K  +SK+EA+  KK LE AGAT
Sbjct: 63  K--DVGANKINVIKAVRELTSLGLKEAKDMVEAAPKAVKENVSKEEADAAKKALEAAGAT 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEIK 124


>gi|15232276|ref|NP_189423.1| RPL12-C (ribosomal protein l12-c); structural constituent of
           ribosome [Arabidopsis thaliana]
 gi|21431811|sp|P36212|RK123_ARATH RecName: Full=50S ribosomal protein L12-3, chloroplastic; AltName:
           Full=CL12-C; Flags: Precursor
 gi|11994490|dbj|BAB02531.1| 50S ribosomal protein L12-like [Arabidopsis thaliana]
 gi|14335124|gb|AAK59841.1| AT3g27850/K16N12_7 [Arabidopsis thaliana]
 gi|22530924|gb|AAM96966.1| 50S ribosomal protein L12-C [Arabidopsis thaliana]
 gi|23506071|gb|AAN28895.1| At3g27850/K16N12_7 [Arabidopsis thaliana]
          Length = 187

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 11/129 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------EKT 56
           IE I  ++SSLTL EA  L   L+ ++GVS   P+S+    AA A  A         E+T
Sbjct: 62  IEKIGSEISSLTLEEARILVDYLQDKFGVS---PLSLAPAAAAVAAPADGGAAAVVEEQT 118

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK L
Sbjct: 119 EFDVVINEVPS-SSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTL 177

Query: 117 EDAGATVEL 125
           E+AGA V +
Sbjct: 178 EEAGAKVSI 186


>gi|50119182|ref|YP_048349.1| 50S ribosomal protein L7/L12 [Pectobacterium atrosepticum SCRI1043]
 gi|81646554|sp|Q6DAN1|RL7_ERWCT RecName: Full=50S ribosomal protein L7/L12
 gi|49609708|emb|CAG73141.1| 50S ribosomal protein L7/L12 [Pectobacterium atrosepticum SCRI1043]
          Length = 121

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 85/122 (69%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A       VAA     A EKTEF+VVLK 
Sbjct: 6   DQILEAVAAMSVMDVVELISAMEEKFGVSAAAA----VAVAAGPAEVAEEKTEFDVVLKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR+ T LGLKEAK+LVESAP  +K G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRSATGLGLKEAKDLVESAPAVMKEGVSKDDAESLKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|150003396|ref|YP_001298140.1| 50S ribosomal protein L7/L12 [Bacteroides vulgatus ATCC 8482]
 gi|212695313|ref|ZP_03303441.1| hypothetical protein BACDOR_04853 [Bacteroides dorei DSM 17855]
 gi|237711665|ref|ZP_04542146.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 9_1_42FAA]
 gi|237725893|ref|ZP_04556374.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D4]
 gi|254881314|ref|ZP_05254024.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 4_3_47FAA]
 gi|265753085|ref|ZP_06088654.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_33FAA]
 gi|294777814|ref|ZP_06743258.1| ribosomal protein L7/L12 [Bacteroides vulgatus PC510]
 gi|319640316|ref|ZP_07995041.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_40A]
 gi|166222136|sp|A6KYK4|RL7_BACV8 RecName: Full=50S ribosomal protein L7/L12
 gi|149931820|gb|ABR38518.1| 50S ribosomal protein L7/L12 [Bacteroides vulgatus ATCC 8482]
 gi|212662223|gb|EEB22797.1| hypothetical protein BACDOR_04853 [Bacteroides dorei DSM 17855]
 gi|229435701|gb|EEO45778.1| 50S ribosomal protein L7/L12 [Bacteroides dorei 5_1_36/D4]
 gi|229454360|gb|EEO60081.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 9_1_42FAA]
 gi|254834107|gb|EET14416.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 4_3_47FAA]
 gi|263236271|gb|EEZ21766.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_33FAA]
 gi|294448268|gb|EFG16824.1| ribosomal protein L7/L12 [Bacteroides vulgatus PC510]
 gi|317388091|gb|EFV68945.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_40A]
          Length = 124

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK     K  + V+K V+    LGLKEAK++V+ AP ++K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKSAGAAK--LQVVKAVKEACGLGLKEAKDMVDGAPSTVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|468773|emb|CAA48183.1| ribosomal protein L12 [Arabidopsis thaliana]
          Length = 187

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 79/129 (61%), Gaps = 11/129 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------EKT 56
           IE I  ++SSLTL EA  L   L+ ++GVS   P+S+    AA A  A         E+T
Sbjct: 62  IEKIGSEISSLTLEEARILVDYLQDKFGVS---PLSLAPAAAAVAAPADGGAAAVVEEQT 118

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK L
Sbjct: 119 EFDVVINEVPS-SSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTL 177

Query: 117 EDAGATVEL 125
           E+AGA V +
Sbjct: 178 EEAGAKVSI 186


>gi|251793499|ref|YP_003008228.1| 50S ribosomal protein L7/L12 [Aggregatibacter aphrophilus NJ8700]
 gi|247534895|gb|ACS98141.1| ribosomal protein L7/L12 [Aggregatibacter aphrophilus NJ8700]
          Length = 123

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A V+      A   +AA EKTEF+VVL  
Sbjct: 6   EQIIEAIASKSVTEIVELITAMEEKFGVSAAAAVAAAPAGGAA--AAAEEKTEFDVVLA- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP  LK G++K EA  +KK+LE+AGA VE
Sbjct: 63  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGIAKAEAEALKKELEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|307823433|ref|ZP_07653662.1| ribosomal protein L7/L12 [Methylobacter tundripaludum SV96]
 gi|307735418|gb|EFO06266.1| ribosomal protein L7/L12 [Methylobacter tundripaludum SV96]
          Length = 122

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  +L   +E+++GVSA+  V+     +A   +A  E+TEF+V++  
Sbjct: 6   EDILEAVSNMTVMEIVDLISAMEEKFGVSAAVAVAAAPAASA---AAVEEQTEFDVIMTS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F +   K+AVIK VR IT LGLKEAK+ VE  P ++K  +SK EA ++KK+L DAGATVE
Sbjct: 63  FGE--NKVAVIKAVRGITGLGLKEAKDAVEGVPTTVKEAVSKAEAEDVKKQLVDAGATVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|78358035|ref|YP_389484.1| 50S ribosomal protein L7/L12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|109893762|sp|Q30X07|RL7_DESDG RecName: Full=50S ribosomal protein L7/L12
 gi|78220440|gb|ABB39789.1| LSU ribosomal protein L12P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 127

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           MS+I  E +VE ++ +T++E +E  K LE+++GVSA+APV+ +A   AEA + A E KTE
Sbjct: 1   MSDITKEQVVEFIAGMTVLELSEFIKELEEKFGVSAAAPVAAMAAAPAEAAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       KIAVIK VRA+T LGLKEAKE V+  P +LK  +SKD+A E  K+L+
Sbjct: 61  FDVILK--SPGANKIAVIKVVRALTGLGLKEAKEKVDGTPSTLKEAVSKDDAEEAAKQLK 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAEVEVK 127


>gi|325982733|ref|YP_004295135.1| 50S ribosomal protein L7/L12 [Nitrosomonas sp. AL212]
 gi|325532252|gb|ADZ26973.1| ribosomal protein L7/L12 [Nitrosomonas sp. AL212]
          Length = 126

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 91/123 (73%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           + I+E ++++T++E ++L K +E+++GVSA+A V+V A  +   G+AA  E+TEF V+L 
Sbjct: 6   DEILEAIANMTVLELSKLIKEMEEKFGVSAAAAVAVAAAPSGGGGAAAEAEQTEFTVILS 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              + K  + VIK VRA+T LGLKEAK+LV+ APK +K G SKDEA+ ++K+L +AGAT 
Sbjct: 66  SAGESK--VNVIKVVRAVTGLGLKEAKDLVDGAPKPVKEGASKDEADSIQKQLVEAGATC 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|327438260|dbj|BAK14625.1| ribosomal protein L7/L12 [Solibacillus silvestris StLB046]
          Length = 119

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 93/124 (75%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E  +L K +E+E+GV+A+APV+VVA  A    +AA EKTEF+VVL
Sbjct: 2   NNEQILEAIKAMTVLELNDLVKAIEEEFGVTAAAPVAVVAGGA----AAAEEKTEFDVVL 57

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR IT LGLKEAKE+V++APK+LK G+SKDEA  +K KLE+ GA+
Sbjct: 58  ASAGG--EKIKVIKVVREITGLGLKEAKEVVDNAPKALKEGVSKDEAEAIKAKLEEVGAS 115

Query: 123 VELR 126
           VE++
Sbjct: 116 VEVK 119


>gi|315635147|ref|ZP_07890425.1| ribosomal protein L7/L12 [Aggregatibacter segnis ATCC 33393]
 gi|315476109|gb|EFU66863.1| ribosomal protein L7/L12 [Aggregatibacter segnis ATCC 33393]
          Length = 123

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A V+      A   +AA EKTEF+VVL  
Sbjct: 6   EQIIEAIASKSVTEIVELIAAMEEKFGVSAAAAVAAAPAGGAA--AAAEEKTEFDVVLA- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP  LK G++K EA  +KK+LE+AGA VE
Sbjct: 63  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGIAKAEAEALKKELEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|297815046|ref|XP_002875406.1| ribosomal protein L12-C [Arabidopsis lyrata subsp. lyrata]
 gi|297321244|gb|EFH51665.1| ribosomal protein L12-C [Arabidopsis lyrata subsp. lyrata]
          Length = 186

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 81/126 (64%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--EAGSAA--SEKTEFE 59
           IE I  ++SSLTL EA  L   L+ ++GVS  +     A VAA  + G+AA   E+TEF+
Sbjct: 61  IEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPSDGGAAAVVEEQTEFD 120

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+A
Sbjct: 121 VVINEVPS-SSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGVTKDEAEEAKKTLEEA 179

Query: 120 GATVEL 125
           GA V +
Sbjct: 180 GAKVSI 185


>gi|261819565|ref|YP_003257671.1| ribosomal protein L7/L12 [Pectobacterium wasabiae WPP163]
 gi|261603578|gb|ACX86064.1| ribosomal protein L7/L12 [Pectobacterium wasabiae WPP163]
          Length = 121

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A      A EKTEF+VVLK 
Sbjct: 6   DQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGPA----EVAEEKTEFDVVLKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  +K G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GANKVAVIKAVRGATGLGLKEAKDLVESAPAVMKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|163839744|ref|YP_001624149.1| 50S ribosomal protein L12P (L7/L12) [Renibacterium salmoninarum
           ATCC 33209]
 gi|162953220|gb|ABY22735.1| LSU ribosomal protein L12P (L7/L12) [Renibacterium salmoninarum
           ATCC 33209]
          Length = 126

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           ++N E ++E    LT+IE +E  K+ E+ + V+A+A         +   +A  EK  F+V
Sbjct: 4   LTNDE-LIEAFKELTIIELSEFVKQFEETFEVTAAAVAVAGPAGCSGEAAAEEEKDSFDV 62

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+   +  KKIAVIKEVRA+T LGLKEAK++V++APK++  G +K+ A + K +LE+AG
Sbjct: 63  ILESAGE--KKIAVIKEVRALTSLGLKEAKDVVDAAPKAVLEGATKEAAEKAKAQLEEAG 120

Query: 121 ATVELR 126
           ATV L+
Sbjct: 121 ATVTLK 126


>gi|313204191|ref|YP_004042848.1| LSU ribosomal protein l12p [Paludibacter propionicigenes WB4]
 gi|312443507|gb|ADQ79863.1| LSU ribosomal protein L12P [Paludibacter propionicigenes WB4]
          Length = 124

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA   A A     EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAGPAAAAEVVEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       K+A++K V+ +T LGLKEAK++V++AP  +K G SKDEA  +KK+L + G
Sbjct: 61  VLKAA--GANKLAIVKLVKELTGLGLKEAKDMVDAAPSVIKEGASKDEAEALKKQLVEGG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|261417597|ref|YP_003251279.1| 50S ribosomal protein L7/L12 [Geobacillus sp. Y412MC61]
 gi|297528472|ref|YP_003669747.1| ribosomal protein L7/L12 [Geobacillus sp. C56-T3]
 gi|319765255|ref|YP_004130756.1| ribosomal protein L7/L12 [Geobacillus sp. Y412MC52]
 gi|261374054|gb|ACX76797.1| ribosomal protein L7/L12 [Geobacillus sp. Y412MC61]
 gi|297251724|gb|ADI25170.1| ribosomal protein L7/L12 [Geobacillus sp. C56-T3]
 gi|317110121|gb|ADU92613.1| ribosomal protein L7/L12 [Geobacillus sp. Y412MC52]
          Length = 122

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 91/122 (74%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA A  AA+EKTEF+V+L  
Sbjct: 4   EQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGA-EAAAEKTEFDVILA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+LV++ PK +K G++K+EA E+K KLE+AGA VE
Sbjct: 62  -DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEEAEEIKAKLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|121997657|ref|YP_001002444.1| 50S ribosomal protein L7/L12 [Halorhodospira halophila SL1]
 gi|166222174|sp|A1WVD0|RL7_HALHL RecName: Full=50S ribosomal protein L7/L12
 gi|121589062|gb|ABM61642.1| LSU ribosomal protein L12P [Halorhodospira halophila SL1]
          Length = 128

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/125 (41%), Positives = 83/125 (66%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           + I+E +++++++E  EL + +E+++GV+A+A V+         G        +TEF+V+
Sbjct: 6   DEILESIANMSVMEVVELIEAMEEKFGVTAAAAVAAAPAAGGGGGDEGGAAEEQTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D   K+ VIK VR +T LGLKEAKE+VE  P  +K G SK+EA+++K KLE+AGA
Sbjct: 66  LSSHGD--NKVGVIKAVRGVTGLGLKEAKEVVEGCPAPIKEGASKEEADDIKAKLEEAGA 123

Query: 122 TVELR 126
           +VEL+
Sbjct: 124 SVELK 128


>gi|320536848|ref|ZP_08036843.1| ribosomal protein L7/L12 [Treponema phagedenis F0421]
 gi|320146307|gb|EFW37928.1| ribosomal protein L7/L12 [Treponema phagedenis F0421]
          Length = 131

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+E +   T++E +EL K +E+E+GV+A+APV+VVA  A     AA+  E+TEF V L
Sbjct: 7   EQIIEAIKEKTILELSELIKAMEEEFGVTAAAPVAVVAGGAGAGAGAAAAEEQTEFTVTL 66

Query: 63  KGFDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           K   DP KKIAVIKEVR  +  LGLKEAKELVE APK LK  +SK+EA ++K+ +  AGA
Sbjct: 67  KALADPGKKIAVIKEVRNVVAGLGLKEAKELVEGAPKPLKENVSKEEAEKIKEAMTAAGA 126

Query: 122 TVEL 125
            +E+
Sbjct: 127 VIEI 130


>gi|254509527|ref|ZP_05121594.1| ribosomal protein L7/L12 [Rhodobacteraceae bacterium KLH11]
 gi|221533238|gb|EEE36226.1| ribosomal protein L7/L12 [Rhodobacteraceae bacterium KLH11]
          Length = 124

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+  A+    V+A      G+A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAGGDAGGAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA E+K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEEVKAKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|257784973|ref|YP_003180190.1| 50S ribosomal protein L7/L12 [Atopobium parvulum DSM 20469]
 gi|257473480|gb|ACV51599.1| ribosomal protein L7/L12 [Atopobium parvulum DSM 20469]
          Length = 126

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA   + A+ EK+ F+V+L+
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGGAAEAAEEKSNFDVILE 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GF D   KI VIK VRA+T+LGLKEAKE+VE APK++  G  K++A   K +LE+AGATV
Sbjct: 66  GFGD--NKIGVIKVVRALTNLGLKEAKEVVEGAPKAVLEGAKKEDAEAAKAQLEEAGATV 123

Query: 124 ELR 126
            L+
Sbjct: 124 TLK 126


>gi|325267350|ref|ZP_08134011.1| 50S ribosomal protein L7/L12 [Kingella denitrificans ATCC 33394]
 gi|324981145|gb|EGC16796.1| 50S ribosomal protein L7/L12 [Kingella denitrificans ATCC 33394]
          Length = 124

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  LT++E  EL K  E+++GVSA+A           A  AA  KTEF+V+L  
Sbjct: 6   EDILNAVEQLTVMELNELVKAFEEKFGVSAAAVAVAGPAAGGAA-GAAEAKTEFDVILAA 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK+LV+ APK+LK G+S+ EA+++KK+LE+AGA VE
Sbjct: 65  SGD--QKVGVIKVVRAITGLGLKEAKDLVDGAPKTLKEGVSQAEADDIKKQLEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|297798266|ref|XP_002867017.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312853|gb|EFH43276.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 179

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 84/136 (61%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
           N+  IV +LS+LTL+E  +L++ L ++  +S    ++ + P  +  GS A +        
Sbjct: 44  NVSKIVNELSNLTLLETMDLTEILRQKLDISELPVMAAMMPGMSFPGSGAGKSTGGEGKE 103

Query: 55  -----KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
                KT F+V+L+ ++    KI VIKEVR ITDLGLKEAK+LVE AP  LK G+SK+EA
Sbjct: 104 KKKEAKTAFDVMLQAYE-AVSKIKVIKEVRTITDLGLKEAKDLVEKAPTLLKKGVSKEEA 162

Query: 110 NEMKKKLEDAGATVEL 125
            ++ +KL+  GA V +
Sbjct: 163 EKIIEKLKAVGAKVAM 178


>gi|297624694|ref|YP_003706128.1| 50S ribosomal protein L7/L12 [Truepera radiovictrix DSM 17093]
 gi|297165874|gb|ADI15585.1| ribosomal protein L7/L12 [Truepera radiovictrix DSM 17093]
          Length = 127

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 6/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E+++E+LS LT++E  +L + L+++WGV A+A +     + A   +A      +TEF V 
Sbjct: 6   EAMIEQLSGLTVLELVDLVEGLKEKWGVEAAAAMPAGMMMPAAGAAAPEAAEEQTEFTVS 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +K   D  KK+ VIKEVRAIT LGLKEAK+LVES    +K G+ K+EA E+K KLE AGA
Sbjct: 66  IKSAGD--KKLNVIKEVRAITSLGLKEAKDLVESGG-VVKEGVGKEEAEEIKSKLEAAGA 122

Query: 122 TVELR 126
           TVE++
Sbjct: 123 TVEVK 127


>gi|89890191|ref|ZP_01201702.1| RplL, 50S ribosomal protein L7/L12 family [Flavobacteria bacterium
           BBFL7]
 gi|89518464|gb|EAS21120.1| RplL, 50S ribosomal protein L7/L12 family [Flavobacteria bacterium
           BBFL7]
          Length = 124

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 86/127 (67%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    +A  A    +AA E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAMAGPAGGGDAAADEQTEFDV 60

Query: 61  VLKGFDDPKK-KIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +LK    P   K+AV+K V+ +T  GLK+AK+LV++AP  +K G+SKDEA  +K +LE+A
Sbjct: 61  ILKA---PGGAKLAVVKLVKELTGAGLKDAKDLVDNAPSPIKEGVSKDEAEALKAQLEEA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAEVELK 124


>gi|288801080|ref|ZP_06406536.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332014|gb|EFC70496.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 125

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (67%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I++I E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+A  E KT F+
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKEEYGIEPAAAAVAVAAGPAAAGAAGGEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    K+ V+K V+    LGLKEAK+LV+ AP ++K GLSKDEA  +KK +E+A
Sbjct: 61  VVLT--DAGAAKLQVVKAVKEACGLGLKEAKDLVDGAPATIKEGLSKDEAENLKKAIEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|52694920|gb|AAU85611.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
          Length = 123

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 60/79 (75%), Gaps = 3/79 (3%)

Query: 49  GSAASE-KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
           GS  SE +TEF+V+L  F + K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK 
Sbjct: 47  GSTDSEEQTEFDVILMSFGNSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKS 104

Query: 108 EANEMKKKLEDAGATVELR 126
           +A E+KKKLE  GA VE++
Sbjct: 105 DAEELKKKLEAVGAKVEVK 123


>gi|56416545|ref|YP_153619.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. St. Maries]
 gi|222474913|ref|YP_002563328.1| ribosomal protein L7/L12 (rplL) [Anaplasma marginale str. Florida]
 gi|254994765|ref|ZP_05276955.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. Mississippi]
 gi|255002886|ref|ZP_05277850.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. Puerto Rico]
 gi|255004017|ref|ZP_05278818.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. Virginia]
 gi|56387777|gb|AAV86364.1| ribosomal protein L7/L12 [Anaplasma marginale str. St. Maries]
 gi|222419049|gb|ACM49072.1| ribosomal protein L7/L12 (rplL) [Anaplasma marginale str. Florida]
          Length = 134

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 80/136 (58%), Gaps = 12/136 (8%)

Query: 1   MSNIE--SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG-----SAAS 53
           MSN++  S+ E++  L L  AA L ++LE + G      ++ + P A  A      S  +
Sbjct: 1   MSNVDLDSLAEQICGLDLCSAAALVEKLEDKLGFPKGGLLTAM-PAAGSAAQGAEDSGGA 59

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVES-APKSLKTG--LSKDEAN 110
           E+TEF V+  G+  P KKI+VIK VR  T LGLKEAK+ VE    + L  G    K EA 
Sbjct: 60  EQTEFVVMFDGYA-PDKKISVIKAVRECTTLGLKEAKDFVEQEGSRELVEGKKYKKAEAE 118

Query: 111 EMKKKLEDAGATVELR 126
           E+KKKLEDAGATV ++
Sbjct: 119 EVKKKLEDAGATVSIK 134


>gi|269123260|ref|YP_003305837.1| 50S ribosomal protein L7/L12 [Streptobacillus moniliformis DSM
           12112]
 gi|268314586|gb|ACZ00960.1| ribosomal protein L7/L12 [Streptobacillus moniliformis DSM 12112]
          Length = 121

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 82/124 (66%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L ++T++E  E+ + +E+ +GVSA         VAA    A  EKT F+VVL
Sbjct: 4   NKEQFIEDLKAMTVLELKEVVEAIEETFGVSAQPVAVAGGAVAA---EAVEEKTNFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G      KIAVIKEVR+IT LGLKEAK+LV++   ++K G SK+EA E+K KLE AGA+
Sbjct: 61  TG--AGANKIAVIKEVRSITGLGLKEAKDLVDNGG-AVKEGASKEEAEEIKGKLEAAGAS 117

Query: 123 VELR 126
           VEL+
Sbjct: 118 VELK 121


>gi|193214889|ref|YP_001996088.1| 50S ribosomal protein L7/L12 [Chloroherpeton thalassium ATCC 35110]
 gi|226733661|sp|B3QYL3|RL7_CHLT3 RecName: Full=50S ribosomal protein L7/L12
 gi|193088366|gb|ACF13641.1| ribosomal protein L7/L12 [Chloroherpeton thalassium ATCC 35110]
          Length = 127

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/130 (46%), Positives = 85/130 (65%), Gaps = 7/130 (5%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KT 56
           M++I+ +VE++  LTL EA+EL K LE+++GVSA APV V       A  AA      KT
Sbjct: 1   MASIDELVEEIGKLTLTEASELVKALEEKFGVSA-APVMVAGGAMPGAAGAAEAPAEEKT 59

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VVLK       KI VIK VRA T LGLKEAK +V+ AP ++K  + K +A ++ K+L
Sbjct: 60  EFDVVLKSAG--ASKINVIKVVRAATGLGLKEAKAVVDEAPSTVKEAMPKADAEKLVKEL 117

Query: 117 EDAGATVELR 126
           ++AGA  E++
Sbjct: 118 KEAGAEAEMK 127


>gi|146299702|ref|YP_001194293.1| 50S ribosomal protein L7/L12 [Flavobacterium johnsoniae UW101]
 gi|189042994|sp|A5FIJ2|RL7_FLAJO RecName: Full=50S ribosomal protein L7/L12
 gi|146154120|gb|ABQ04974.1| 50S ribosomal protein L7/L12 [Flavobacterium johnsoniae UW101]
          Length = 123

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 86/126 (68%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A   VVA    +  +A   +TEF V
Sbjct: 1   MADLKQFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVVVAAGGGDG-AAEEAQTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  D    K+AV+K V+ +T LGLKEAK++V+ AP ++K G+SK+EA  +KK LE+AG
Sbjct: 60  VLK--DAGASKLAVVKLVKELTGLGLKEAKDVVDGAPSNVKEGVSKEEAEGLKKSLEEAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|57234279|ref|YP_181713.1| 50S ribosomal protein L7/L12 [Dehalococcoides ethenogenes 195]
 gi|109893760|sp|Q3Z7T6|RL7_DEHE1 RecName: Full=50S ribosomal protein L7/L12
 gi|57224727|gb|AAW39784.1| ribosomal protein L7/L12 [Dehalococcoides ethenogenes 195]
          Length = 124

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           I+ ++  +  +T+IE +EL K LEKE+GVSA+  V+  A   A   +AA E KTEF V+L
Sbjct: 3   IDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAAPAAGGAAVAAAAEEEKTEFNVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K  D    KI VIK VR +T LGLKEAK++VE+APK++K  +SK+EA+  KK LE AGAT
Sbjct: 63  K--DVGANKINVIKAVRELTSLGLKEAKDMVEAAPKAVKENVSKEEADAAKKALEAAGAT 120

Query: 123 VELR 126
           +E++
Sbjct: 121 IEIK 124


>gi|323490604|ref|ZP_08095809.1| 50S ribosomal protein L7/L12 [Planococcus donghaensis MPA1U2]
 gi|323395696|gb|EGA88537.1| 50S ribosomal protein L7/L12 [Planococcus donghaensis MPA1U2]
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T+++  +L K +E+E+GV+A+AP       AA  G+A +E+TEF+VVL  
Sbjct: 4   EQILESIKEMTVLQLNDLVKAIEEEFGVTAAAP----VAAAAAGGAAEAEQTEFDVVLAS 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D K  I VIK VR +T LGLKEAK LV+ APK++K G+SK++A E+K KLE+ GA+VE
Sbjct: 60  AGDSK--IKVIKAVREVTGLGLKEAKALVDEAPKAIKEGVSKEDAEEIKGKLEEVGASVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|320101661|ref|YP_004177252.1| 50S ribosomal protein L12P [Isosphaera pallida ATCC 43644]
 gi|319748943|gb|ADV60703.1| LSU ribosomal protein L12P [Isosphaera pallida ATCC 43644]
          Length = 134

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 89/127 (70%), Gaps = 6/127 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGV----SASAPVSVVAPVAAEAGSAASEKTEF 58
           NI+++ + L  LT++EA  LS  ++  +G+    +  A V+  A  A EA + A+EKTEF
Sbjct: 9   NIKALGDSLVKLTVLEAKALSDYMKDTYGLEAAAAPVAMVAGPAAAAGEAAAPAAEKTEF 68

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+      +KI VIK VRA T LGLKEAKELVESAPK +K G+SK +A ++KK+LE+
Sbjct: 69  DVILEAAGS--QKINVIKVVRAATSLGLKEAKELVESAPKPVKQGISKADAEKLKKELEE 126

Query: 119 AGATVEL 125
           AGATV++
Sbjct: 127 AGATVKI 133


>gi|228937402|ref|ZP_04100048.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|228970288|ref|ZP_04130947.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228976858|ref|ZP_04137270.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis Bt407]
 gi|229015502|ref|ZP_04172500.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH1273]
 gi|229021711|ref|ZP_04178293.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH1272]
 gi|229027948|ref|ZP_04184101.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH1271]
 gi|229074161|ref|ZP_04207207.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock4-18]
 gi|229094822|ref|ZP_04225827.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock3-29]
 gi|229100899|ref|ZP_04231703.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock3-28]
 gi|229113776|ref|ZP_04243211.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock1-3]
 gi|229159273|ref|ZP_04287297.1| 50S ribosomal protein L7/L12 [Bacillus cereus R309803]
 gi|229170951|ref|ZP_04298552.1| 50S ribosomal protein L7/L12 [Bacillus cereus MM3]
 gi|228612491|gb|EEK69712.1| 50S ribosomal protein L7/L12 [Bacillus cereus MM3]
 gi|228624165|gb|EEK80967.1| 50S ribosomal protein L7/L12 [Bacillus cereus R309803]
 gi|228669647|gb|EEL25054.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock1-3]
 gi|228682478|gb|EEL36551.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock3-28]
 gi|228688565|gb|EEL42438.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock3-29]
 gi|228708931|gb|EEL61058.1| 50S ribosomal protein L7/L12 [Bacillus cereus Rock4-18]
 gi|228733336|gb|EEL84165.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH1271]
 gi|228739579|gb|EEL89993.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH1272]
 gi|228745789|gb|EEL95793.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH1273]
 gi|228782828|gb|EEM30994.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis Bt407]
 gi|228789397|gb|EEM37317.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis serovar
           thuringiensis str. T01001]
 gi|228822235|gb|EEM68217.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis serovar
           berliner ATCC 10792]
 gi|326937894|gb|AEA13790.1| 50S ribosomal protein L7/L12 [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 119

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K +E+E+GV+A+AP      VA  AG AA+EKTEF+VVL  
Sbjct: 4   EQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAP----VAVAGGAGEAAAEKTEFDVVLAS 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR IT LGLKEAKELV++ PK++K G+SK+EA EMK KLE+ GA VE
Sbjct: 60  --AGAQKIKVIKAVREITGLGLKEAKELVDNTPKAIKEGVSKEEAEEMKAKLEEVGAAVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|119953181|ref|YP_945390.1| 50S ribosomal protein L7/L12 [Borrelia turicatae 91E135]
 gi|254806263|sp|A1QZH8|RL7_BORT9 RecName: Full=50S ribosomal protein L7/L12
 gi|119861952|gb|AAX17720.1| LSU ribosomal protein L12P (L7/L12) [Borrelia turicatae 91E135]
          Length = 123

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 73/117 (62%), Gaps = 20/117 (17%)

Query: 18  EAAELSKRLEKEWGVS--------ASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPK 69
           E  EL   +E+++GV+         S P SV           A E+TEF+V+L  F D K
Sbjct: 19  EVVELITAIEEKFGVTAAAVAVAAGSGPASV----------DAEEQTEFDVMLMSFGDSK 68

Query: 70  KKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
             I VIKEVRA+T LGL EAK LVE+APK++K G+SK +A ++KKKLE  GA VE++
Sbjct: 69  --INVIKEVRAVTGLGLGEAKALVEAAPKAIKEGVSKADAEDIKKKLEAVGAKVEIK 123


>gi|302877793|ref|YP_003846357.1| 50S ribosomal protein L7/L12 [Gallionella capsiferriformans ES-2]
 gi|302580582|gb|ADL54593.1| ribosomal protein L7/L12 [Gallionella capsiferriformans ES-2]
          Length = 123

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 94/126 (74%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           ++N E +++ ++S+T++E +EL K++E+++GVSA+A     A  AA   +AA+E++EF+V
Sbjct: 3   ITNAE-LMDAVASMTVLELSELIKQMEEKFGVSAAAVAV--AGPAAGPAAAAAEQSEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L    D   K++VIK VR IT LGLKEAK+LV++APK +K G+SK +A+ + K+L +AG
Sbjct: 60  ILATVGD--NKVSVIKAVRVITGLGLKEAKDLVDAAPKVVKEGVSKADADAIAKQLIEAG 117

Query: 121 ATVELR 126
           AT E++
Sbjct: 118 ATAEVK 123


>gi|311748522|ref|ZP_07722307.1| ribosomal protein L7/L12 [Algoriphagus sp. PR1]
 gi|126577038|gb|EAZ81286.1| ribosomal protein L7/L12 [Algoriphagus sp. PR1]
          Length = 127

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 86/129 (66%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           M+++  + ++L +LT+ E  EL+  L+ ++G+  +A    VA  AA      +   EKT 
Sbjct: 1   MADLTQLADQLVNLTVKEVKELTDILKDQYGIEPAAAAVAVAGPAAGGADGGAAEEEKTS 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       K+AV+K V+ +T LGLK+AKELV+SAPK+LK G++KDEA  +KK LE
Sbjct: 61  FDVILKAA--GASKLAVVKLVKELTGLGLKDAKELVDSAPKALKEGIAKDEAEGLKKSLE 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAEVEIK 127


>gi|325285441|ref|YP_004261231.1| 50S ribosomal protein L7/L12 [Cellulophaga lytica DSM 7489]
 gi|324320895|gb|ADY28360.1| 50S ribosomal protein L7/L12 [Cellulophaga lytica DSM 7489]
          Length = 125

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++   E+L +LT+ E  EL+  L+ E+G+  A+A V+V A   A  G AA E+TEF+
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELANILKDEYGIEPAAAAVAVAAGGGAAGGEAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+AV+K V+ +T LGLK+AK++V+SAPK++K G+SKDEA  +KK LE+A
Sbjct: 61  VVLKSA--GASKLAVVKLVKELTGLGLKDAKDIVDSAPKAVKEGVSKDEAEGIKKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|302336392|ref|YP_003801599.1| LSU ribosomal protein L12P [Olsenella uli DSM 7084]
 gi|301320232|gb|ADK68719.1| LSU ribosomal protein L12P [Olsenella uli DSM 7084]
          Length = 125

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA A +A  EKT F+V L  
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGAAAAEEEKTNFDVELTA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KIAVIK VR++T LGLKEAKE VESAPK L  G  K++A   K +LE+AGATV 
Sbjct: 66  FGD--NKIAVIKVVRSLTSLGLKEAKEAVESAPKVLIEGAKKEDAEAAKAQLEEAGATVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|74316415|ref|YP_314155.1| 50S ribosomal protein L7/L12 [Thiobacillus denitrificans ATCC
           25259]
 gi|109893815|sp|Q3SLQ7|RL7_THIDA RecName: Full=50S ribosomal protein L7/L12
 gi|74055910|gb|AAZ96350.1| Ribosomal protein L7/L12 [Thiobacillus denitrificans ATCC 25259]
          Length = 127

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 92/122 (75%), Gaps = 4/122 (3%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVLKG 64
           I++ ++ +T++E +EL K +E ++GVSA+A    VA  AA AG+AA+  E+TEF V+L  
Sbjct: 8   ILDAIAGMTVLELSELIKEMEDKFGVSAAAAAVAVAAPAAGAGAAAAAEEQTEFTVMLNS 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             +  KK+ VIK VRA T LGLKEAK+LV+ APK++K G+SK +A+ +KK+LE+AGA+VE
Sbjct: 68  AGE--KKVEVIKVVRAATGLGLKEAKDLVDGAPKAVKEGVSKADADALKKQLEEAGASVE 125

Query: 125 LR 126
           ++
Sbjct: 126 VK 127


>gi|95930694|ref|ZP_01313427.1| ribosomal protein L7/L12 [Desulfuromonas acetoxidans DSM 684]
 gi|95133174|gb|EAT14840.1| ribosomal protein L7/L12 [Desulfuromonas acetoxidans DSM 684]
          Length = 127

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 97/129 (75%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           M++I  E ++E + +++++E +EL K LE ++GVSA+APV+V A   A    AA+E KTE
Sbjct: 1   MADITKEQVIEFIENMSVLELSELVKELEDKFGVSAAAPVAVAAAGPAGDAGAAAEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL G  D  KKI VIK VR++T LGLKEAKE+V+ AP ++K   +K+EA ++KK+LE
Sbjct: 61  FDVVLTGAGD--KKINVIKVVRSVTGLGLKEAKEMVDGAPSTVKEAAAKEEAEDIKKQLE 118

Query: 118 DAGATVELR 126
           +AGA+VEL+
Sbjct: 119 EAGASVELK 127


>gi|323700799|ref|ZP_08112711.1| ribosomal protein L7/L12 [Desulfovibrio sp. ND132]
 gi|323460731|gb|EGB16596.1| ribosomal protein L7/L12 [Desulfovibrio desulfuricans ND132]
          Length = 128

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/130 (51%), Positives = 92/130 (70%), Gaps = 6/130 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KT 56
           M++I  E +VE + ++T+++ +E  K LE  +GV A+AP   VA   A  G AA+E  +T
Sbjct: 1   MADITKEQVVEFIGNMTVLQLSEFIKELEDVFGVEAAAPAVAVAAAPAAGGEAAAEEEQT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VVL G      KIAVIK VRAIT LGLKEAK LV+ APK+LK G+SK+EA+E  K+L
Sbjct: 61  EFDVVLTG--AGANKIAVIKAVRAITGLGLKEAKALVDEAPKALKEGVSKEEADEAAKQL 118

Query: 117 EDAGATVELR 126
           ++AGA VE++
Sbjct: 119 QEAGAEVEVK 128


>gi|218886549|ref|YP_002435870.1| 50S ribosomal protein L7/L12 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226693629|sp|P02393|RL7_DESVM RecName: Full=50S ribosomal protein L7/L12
 gi|218757503|gb|ACL08402.1| ribosomal protein L7/L12 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 127

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 88/129 (68%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           MS+I  E +VE ++++T++E +E  K LE+++GVSA+AP   +        + A E KTE
Sbjct: 1   MSSITKEQVVEFIANMTVLELSEFIKELEEKFGVSAAAPAMAMVAAGPAEAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       KI VIK VRA+T LGLKEAK+ V+ AP +LK  +SK+EA E KK+L 
Sbjct: 61  FDVILKA--AGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAVSKEEAEEAKKQLV 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAEVEVK 127


>gi|203284302|ref|YP_002222042.1| 50S ribosomal protein L7/L12 [Borrelia duttonii Ly]
 gi|203287838|ref|YP_002222853.1| 50S ribosomal protein L7/L12 [Borrelia recurrentis A1]
 gi|226733645|sp|B5RLV0|RL7_BORDL RecName: Full=50S ribosomal protein L7/L12
 gi|226733648|sp|B5RRJ8|RL7_BORRA RecName: Full=50S ribosomal protein L7/L12
 gi|201083745|gb|ACH93336.1| 50S ribosomal protein L7/L12 [Borrelia duttonii Ly]
 gi|201085058|gb|ACH94632.1| 50S ribosomal protein L7/L12 [Borrelia recurrentis A1]
          Length = 123

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVESAPK++K G+SK +A E+K
Sbjct: 53  EQTEFDVMLVSFGDSK--INVIKEVRAITGLGLGEAKALVESAPKAVKEGVSKSDAEEIK 110

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 111 KKLEAVGAKVEIK 123


>gi|309792758|ref|ZP_07687203.1| ribosomal protein L7/L12 [Oscillochloris trichoides DG6]
 gi|308225210|gb|EFO78993.1| ribosomal protein L7/L12 [Oscillochloris trichoides DG6]
          Length = 131

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 89/128 (69%), Gaps = 7/128 (5%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV-----VAPVAAEAGSAASEKTEF 58
           I +I+E + +L ++E  EL K +E +WGV+A+AP+ +      A  AAEA +   EKTEF
Sbjct: 6   IAAIIESIETLNVLELVELKKTMEDKWGVTAAAPMMMGGFAAPAAAAAEAAAPVEEKTEF 65

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK  D    KIAVIK VR +T LGLKEAK+LVE+APK +K  +SK++A   K KL +
Sbjct: 66  DVILK--DVGANKIAVIKVVRELTSLGLKEAKDLVEAAPKPVKEAVSKEDAEAAKAKLAE 123

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 124 AGATVEIK 131


>gi|32034816|ref|ZP_00134928.1| COG0222: Ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|126209185|ref|YP_001054410.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae L20]
 gi|165977156|ref|YP_001652749.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|190151050|ref|YP_001969575.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303249963|ref|ZP_07336165.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303253135|ref|ZP_07339284.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307246647|ref|ZP_07528718.1| hypothetical protein appser1_18430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|307248774|ref|ZP_07530787.1| hypothetical protein appser2_17400 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307251017|ref|ZP_07532942.1| hypothetical protein appser4_17800 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307253393|ref|ZP_07535264.1| hypothetical protein appser6_18870 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307255632|ref|ZP_07537437.1| hypothetical protein appser9_18570 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|307257808|ref|ZP_07539565.1| hypothetical protein appser10_17930 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307260083|ref|ZP_07541795.1| hypothetical protein appser11_18690 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307262212|ref|ZP_07543862.1| hypothetical protein appser12_17570 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307264413|ref|ZP_07545999.1| hypothetical protein appser13_18040 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|166222129|sp|A3N319|RL7_ACTP2 RecName: Full=50S ribosomal protein L7/L12
 gi|226733630|sp|B3GYU7|RL7_ACTP7 RecName: Full=50S ribosomal protein L7/L12
 gi|226733631|sp|B0BSE8|RL7_ACTPJ RecName: Full=50S ribosomal protein L7/L12
 gi|126097977|gb|ABN74805.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|165877257|gb|ABY70305.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 3 str. JL03]
 gi|189916181|gb|ACE62433.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302647817|gb|EFL78024.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302651026|gb|EFL81180.1| 50S ribosomal protein L7/L12 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306852519|gb|EFM84753.1| hypothetical protein appser1_18430 [Actinobacillus pleuropneumoniae
           serovar 1 str. 4074]
 gi|306854701|gb|EFM86891.1| hypothetical protein appser2_17400 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306856957|gb|EFM89088.1| hypothetical protein appser4_17800 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859072|gb|EFM91114.1| hypothetical protein appser6_18870 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306861481|gb|EFM93470.1| hypothetical protein appser9_18570 [Actinobacillus pleuropneumoniae
           serovar 9 str. CVJ13261]
 gi|306863714|gb|EFM95640.1| hypothetical protein appser10_17930 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306865919|gb|EFM97795.1| hypothetical protein appser11_18690 [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306868086|gb|EFM99912.1| hypothetical protein appser12_17570 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870229|gb|EFN01987.1| hypothetical protein appser13_18040 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 122

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E ++S ++ E  EL   +E+++GVSA+A V+      A   +AA EKTEF+V+L  
Sbjct: 6   EQLIEAIASKSVSEIVELIAAMEEKFGVSAAAAVAAAPAAGA---AAAEEKTEFDVILA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 62  -EAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKPEAEALKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|295095128|emb|CBK84218.1| LSU ribosomal protein L12P [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 121

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|77359192|ref|YP_338767.1| 50S ribosomal subunit protein L7/L12 [Pseudoalteromonas
           haloplanktis TAC125]
 gi|109893785|sp|Q3ILQ0|RL7_PSEHT RecName: Full=50S ribosomal protein L7/L12
 gi|76874103|emb|CAI85324.1| 50S ribosomal subunit protein L7/L12 [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 120

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/122 (40%), Positives = 81/122 (66%), Gaps = 7/122 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++   L + +E+++GV+A+A +     VA  A  A  EKTEF+V+L G
Sbjct: 6   DQILDAIAEMSVMDVVALIEAMEEKFGVTAAAGM-----VAGPAAEAVEEKTEFDVILTG 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++ IK VR+ T LGLKEAK LVE+AP  +K G+SK+EA  + K L +AGA VE
Sbjct: 61  AG--ANKVSAIKAVRSATGLGLKEAKALVEAAPTPVKEGISKEEAEALAKDLTEAGAEVE 118

Query: 125 LR 126
           ++
Sbjct: 119 VK 120


>gi|87306546|ref|ZP_01088693.1| probable 50S ribosomal protein L7/L12 [Blastopirellula marina DSM
           3645]
 gi|87290725|gb|EAQ82612.1| probable 50S ribosomal protein L7/L12 [Blastopirellula marina DSM
           3645]
          Length = 135

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 81/124 (65%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           ++++ +K+++LTL +A EL   L+   G+ A+A   V+    A   +  +  +TEF+VV+
Sbjct: 14  LKTLGDKIATLTLKQAVELGDYLKDAHGIEAAAGGGVMMAGPAAGPAEEAAVQTEFDVVM 73

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI+VIK +R+IT LGLKEAKEL E  P  +K G+SK++A ++K +L DAGA 
Sbjct: 74  TSF--GGNKISVIKAIRSITGLGLKEAKELTEGVPSKVKEGVSKEDAEKVKAELTDAGAE 131

Query: 123 VELR 126
           VE++
Sbjct: 132 VEIK 135


>gi|83648860|ref|YP_437295.1| 50S ribosomal protein L7/L12 [Hahella chejuensis KCTC 2396]
 gi|109893766|sp|Q2S904|RL7_HAHCH RecName: Full=50S ribosomal protein L7/L12
 gi|83636903|gb|ABC32870.1| ribosomal protein L7/L12 [Hahella chejuensis KCTC 2396]
          Length = 124

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 91/122 (74%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ +++++   L + +E+++GVSA+A V+V A  AA+A +A  EKTEF+VVL+ 
Sbjct: 6   DDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAVAAAPAADA-AAVEEKTEFDVVLQS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VR IT LGLKEAK+LV+ AP ++K  LSKD+A + KK+LE+AGATVE
Sbjct: 65  A--GEKKVNVIKVVRGITGLGLKEAKDLVDGAPSTVKEALSKDDAEKAKKELEEAGATVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|224531541|ref|ZP_03672173.1| ribosomal protein L7/L12 [Borrelia valaisiana VS116]
 gi|52694896|gb|AAU85599.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana VS116]
 gi|52694898|gb|AAU85600.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
 gi|224511006|gb|EEF81412.1| ribosomal protein L7/L12 [Borrelia valaisiana VS116]
          Length = 124

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F + K  I VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+K
Sbjct: 54  EQTEFDVILMSFGNSK--INVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELK 111

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 112 KKLEAVGAKVEVK 124


>gi|56698331|ref|YP_168704.1| 50S ribosomal protein L7/L12 [Ruegeria pomeroyi DSS-3]
 gi|81558285|sp|Q5LMQ4|RL7_SILPO RecName: Full=50S ribosomal protein L7/L12
 gi|56680068|gb|AAV96734.1| ribosomal protein L7/L12 [Ruegeria pomeroyi DSS-3]
          Length = 125

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/127 (49%), Positives = 84/127 (66%), Gaps = 5/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++++ E +  LTL+EA EL   L+ E+G+  +A   V V A       +A  EKTEF
Sbjct: 1   MADLKALAESIVGLTLLEAQELKNILKDEYGIEPAAGGAVMVAAAGGDAGAAAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G++K EA E+K KLE 
Sbjct: 61  DVVLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVAKAEAEEIKAKLEA 117

Query: 119 AGATVEL 125
           AGA VEL
Sbjct: 118 AGAEVEL 124


>gi|197286615|ref|YP_002152487.1| 50S ribosomal subunit protein L7/L12 [Proteus mirabilis HI4320]
 gi|227355192|ref|ZP_03839601.1| 50S ribosomal subunit protein L7/L12 [Proteus mirabilis ATCC 29906]
 gi|226733722|sp|B4EYV0|RL7_PROMH RecName: Full=50S ribosomal protein L7/L12
 gi|194684102|emb|CAR45498.1| 50S ribosomal subunit protein L7/L12 [Proteus mirabilis HI4320]
 gi|227164701|gb|EEI49555.1| 50S ribosomal subunit protein L7/L12 [Proteus mirabilis ATCC 29906]
          Length = 121

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ +++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LKG
Sbjct: 6   DDILNAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKG 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  I--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|33860761|ref|NP_892322.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
 gi|81576465|sp|Q7V384|RL7_PROMP RecName: Full=50S ribosomal protein L7/L12
 gi|33633703|emb|CAE18660.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus subsp.
           pastoris str. CCMP1986]
          Length = 131

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 77/114 (67%), Gaps = 6/114 (5%)

Query: 18  EAAELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKI 72
           EA+EL K++E+ +GVSA+A   VV     A      G AA EKTEF+V+L+ FD    KI
Sbjct: 19  EASELVKQIEEAFGVSAAASAGVVMAAPGAGGGDGDGGAAEEKTEFDVILESFD-AAAKI 77

Query: 73  AVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
            V+K VR  T LGL +AK LVESAPK++K G++K +A  +KK++E+AG  V L+
Sbjct: 78  KVLKVVRNATGLGLGDAKALVESAPKTVKEGIAKADAETLKKEIEEAGGKVTLK 131


>gi|46015535|pdb|1RQS|A Chain A, Nmr Structure Of C-Terminal Domain Of Ribosomal Protein L7
           From E.Coli
 gi|157830712|pdb|1CTF|A Chain A, Structure Of The C-Terminal Domain Of The Ribosomal
           Protein L7L12 FROM ESCHERICHIA COLI AT 1.7 ANGSTROMS
          Length = 74

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/76 (61%), Positives = 58/76 (76%), Gaps = 2/76 (2%)

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKTEF+V+LK       K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A 
Sbjct: 1   AAEEKTEFDVILKAA--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAE 58

Query: 111 EMKKKLEDAGATVELR 126
            +KK LE+AGA VE++
Sbjct: 59  ALKKALEEAGAEVEVK 74


>gi|150008875|ref|YP_001303618.1| 50S ribosomal protein L7/L12 [Parabacteroides distasonis ATCC 8503]
 gi|166222188|sp|A6LE82|RL7_PARD8 RecName: Full=50S ribosomal protein L7/L12
 gi|149937299|gb|ABR43996.1| ribosomal protein L7/L12 [Parabacteroides distasonis ATCC 8503]
          Length = 125

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/127 (44%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E +EL+  L++E+G+  +A    VA  AA   +AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVSELATILKEEYGIEPAAAAVAVAGPAAGGAAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+A++K V+ +T LGLKEAK++V+SAP ++K G++K +A  MKK+LE+A
Sbjct: 61  VVLKAA--GANKLAIVKLVKELTGLGLKEAKDMVDSAPSAIKEGIAKADAEAMKKQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|255037204|ref|YP_003087825.1| 50S ribosomal protein L7/L12 [Dyadobacter fermentans DSM 18053]
 gi|254949960|gb|ACT94660.1| ribosomal protein L7/L12 [Dyadobacter fermentans DSM 18053]
          Length = 128

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 87/130 (66%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV----SASAPVSVVAPVAAEAGSAASEKT 56
           M+++++  E+L +LT+ E  EL+  L+ E+G+    + +  V+  A  A     A  EKT
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAAILKDEYGIEPAAAGAVMVAGPAGGAGADAPAVEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+V+LK       K+AV+K V+ +T LGLKEAKELV+ APK +K G++KDEA+ +KK+L
Sbjct: 61  SFDVILKSAG--AGKLAVVKLVKDLTGLGLKEAKELVDGAPKPVKEGVAKDEADALKKQL 118

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 119 EEAGAEVEVK 128


>gi|187735537|ref|YP_001877649.1| ribosomal protein L7/L12 [Akkermansia muciniphila ATCC BAA-835]
 gi|226733632|sp|B2UQY3|RL7_AKKM8 RecName: Full=50S ribosomal protein L7/L12
 gi|187425589|gb|ACD04868.1| ribosomal protein L7/L12 [Akkermansia muciniphila ATCC BAA-835]
          Length = 124

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 86/127 (67%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  I E+L +LT++EAA+L K LE++WGVSA+APV+     AA A  A  EKTEF V
Sbjct: 1   MADINKIAEELGTLTILEAADLVKLLEEKWGVSAAAPVAAAGAAAAPA-EAEEEKTEFNV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VL   +    KIAVIK VR +   LGL +AK+LVE  P  +   +SKDEAN  K KLE+A
Sbjct: 60  VLT--EAGANKIAVIKAVREVKAGLGLVDAKKLVEGTPAVILEAVSKDEANAAKAKLEEA 117

Query: 120 GATVELR 126
           GA V+++
Sbjct: 118 GAKVDVK 124


>gi|170770131|ref|ZP_02904584.1| ribosomal protein L7/L12 [Escherichia albertii TW07627]
 gi|170121013|gb|EDS89944.1| ribosomal protein L7/L12 [Escherichia albertii TW07627]
          Length = 122

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 89/122 (72%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  AA    AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPAA---EAAEEKTEFDVILKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 63  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|152973947|ref|YP_001373464.1| 50S ribosomal protein L7/L12 [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|189042980|sp|A7GK11|RL7_BACCN RecName: Full=50S ribosomal protein L7/L12
 gi|152022699|gb|ABS20469.1| ribosomal protein L7/L12 [Bacillus cytotoxicus NVH 391-98]
          Length = 119

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K +E+E+GV+A+APV+VV         AA+EKTEF+V L  
Sbjct: 4   EQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVVGGAG----EAAAEKTEFDVELA- 58

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR IT LGLKEAKELV++ PK +K G SK+EA E+K KLE+ GA VE
Sbjct: 59  -NAGAQKIKVIKVVREITGLGLKEAKELVDNTPKVIKEGASKEEAEEIKAKLEEVGAAVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|261340895|ref|ZP_05968753.1| ribosomal protein L7/L12 [Enterobacter cancerogenus ATCC 35316]
 gi|288316948|gb|EFC55886.1| ribosomal protein L7/L12 [Enterobacter cancerogenus ATCC 35316]
          Length = 121

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|70727466|ref|YP_254382.1| 50S ribosomal protein L7/L12 [Staphylococcus haemolyticus JCSC1435]
 gi|82581598|sp|Q4L3K1|RL7_STAHJ RecName: Full=50S ribosomal protein L7/L12
 gi|68448192|dbj|BAE05776.1| 50S ribosomal protein L7/L12 [Staphylococcus haemolyticus JCSC1435]
          Length = 122

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 92/126 (73%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+  A  AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVA--AAGAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L      K  I V+K V+  T LGLK+AKELV++APK +K G++K+EA ++K++LE+ G
Sbjct: 59  ELTSAGSSK--IKVVKAVKEATGLGLKDAKELVDNAPKVIKEGVAKEEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|72383404|ref|YP_292759.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. NATL2A]
 gi|109893782|sp|Q46HH2|RL7_PROMT RecName: Full=50S ribosomal protein L7/L12
 gi|72003254|gb|AAZ59056.1| LSU ribosomal protein L12P [Prochlorococcus marinus str. NATL2A]
          Length = 131

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (65%), Gaps = 6/114 (5%)

Query: 18  EAAELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKI 72
           EA+EL K++E+ +GVSA+A   VV     A    +   AA EKTEFEVVL+ F+    KI
Sbjct: 19  EASELVKQIEEAFGVSAAASAGVVMAAPGAAAGGDGADAAEEKTEFEVVLESFE-ASSKI 77

Query: 73  AVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
            V+KEVR  T LGL EAK LVE+APK++K G +K++A  +KK +E  G  V L+
Sbjct: 78  KVLKEVRNATGLGLGEAKALVEAAPKTIKEGATKEDAEALKKAIEAVGGKVTLK 131


>gi|307565730|ref|ZP_07628199.1| 50S ribosomal protein L7/L12 [Prevotella amnii CRIS 21A-A]
 gi|307345556|gb|EFN90924.1| 50S ribosomal protein L7/L12 [Prevotella amnii CRIS 21A-A]
          Length = 124

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA   +AA EKT F+V
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAGPAAGGAAAAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +    K+ V+K V+    LGLKEAK+LV+ AP +LK GLSKDEA  +KK +E  G
Sbjct: 61  VLT--EAGPNKLKVVKAVKEACGLGLKEAKDLVDGAPSTLKEGLSKDEAENLKKAIEAEG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|114567851|ref|YP_755005.1| 50S ribosomal protein L7/L12 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122317277|sp|Q0AUH0|RL7_SYNWW RecName: Full=50S ribosomal protein L7/L12
 gi|114338786|gb|ABI69634.1| LSU ribosomal protein L12P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 125

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           MS ++ +++ +  +T++E +EL K LE+E+GVSA+APV+V A  AA A + A E + EF+
Sbjct: 1   MSKVQEVIDIVKQMTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGAVAEAVEEQYEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L      +KKI VIK VR IT LGLKEAK LV+  P  +K  ++K+EANE+K K+E+A
Sbjct: 61  VILTS--SGEKKINVIKVVREITGLGLKEAKTLVDECPNPVKEKITKEEANEIKAKIEEA 118

Query: 120 GATVELR 126
           G +VE++
Sbjct: 119 GGSVEVK 125


>gi|325846461|ref|ZP_08169376.1| ribosomal protein L7/L12 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325481219|gb|EGC84260.1| ribosomal protein L7/L12 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 126

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 87/123 (70%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVL 62
           + +++E++  LT++E +EL K LE+E+ V+A A V+     AA A  A + EK+EF+VVL
Sbjct: 5   VTNLLEEIKELTVLELSELVKALEEEFDVTAQATVAAAPAAAAGAADAGAAEKSEFDVVL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K       KI VIK V+ +T LGLK+AK LV+ APK++K G++KDEA E+K KLE+AGA 
Sbjct: 65  KSA--GASKINVIKVVKEVTGLGLKDAKALVDGAPKAVKEGVAKDEAEELKSKLEEAGAE 122

Query: 123 VEL 125
           VEL
Sbjct: 123 VEL 125


>gi|260436303|ref|ZP_05790273.1| ribosomal protein L7/L12 [Synechococcus sp. WH 8109]
 gi|260414177|gb|EEX07473.1| ribosomal protein L7/L12 [Synechococcus sp. WH 8109]
          Length = 129

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 21  ELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKE 77
           EL K++E+ +GVSA+A   VV      A   G A  EKTEF+V+L+GFD    KI V+K 
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAGGGGDAVEEKTEFDVILEGFD-ASAKIKVLKA 80

Query: 78  VRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           VR  T LGL +AK LVE+APK++K G+SK++A   KK +E+AG  V L+
Sbjct: 81  VREATGLGLGDAKALVEAAPKAVKEGVSKEDAEAAKKAIEEAGGKVTLK 129


>gi|254475143|ref|ZP_05088529.1| ribosomal protein L7/L12 [Ruegeria sp. R11]
 gi|214029386|gb|EEB70221.1| ribosomal protein L7/L12 [Ruegeria sp. R11]
          Length = 124

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+  A+    V+A      G+A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAGGDAGGAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|297620828|ref|YP_003708965.1| 50S ribosomal protein L7/L12 [Waddlia chondrophila WSU 86-1044]
 gi|297376129|gb|ADI37959.1| 50S ribosomal protein L7/L12 [Waddlia chondrophila WSU 86-1044]
          Length = 130

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 87/127 (68%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK--TEFE 59
           +  E +VE+LS LT++E +EL K LE+ WGV A+A   V APVAA AG  A+E+  T+FE
Sbjct: 3   TKTEKLVEELSKLTVLEMSELKKALEEHWGVEAAAAAVVAAPVAAAAGGEAAEEEATDFE 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V L       KKIAVIK VR +T LGLKEAKEL ESAPK LK    K EA E+KKKLEDA
Sbjct: 63  VTLTEVP-ADKKIAVIKIVREVTGLGLKEAKELAESAPKVLKESAPKAEAEEIKKKLEDA 121

Query: 120 GATVELR 126
           GA   L+
Sbjct: 122 GAKAVLK 128


>gi|150015035|ref|YP_001307289.1| ribosomal protein L7/L12 [Clostridium beijerinckii NCIMB 8052]
 gi|189042987|sp|A6LPQ3|RL7_CLOB8 RecName: Full=50S ribosomal protein L7/L12
 gi|149901500|gb|ABR32333.1| ribosomal protein L7/L12 [Clostridium beijerinckii NCIMB 8052]
          Length = 121

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +++++  EL K  E+E+    SA  +VVA  A   G+AA EKTEF+VVL  
Sbjct: 4   EEIIQAIKEMSVLDLNELVKACEEEF--GVSAAAAVVAGGAVAGGAAAEEKTEFDVVLAS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   KI VIK VR IT LGLKEAKE+V+ APK+LK G+SKDEA +MK KL + GAT E
Sbjct: 62  AGD--NKIKVIKVVREITGLGLKEAKEIVDGAPKTLKEGVSKDEAEDMKAKLAEVGATAE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|148263133|ref|YP_001229839.1| 50S ribosomal protein L7/L12 [Geobacter uraniireducens Rf4]
 gi|189042996|sp|A5GAY0|RL7_GEOUR RecName: Full=50S ribosomal protein L7/L12
 gi|146396633|gb|ABQ25266.1| LSU ribosomal protein L12P [Geobacter uraniireducens Rf4]
          Length = 126

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 91/125 (72%), Gaps = 5/125 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           +++ + +EK+S L L   AE+ K LE+++GVSA+APV+V A        AA E+TEF+V+
Sbjct: 7   ADVITFIEKMSVLDL---AEMVKELEEKFGVSAAAPVAVAAVAGPAVAEAAEEQTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK       KIAVIK VRA+T LGLKEAK+LV+ AP+ +K+G+SK+EA E KK+L ++GA
Sbjct: 64  LKA--AGANKIAVIKVVRALTSLGLKEAKDLVDGAPQPVKSGVSKEEAEEAKKQLAESGA 121

Query: 122 TVELR 126
            VE++
Sbjct: 122 EVEVK 126


>gi|307107194|gb|EFN55437.1| hypothetical protein CHLNCDRAFT_133731 [Chlorella variabilis]
          Length = 204

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 55/72 (76%), Gaps = 1/72 (1%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKTEF + L+G+D    KI VIKEVRAIT LGLKEAKELVE+APK +K GL K+EA  ++
Sbjct: 133 EKTEFTLKLEGYD-AAAKIKVIKEVRAITGLGLKEAKELVEAAPKVVKEGLKKEEAEALQ 191

Query: 114 KKLEDAGATVEL 125
           K L DAGA V L
Sbjct: 192 KTLLDAGAKVSL 203


>gi|108773072|ref|YP_635981.1| ribosomal protein L12 [Scenedesmus obliquus]
 gi|122231587|sp|Q1KVU3|RK12_SCEOB RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|88696638|gb|ABD48264.1| ribosomal protein L12 [Scenedesmus obliquus]
          Length = 132

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/132 (41%), Positives = 82/132 (62%), Gaps = 8/132 (6%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------VVAPVAAEAGSAAS 53
           MS +  I+EKL +LTL+EA+EL  ++E+ +GV ASAPV        + A   A+A     
Sbjct: 1   MSTVNEIIEKLKTLTLLEASELVSQIEETFGVDASAPVGGGVMMAAMPAAGGADAAPKEE 60

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F+VVL+      KK+ + K VR I ++ + + KE   + PK+LK  +SK+EA   K
Sbjct: 61  EKTLFDVVLEEIP-ADKKVGIYKVVRNIANIAVNQVKEFTGTLPKALKESVSKEEAEAAK 119

Query: 114 KKLEDAGATVEL 125
           ++LEDAGA V++
Sbjct: 120 QQLEDAGAKVKI 131


>gi|29348144|ref|NP_811647.1| 50S ribosomal protein L7/L12 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253569582|ref|ZP_04846992.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 1_1_6]
 gi|298386173|ref|ZP_06995730.1| ribosomal protein L7/L12 [Bacteroides sp. 1_1_14]
 gi|81586838|sp|Q8A468|RL7_BACTN RecName: Full=50S ribosomal protein L7/L12
 gi|29340047|gb|AAO77841.1| 50S ribosomal protein L7/L12 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251841601|gb|EES69682.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 1_1_6]
 gi|298261401|gb|EFI04268.1| ribosomal protein L7/L12 [Bacteroides sp. 1_1_14]
          Length = 124

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 82/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +A  EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAVEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK     K  + V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKSAGAAK--LQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|253682505|ref|ZP_04863302.1| ribosomal protein L7/L12 [Clostridium botulinum D str. 1873]
 gi|331268404|ref|YP_004394896.1| 50S ribosomal protein L7/L12 [Clostridium botulinum BKT015925]
 gi|253562217|gb|EES91669.1| ribosomal protein L7/L12 [Clostridium botulinum D str. 1873]
 gi|329124954|gb|AEB74899.1| ribosomal protein L7/L12 [Clostridium botulinum BKT015925]
          Length = 121

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 80/122 (65%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  ++++E  EL K  E+E+    SA   V    A     AA EK+EF+VVL  
Sbjct: 4   EEMIQAIKEMSVLELNELVKACEEEF--GVSAAAPVAVAGAVAGAGAAEEKSEFDVVLA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR +T LGLKEAKE+V+ APK+LK G++KD A EMK KLE+ GAT+E
Sbjct: 61  -NSGSQKIKVIKAVRELTGLGLKEAKEIVDGAPKTLKEGVAKDAAEEMKAKLEEVGATIE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|206602626|gb|EDZ39107.1| Ribosomal protein L7/L12 [Leptospirillum sp. Group II '5-way CG']
          Length = 128

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 90/124 (72%), Gaps = 2/124 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           ++ I+  + +LT++E   L K +E+++GVSA+APV+V A  AA A +AA+E KTEF+V+L
Sbjct: 6   VDEILTGIENLTVLELVGLIKNMEEKFGVSAAAPVAVAAAPAATAAAAATEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K      KKI +IK VR +T LGLKEAK+LVE APK LK G +K+EA  MK+KL  AGA 
Sbjct: 66  KS-APADKKINIIKVVRELTSLGLKEAKDLVEGAPKPLKNGATKEEAASMKEKLTAAGAE 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEVK 128


>gi|149177089|ref|ZP_01855697.1| probable 50S ribosomal protein L7/L12 [Planctomyces maris DSM 8797]
 gi|148844154|gb|EDL58509.1| probable 50S ribosomal protein L7/L12 [Planctomyces maris DSM 8797]
          Length = 135

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 88/119 (73%), Gaps = 3/119 (2%)

Query: 9   EKLSSLTLIEAAELSKRLEKEWGV-SASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDD 67
           +K++ LTL++A +L++ L++  G+ +A+    ++A  AAEAG AA EKTEF+V+L GF D
Sbjct: 19  DKIAGLTLLQAKDLAEYLDEVHGIKAAAGGAVMMAGPAAEAGPAAEEKTEFDVILTGFGD 78

Query: 68  PKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
              KI VIK VRA T LGLKEAK+LVE APK LK G+SK++A  + K++++AG T E++
Sbjct: 79  --NKIPVIKIVRAATGLGLKEAKDLVEGAPKPLKEGISKEDAEALVKEVKEAGGTAEVK 135


>gi|56477586|ref|YP_159175.1| 50S ribosomal protein L7/L12 [Aromatoleum aromaticum EbN1]
 gi|81598746|sp|Q5P340|RL7_AZOSE RecName: Full=50S ribosomal protein L7/L12
 gi|56313629|emb|CAI08274.1| 50S ribosomal protein L7/L12 [Aromatoleum aromaticum EbN1]
          Length = 124

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K  E+++GVSA++         A A +   EKTEF+V+L  
Sbjct: 6   EDILEAVGSMTVMELNDLVKAFEEKFGVSAASMAVAAPGAGAAA-APVEEKTEFDVIL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+  IK VRA T LGLKEAK+LV+ APK++K G+SK +A  +KK+LEDAGA VE
Sbjct: 63  LAAGEKKVEAIKVVRAATGLGLKEAKDLVDGAPKAVKEGISKADAEAIKKQLEDAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|34580866|ref|ZP_00142346.1| 50S ribosomal protein L7/L12 [Rickettsia sibirica 246]
 gi|28262251|gb|EAA25755.1| 50S ribosomal protein L7/L12 [Rickettsia sibirica 246]
          Length = 142

 Score = 81.6 bits (200), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV+V A  AA   + A   KTEFE
Sbjct: 18  MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAAGAAAPAAEAVAEKTEFE 77

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D K ++     V+ IT LGL EAK+LV+ APK +K+ + K EA+E+K KLE A
Sbjct: 78  VVLTAAGDKKVEVIK--VVKDITGLGLIEAKKLVDEAPKPIKSNVKKAEADEIKGKLEAA 135

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 136 GAKVELK 142


>gi|90417543|ref|ZP_01225464.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2207]
 gi|90330635|gb|EAS45925.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2207]
          Length = 125

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  EL   +E+++GVSA A V+V A  AA   +AA EKT+F+VVL  
Sbjct: 6   EDILNAIAEMSVMDVVELVSAMEEKFGVSAQAAVAVAAGPAAGGEAAAEEKTDFDVVLAA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VRAIT LGLKEAKELV+ AP ++K   SKD+A E KK LE+AGATVE
Sbjct: 66  V--GEKKVNVIKAVRAITGLGLKEAKELVDGAPSTIKEAASKDDAEEAKKALEEAGATVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|172056130|ref|YP_001812590.1| ribosomal protein L7/L12 [Exiguobacterium sibiricum 255-15]
 gi|171988651|gb|ACB59573.1| ribosomal protein L7/L12 [Exiguobacterium sibiricum 255-15]
          Length = 121

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 84/124 (67%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L  +T++E  EL K +E+E+GVSA+APV+     A    +AA E+TEF+V+L
Sbjct: 4   NKEQFIEDLKGMTVLELNELVKTIEEEFGVSAAAPVAAAGAGA----AAAEEQTEFDVIL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR +T LGLKEAK LV+  P  +K G+SK++A+ +K KLE+AGA+
Sbjct: 60  T--SAGSGKINVIKAVRELTGLGLKEAKALVDGTPAPVKEGVSKEDADAIKAKLEEAGAS 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|99080074|ref|YP_612228.1| 50S ribosomal protein L7/L12 [Ruegeria sp. TM1040]
 gi|123379130|sp|Q1GK50|RL7_SILST RecName: Full=50S ribosomal protein L7/L12
 gi|99036354|gb|ABF62966.1| LSU ribosomal protein L12P [Ruegeria sp. TM1040]
          Length = 125

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 85/127 (66%), Gaps = 5/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++++ E +  LTL+EA EL   L+ E+G+  +A   V V A   A  G+A  EKTEF
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVMVAAGGDAAGGAAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA ++K KLE 
Sbjct: 61  DVVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEDIKGKLEA 117

Query: 119 AGATVEL 125
           AGA VEL
Sbjct: 118 AGAEVEL 124


>gi|223647|prf||0905174A protein L7/L12
          Length = 124

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 82/127 (64%), Gaps = 5/127 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEFE 59
           +++  + E +  LTL+EA EL   L+ ++G+  +A   V +  P A  A  A  EKTEF+
Sbjct: 1   ADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGPAAGAAAPAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V L   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K  ++K +A  MKKKLE+A
Sbjct: 61  VGLT--DAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAVAKADAEAMKKKLEEA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|159896674|ref|YP_001542921.1| 50S ribosomal protein L7/L12 [Herpetosiphon aurantiacus ATCC 23779]
 gi|226733697|sp|A9B5G8|RL7_HERA2 RecName: Full=50S ribosomal protein L7/L12
 gi|159889713|gb|ABX02793.1| ribosomal protein L7/L12 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 130

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 76/107 (71%), Gaps = 4/107 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFEV 60
            + +++E+L  LTL+EAAEL+K +E+ +GVSA+APV  + VA       +AA E+TEF V
Sbjct: 5   KVTALLEELKGLTLVEAAELAKEMEEVFGVSAAAPVMVAGVAAAGDAPAAAAEEQTEFTV 64

Query: 61  VLKGFDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSK 106
           +LKG     KKIA+IK VR  +  LGLKEAK+LVE APK +K G+SK
Sbjct: 65  ILKG-APADKKIAIIKAVREVVAGLGLKEAKDLVEGAPKPVKEGVSK 110


>gi|238760255|ref|ZP_04621399.1| 50S ribosomal protein L7/L12 [Yersinia aldovae ATCC 35236]
 gi|238701519|gb|EEP94092.1| 50S ribosomal protein L7/L12 [Yersinia aldovae ATCC 35236]
          Length = 122

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 85/128 (66%), Gaps = 8/128 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS I  + I+E +++L+++E  EL   +E+++GVSA+A  +  A  A     A  E+TEF
Sbjct: 1   MSTITKDQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAA----EAVEEQTEF 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL  F     K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK L +
Sbjct: 57  NVVLTSFG--ANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKALTE 114

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 115 AGAEVEIK 122


>gi|15618004|ref|NP_224288.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae CWL029]
 gi|15835615|ref|NP_300139.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae J138]
 gi|16752964|ref|NP_445237.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae AR39]
 gi|33241415|ref|NP_876356.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae TW-183]
 gi|6647728|sp|Q9Z9A1|RL7_CHLPN RecName: Full=50S ribosomal protein L7/L12
 gi|4376338|gb|AAD18233.1| L7/L12 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189609|gb|AAF38503.1| ribosomal protein L7/L12 [Chlamydophila pneumoniae AR39]
 gi|8978453|dbj|BAA98290.1| L7/L12 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33235923|gb|AAP98013.1| ribosomal protein L7/L12 [Chlamydophila pneumoniae TW-183]
 gi|269302959|gb|ACZ33059.1| ribosomal protein L7/L12 [Chlamydophila pneumoniae LPCoLN]
          Length = 129

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 3/120 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           ++E++VEKLS+LT++E ++L K LE++W V+ASAPV  VA         A+E TEF V L
Sbjct: 5   SLETLVEKLSNLTVLELSQLKKLLEEKWDVTASAPVVAVAAGGGGEAPVAAEPTEFAVTL 64

Query: 63  KGFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +  D P  KKI V+K VR +T L LKEAKE+ E  PK++K   SK +A +  KKL+DAGA
Sbjct: 65  E--DVPADKKIGVLKVVREVTGLALKEAKEMTEGLPKTVKEKTSKSDAEDTVKKLQDAGA 122


>gi|295133027|ref|YP_003583703.1| 50S ribosomal protein L7/L12 [Zunongwangia profunda SM-A87]
 gi|294981042|gb|ADF51507.1| 50S ribosomal protein L7/L12 [Zunongwangia profunda SM-A87]
          Length = 125

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++   E+L +LT+ E  EL+  L++E+G+  A+A V+V    AA    AA E+TEF+
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGAAAGGEEAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLK+AKELV+ APK++K G+SKDEA  +K +LE+A
Sbjct: 61  VILKA--PGGSKLAVVKLVKELTGLGLKDAKELVDGAPKAVKEGVSKDEAEALKSQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|212637944|ref|YP_002314464.1| 50S ribosomal protein L7/L12 [Anoxybacillus flavithermus WK1]
 gi|254806255|sp|B7GJ57|RL7_ANOFW RecName: Full=50S ribosomal protein L7/L12
 gi|212559424|gb|ACJ32479.1| Ribosomal protein L7/L12 [Anoxybacillus flavithermus WK1]
          Length = 121

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  +L K +E+E+    +A   VV    A AG+AA EKTEF+V+L  
Sbjct: 4   EQIIEAVKNMTVLELNDLVKAIEEEF--GVTAAAPVVVAGGAAAGAAAEEKTEFDVILA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR +T LGLKEAK+LV++ PK +K G+SK+EA E+K KLE+AGA VE
Sbjct: 61  -DGGAQKIKVIKVVRELTGLGLKEAKDLVDNTPKPVKEGVSKEEAEEIKAKLEEAGAKVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|126737164|ref|ZP_01752899.1| ribosomal protein L7/L12 [Roseobacter sp. SK209-2-6]
 gi|126721749|gb|EBA18452.1| ribosomal protein L7/L12 [Roseobacter sp. SK209-2-6]
          Length = 124

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+  A+    V+A      G+A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAGGDAGGAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEDVKAKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|320333431|ref|YP_004170142.1| 50S ribosomal protein L7/L12 [Deinococcus maricopensis DSM 21211]
 gi|319754720|gb|ADV66477.1| 50S ribosomal protein L7/L12 [Deinococcus maricopensis DSM 21211]
          Length = 120

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 81/122 (66%), Gaps = 7/122 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++++++L  LT++E A+L   L++ WGV+A+      A  A    +   EKTEF+VVL  
Sbjct: 6   QALIDQLGQLTIMELADLIDGLKETWGVTAAVAAGPAAAAA----APVEEKTEFDVVL-- 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIKE+RAIT LGLKEAK+L E    ++K G+SK++A + K +LE AGA VE
Sbjct: 60  VDAGAQKINVIKELRAITGLGLKEAKDLSEKGG-NVKEGVSKEDAEKFKAQLEGAGARVE 118

Query: 125 LR 126
           L+
Sbjct: 119 LK 120


>gi|293394021|ref|ZP_06638325.1| ribosomal protein L7/L12 [Serratia odorifera DSM 4582]
 gi|291423461|gb|EFE96686.1| ribosomal protein L7/L12 [Serratia odorifera DSM 4582]
          Length = 121

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+VVL  
Sbjct: 6   DQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK G+SKD+A  +KK LE+AGA+VE
Sbjct: 62  V--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGISKDDAEALKKSLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|299137933|ref|ZP_07031113.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX8]
 gi|298599863|gb|EFI56021.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 86/127 (67%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I+ + +++ SL+L+EA+EL K+LE+  GVSA+A V+        A +A +E KTEF 
Sbjct: 1   MADIQQLEDQIVSLSLLEASELVKKLEERLGVSAAAAVAAAPAGGGAAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  D    KI  IK VR +T LGLKEAK+LV+ APK LK  +SK++A  + KK  D 
Sbjct: 61  VILK--DAGANKINTIKAVREVTALGLKEAKDLVDGAPKPLKENISKEDAAAIAKKF-DG 117

Query: 120 GATVELR 126
            ATVE++
Sbjct: 118 VATVEIK 124


>gi|320105625|ref|YP_004181215.1| 50S ribosomal protein L7/L12 [Terriglobus saanensis SP1PR4]
 gi|319924146|gb|ADV81221.1| ribosomal protein L7/L12 [Terriglobus saanensis SP1PR4]
          Length = 124

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 86/127 (67%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I+ + +++ SL+L+EA+EL K+LE+  GVSA+A V+        A + A+E KTEF 
Sbjct: 1   MADIQQLEDQIVSLSLLEASELVKKLEERLGVSAAAAVAAAPAAGGGAAAPAAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  D    KI+ IK VR  T LGLKEAK+LV+ APK +K  +SKDEA  + KK E  
Sbjct: 61  VILK--DAGANKISTIKAVREATALGLKEAKDLVDGAPKPIKENVSKDEAAAIAKKFEGI 118

Query: 120 GATVELR 126
            ATVE++
Sbjct: 119 -ATVEIK 124


>gi|330430115|gb|AEC21449.1| 50S ribosomal protein L7/L12 [Pusillimonas sp. T7-7]
          Length = 126

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 88/121 (72%), Gaps = 3/121 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLKGF 65
           I++ ++S+T++E +EL K +E+++GVSA+A    VA  AA   +AA+E +TEF VVL   
Sbjct: 8   ILDAIASMTVLELSELIKEMEEKFGVSAAAAAVAVAAPAAGGAAAAAEEQTEFTVVLA-- 65

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
           +    K++VIK VR IT LGLKEAK+LV+ APK +K GL+K +A   +KKLE+AGA VEL
Sbjct: 66  EVGANKVSVIKAVREITGLGLKEAKDLVDGAPKPVKEGLAKADAEAAQKKLEEAGAKVEL 125

Query: 126 R 126
           +
Sbjct: 126 K 126


>gi|224081|prf||1010169A protein L7/L12
          Length = 126

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +VE ++++T++E +E  K LE+++GVSA+AP  +         + A E KTEF+V+LK
Sbjct: 6   EQVVEFIANMTVLELSEFIKELEEKFGVSAAAPAMMAVAAGPAEAAPAEEEKTEFDVILK 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+ V+ AP +LK  +SK+EA E KK+L +AGA V
Sbjct: 66  A--AGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAVSKEEAEEAKKQLVEAGAEV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|21592776|gb|AAM64725.1| 50S ribosomal protein L12-C [Arabidopsis thaliana]
          Length = 187

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 79/129 (61%), Gaps = 11/129 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------EKT 56
           IE I  ++SSLTL EA  L   L+ ++GVS   P+S+    AA A  A         E+T
Sbjct: 62  IEKIGSEISSLTLEEARILVDYLQDKFGVS---PLSLAPAAAAVAAPADGGAAAVVEEQT 118

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           +F+VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK L
Sbjct: 119 KFDVVINEVPS-SSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTL 177

Query: 117 EDAGATVEL 125
           E+AGA V +
Sbjct: 178 EEAGAKVSI 186


>gi|319775418|ref|YP_004137906.1| 50S ribosomal subunit protein L7/L12 [Haemophilus influenzae F3047]
 gi|317450009|emb|CBY86222.1| 50S ribosomal subunit protein L7/L12 [Haemophilus influenzae F3047]
          Length = 123

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S T+ E  EL   +E+++    SA  +V A  AA + +AA EKTEF+VVLK 
Sbjct: 6   EQIIEAIASKTVTEIVELIAAMEEKF--GVSAAAAVAAAPAAGSAAAAEEKTEFDVVLK- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +KK+LE+AGA VE
Sbjct: 63  -SAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKEEAEALKKELEEAGAEVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|315024075|gb|EFT37077.1| 50S ribosomal protein L7/L12 [Riemerella anatipestifer RA-YM]
          Length = 122

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL++ L+ E+G+  +A   V A  A  AG AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELAQILKDEYGIEPAAATVVAA--AGGAGGAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+A++K V+ +T  GLKEAK++V+ AP  +K G+SKDEA  +KK+LE+AG
Sbjct: 59  ILKSA--GASKLAIVKLVKDLTGAGLKEAKDIVDGAPAPIKEGVSKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|157828054|ref|YP_001494296.1| 50S ribosomal protein L7/L12 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165932751|ref|YP_001649540.1| 50S ribosomal protein L7/L12 [Rickettsia rickettsii str. Iowa]
 gi|157800535|gb|ABV75788.1| 50S ribosomal protein L7/L12 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165907838|gb|ABY72134.1| LSU ribosomal protein L12P (L7/L12) [Rickettsia rickettsii str.
           Iowa]
          Length = 143

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 68/128 (53%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEF 58
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV+V A  AA   +A +   KTEF
Sbjct: 18  MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAAGAAAPAAAEAVAEKTEF 77

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           EVVL    D K ++     V+ IT LGL EAK+LV+ APK +K+ + K EA+E+K KLE 
Sbjct: 78  EVVLTAAGDKKVEVIK--VVKDITGLGLIEAKKLVDEAPKPIKSNVKKAEADEIKGKLEA 135

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 136 AGAKVELK 143


>gi|260655336|ref|ZP_05860824.1| ribosomal protein L7/L12 [Jonquetella anthropi E3_33 E1]
 gi|260629784|gb|EEX47978.1| ribosomal protein L7/L12 [Jonquetella anthropi E3_33 E1]
          Length = 125

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 88/123 (71%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+  + S+T++E +EL K +E+++GVSA+AP  ++A  AA   +A +  EKTEF V+L
Sbjct: 4   EEILSAIESMTVLELSELVKAMEEKFGVSAAAPAMMMAAPAAAGAAAPAAEEKTEFNVIL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K  D   +KI VIK VR IT LGLK+AK+ V++  K+LK G+SK+EA  +KK++ + GAT
Sbjct: 64  K--DVGAEKIKVIKVVREITGLGLKDAKDFVDNPGKALKEGVSKEEAENIKKQMAEVGAT 121

Query: 123 VEL 125
           VEL
Sbjct: 122 VEL 124


>gi|319760674|ref|YP_004124612.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039388|gb|ADV33938.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 126

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 80/123 (65%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I++ +S +++++  +L   +EK++GV +   ++       E+      E+TEF V+L 
Sbjct: 6   EEILDGISEMSVMDIMQLVSMIEKKFGVVSGPFITNNETKITESSQPTEPEQTEFTVILS 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              +   KI VIK VR+IT LGLKE+KELVESAP +LK  +SK +A ++KK+LE+ GA +
Sbjct: 66  VVGN--NKIPVIKMVRSITGLGLKESKELVESAPVTLKESMSKTDAEDLKKQLEEIGAKI 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|302036656|ref|YP_003796978.1| fused 50S ribosomal proteins L10 and L7/L12 [Candidatus Nitrospira
           defluvii]
 gi|300604720|emb|CBK41052.1| Fused 50S ribosomal proteins L10 and L7/L12 (modular protein)
           [Candidatus Nitrospira defluvii]
          Length = 311

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 88/124 (70%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           + +++ +  ++++E A+L K LE  +GV+A+APV+V A     A +A +E KT F+V+L 
Sbjct: 190 DELIKAIEGMSVLELADLVKGLETRFGVTAAAPVAVAAVGGGGAAAAPAEEKTAFDVIL- 248

Query: 64  GFDDP-KKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               P  KKI VIK VR +T LGLKEAK+LVE APK +K G +K+EA+ MKKKLE++GA 
Sbjct: 249 -VSAPADKKIQVIKVVRELTSLGLKEAKDLVEGAPKPIKAGATKEEADTMKKKLEESGAK 307

Query: 123 VELR 126
           VE++
Sbjct: 308 VEVK 311


>gi|239813606|ref|YP_002942516.1| 50S ribosomal protein L7/L12 [Variovorax paradoxus S110]
 gi|259491660|sp|C5CKF2|RL7_VARPS RecName: Full=50S ribosomal protein L7/L12
 gi|239800183|gb|ACS17250.1| ribosomal protein L7/L12 [Variovorax paradoxus S110]
          Length = 125

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++ +  L S+T++E  +L K +E+++GVSA+A  +        A + A E+TEF V+L  
Sbjct: 6   DAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAGAGGGAAAAVAEEQTEFNVML-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K++ IK VR IT LGLKEAK+LVE+APK++K GLSK +A   KKKLEDAGA VE
Sbjct: 64  MDAGANKVSAIKAVREITGLGLKEAKDLVEAAPKAVKEGLSKADAEAAKKKLEDAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|256821654|ref|YP_003145617.1| 50S ribosomal protein L7/L12 [Kangiella koreensis DSM 16069]
 gi|256795193|gb|ACV25849.1| ribosomal protein L7/L12 [Kangiella koreensis DSM 16069]
          Length = 125

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 89/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++E  EL + +E+++GVSA+A V+V  P A     AA+E+TEF+VV+K 
Sbjct: 6   DDILNAIAEMSVMEVVELVEAMEEKFGVSAAAAVAVAGPAAGGDAGAAAEQTEFDVVMKS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK +R IT LGLKEAK++VE AP ++K G+ K EA ++KK+LE+AGA VE
Sbjct: 66  F--GGNKVAVIKAIRGITGLGLKEAKDMVEGAPVAVKEGVEKAEAEDIKKQLEEAGAEVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|213963187|ref|ZP_03391445.1| ribosomal protein L7/L12 [Capnocytophaga sputigena Capno]
 gi|213954271|gb|EEB65595.1| ribosomal protein L7/L12 [Capnocytophaga sputigena Capno]
          Length = 126

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 87/128 (67%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++++  E+L +LT+ E  EL++ L++E+G+  +A    VA   A  G+  +  EKTEF
Sbjct: 1   MADLKNFAEQLVNLTVKEVNELAQILKEEYGIEPAAAAVAVAAGPAAGGAGEAAAEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V LK       K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK+EA  +KK LE+
Sbjct: 61  DVFLK--SAGANKLAVVKLVKDLTGLGLKEAKEVVDGAPSKVKEGVSKEEAEGLKKSLEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|212696282|ref|ZP_03304410.1| hypothetical protein ANHYDRO_00819 [Anaerococcus hydrogenalis DSM
           7454]
 gi|212676911|gb|EEB36518.1| hypothetical protein ANHYDRO_00819 [Anaerococcus hydrogenalis DSM
           7454]
          Length = 126

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVL 62
           + +++E++  LT++E +EL K LE+E+ V+A A V+     AA    A + EK+EF+VVL
Sbjct: 5   VTNLLEEIKELTVLELSELVKALEEEFDVTAQATVAAAPAAAAGTADAGAAEKSEFDVVL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K       KI VIK V+ +T LGLK+AK LV+ APK++K G++KDEA E+K KLE+AGA 
Sbjct: 65  KSA--GASKINVIKVVKEVTGLGLKDAKALVDGAPKAVKEGVAKDEAEELKSKLEEAGAE 122

Query: 123 VEL 125
           VEL
Sbjct: 123 VEL 125


>gi|167856581|ref|ZP_02479285.1| 50S ribosomal protein L7/L12 [Haemophilus parasuis 29755]
 gi|219871555|ref|YP_002475930.1| 50S ribosomal protein L7/L12 [Haemophilus parasuis SH0165]
 gi|254806376|sp|B8F6N0|RL7_HAEPS RecName: Full=50S ribosomal protein L7/L12
 gi|167852298|gb|EDS23608.1| 50S ribosomal protein L7/L12 [Haemophilus parasuis 29755]
 gi|219691759|gb|ACL32982.1| 50S ribosomal protein L7/L12 [Haemophilus parasuis SH0165]
          Length = 122

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A    VA   A    AA EKTEF+V+L  
Sbjct: 6   EQIIEAIASKSVSEIVELITAMEEKFGVSAAAAAVAVAAGPA---EAAEEKTEFDVILA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK EA  +KK+LE+AGA VE
Sbjct: 62  -DAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKGEAEALKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|260913281|ref|ZP_05919763.1| ribosomal protein L7/L12 [Pasteurella dagmatis ATCC 43325]
 gi|260632868|gb|EEX51037.1| ribosomal protein L7/L12 [Pasteurella dagmatis ATCC 43325]
          Length = 122

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A    VA   A    AA EKTEF+VVL G
Sbjct: 6   EQIIEAIASKSVTEIVELITAMEEKFGVSAAAAAVAVAAGPA---EAAEEKTEFDVVLAG 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK G+SK EA  +KK+LE+AGA VE
Sbjct: 63  --AGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGISKAEAEALKKELEEAGAQVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|78778589|ref|YP_396701.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9312]
 gi|109893781|sp|Q31CY0|RL7_PROM9 RecName: Full=50S ribosomal protein L7/L12
 gi|78712088|gb|ABB49265.1| LSU ribosomal protein L12P [Prochlorococcus marinus str. MIT 9312]
          Length = 131

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 73/111 (65%), Gaps = 6/111 (5%)

Query: 21  ELSKRLEKEWGVSASAPVSVV--APVAAEAGSAAS---EKTEFEVVLKGFDDPKKKIAVI 75
           EL K++E+ +GVSA+A   VV  AP A           EKTEF+VVL+ FD    KI V+
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGATGGDGDGGAAEEKTEFDVVLESFD-AAAKIKVL 80

Query: 76  KEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           K VR  T LGL +AK LVESAPK++K G++K +A  +KK++E+AG  V L+
Sbjct: 81  KVVRNATGLGLGDAKALVESAPKTVKEGIAKADAESLKKEIEEAGGKVTLK 131


>gi|326772039|ref|ZP_08231324.1| ribosomal protein L7/L12 [Actinomyces viscosus C505]
 gi|326638172|gb|EGE39073.1| ribosomal protein L7/L12 [Actinomyces viscosus C505]
          Length = 129

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (65%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A    +   EK EF+V+
Sbjct: 7   EELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGGDAAAEEKDEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+   D  KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++LE AGA
Sbjct: 67  LEAAGD--KKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKETAEKAKEQLEGAGA 124

Query: 122 TVELR 126
           TV L+
Sbjct: 125 TVTLK 129


>gi|225431267|ref|XP_002275239.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 189

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/134 (39%), Positives = 81/134 (60%), Gaps = 13/134 (9%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP------------VAAEAGSA 51
           + SIV+++S LTL+E ++L++ L K+  ++    ++V+ P                A   
Sbjct: 56  VSSIVDEISGLTLLEVSDLTELLRKKLDINEMPVMAVMMPGMGFGVRGAGGAAPKAAEVK 115

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           A+EKT F++ L+ FD    KI +IKEVR  TDLGLKEAK+LVE AP  LK G+ K+EA  
Sbjct: 116 AAEKTAFDLKLEAFD-AAAKIKIIKEVRTFTDLGLKEAKDLVEHAPTLLKKGVPKEEAEN 174

Query: 112 MKKKLEDAGATVEL 125
           + +K++  GA V +
Sbjct: 175 IIEKMKAVGAKVTM 188


>gi|300776013|ref|ZP_07085872.1| ribosomal protein L7/L12 [Chryseobacterium gleum ATCC 35910]
 gi|300505146|gb|EFK36285.1| ribosomal protein L7/L12 [Chryseobacterium gleum ATCC 35910]
          Length = 122

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL+  L+ E+G+  +A   VVA     AG AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELAAILKDEYGIEPAAAAVVVA--GGAAGEAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+A++K V+ +T  GLKEAK++V+ AP  +KTG+SKDEA  +KK+LE+AG
Sbjct: 59  ILKSAG--ASKLAIVKLVKDLTGAGLKEAKDIVDGAPAPIKTGVSKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|241765527|ref|ZP_04763489.1| ribosomal protein L7/L12 [Acidovorax delafieldii 2AN]
 gi|241364684|gb|EER59709.1| ribosomal protein L7/L12 [Acidovorax delafieldii 2AN]
          Length = 125

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++ +  L S+T++E  +L K +E+++GVSA+A  +  A       +AA EKTEF VVL  
Sbjct: 6   DAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAAGGGAGAAAAEEKTEFNVVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K++VIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA  E
Sbjct: 65  -DAGANKVSVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGAKAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|255560996|ref|XP_002521510.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
 gi|223539188|gb|EEF40781.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
          Length = 192

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/137 (37%), Positives = 81/137 (59%), Gaps = 16/137 (11%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---------- 53
           + ++V+++S LTL+E ++L++ L  +  +     ++V+ P    +G              
Sbjct: 56  VAALVDEISELTLLEISDLTEVLRNKLDIKEMPVMAVMMPGMGFSGMKGGVKGGAAGAAK 115

Query: 54  -----EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
                EKT F+V L+GFD    KI VIKEVR  TDLGLKEAK+LVE AP  LK G++K+E
Sbjct: 116 AEEKVEKTVFDVKLEGFDA-AAKIKVIKEVRGFTDLGLKEAKDLVEKAPTLLKKGVTKEE 174

Query: 109 ANEMKKKLEDAGATVEL 125
           A ++  K+++ GA V +
Sbjct: 175 AEKITAKMKEVGAKVSM 191


>gi|163739424|ref|ZP_02146834.1| 50S ribosomal protein L7/L12 [Phaeobacter gallaeciensis BS107]
 gi|163740212|ref|ZP_02147606.1| ribosomal protein L7/L12 [Phaeobacter gallaeciensis 2.10]
 gi|161386070|gb|EDQ10445.1| ribosomal protein L7/L12 [Phaeobacter gallaeciensis 2.10]
 gi|161387177|gb|EDQ11536.1| 50S ribosomal protein L7/L12 [Phaeobacter gallaeciensis BS107]
          Length = 124

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (65%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++ + E +  LTL+EA EL   L+ E+G+  A+    V+A      G+A  EKTEF+
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAGGDAGGAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|315452939|ref|YP_004073209.1| 50S ribosomal protein L7 /L12 [Helicobacter felis ATCC 49179]
 gi|315131991|emb|CBY82619.1| 50S ribosomal protein L7 /L12 [Helicobacter felis ATCC 49179]
          Length = 124

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  L+++E +EL K  E+++GVSA AP  V       A  A  EKTEF VVL  
Sbjct: 6   EELLDYIGGLSVLELSELVKAFEEKFGVSA-APTVVAGAGGGVAAEAVEEKTEFSVVLA- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR IT LGLKEAKE  E  P  LK G++K+EA  +KKKLE+ GA  E
Sbjct: 64  -ETGAEKIKVIKVVREITGLGLKEAKEATEKTPHVLKEGVNKEEAESIKKKLEEVGAKAE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|39938745|ref|NP_950511.1| 50S ribosomal protein L7/L12 [Onion yellows phytoplasma OY-M]
 gi|39721854|dbj|BAD04344.1| ribosomal protein L7/L12 [Onion yellows phytoplasma OY-M]
          Length = 136

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E+ V  L  ++L+E  EL   L++E+G+  +A ++V AP  A   +   EKTEF VV+K 
Sbjct: 18  EAFVSALKEMSLLEIKELLDGLKEEFGIDPTA-LAVAAP-GANNSAEVEEKTEFTVVMKS 75

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           FD+ KKK+AVIK VR +T LGL +A   V+     +K  +SK  A ++K KLE AGA VE
Sbjct: 76  FDE-KKKLAVIKTVREVTGLGLLDAANFVKVPDSKVKENVSKALAEDIKNKLEQAGAVVE 134

Query: 125 LR 126
           L+
Sbjct: 135 LQ 136


>gi|116671535|ref|YP_832468.1| 50S ribosomal protein L12P / LSU ribosomal protein L12P
           [Arthrobacter sp. FB24]
 gi|116611644|gb|ABK04368.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P
           [Arthrobacter sp. FB24]
          Length = 123

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 6/126 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           ++N E ++E    LT+IE +E  K  E+ + V+A+A        AA     A EKT+F+V
Sbjct: 4   LTN-EELIEAFKELTIIELSEFVKLFEETFEVTAAAVAVAGPAAAA---EEAEEKTDFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+   D  KKIAVIKEVRAIT LGLKEAK+LV+SAPK++  G +K+ A + K++LE AG
Sbjct: 60  VLEAAGD--KKIAVIKEVRAITSLGLKEAKDLVDSAPKAVLEGATKEAAEKAKEQLEAAG 117

Query: 121 ATVELR 126
           ATV L+
Sbjct: 118 ATVTLK 123


>gi|320532561|ref|ZP_08033368.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320135232|gb|EFW27373.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 129

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (65%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A    +   EK EF+V+
Sbjct: 7   EELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGDEAAAEEKDEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+   D  KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++LE AGA
Sbjct: 67  LEAAGD--KKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKEAAEKAKEQLEGAGA 124

Query: 122 TVELR 126
           TV L+
Sbjct: 125 TVTLK 129


>gi|325067667|ref|ZP_08126340.1| 50S ribosomal protein L7/L12 [Actinomyces oris K20]
          Length = 129

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (65%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A    +   EK EF+V+
Sbjct: 7   EELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGGDAAAEEKDEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+   D  KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++LE AGA
Sbjct: 67  LEAAGD--KKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKEAAEKAKEQLEGAGA 124

Query: 122 TVELR 126
           TV L+
Sbjct: 125 TVTLK 129


>gi|326501736|dbj|BAK02657.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 196

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/130 (43%), Positives = 82/130 (63%), Gaps = 14/130 (10%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-------------APVAAEAGSAAS 53
           +V+ +S+LTL EAAELS  L +   + ++ P++++             A  A +  +AA+
Sbjct: 65  LVDDVSALTLAEAAELSALLLRRLDIPSAPPIAILNSAAGLGGGGAAAAGAAGDKPAAAA 124

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT FE+ L  FD    KI VIKE+R  TDLGLKEAKELVE AP  +K GLSK+EA ++ 
Sbjct: 125 EKTVFELRLDSFD-AASKIKVIKEIRTFTDLGLKEAKELVEKAPAVIKGGLSKEEAEKIV 183

Query: 114 KKLEDAGATV 123
           ++++  GA V
Sbjct: 184 ERMKALGAKV 193


>gi|302762214|ref|XP_002964529.1| hypothetical protein SELMODRAFT_28777 [Selaginella moellendorffii]
 gi|302822958|ref|XP_002993134.1| hypothetical protein SELMODRAFT_7808 [Selaginella moellendorffii]
 gi|300139025|gb|EFJ05774.1| hypothetical protein SELMODRAFT_7808 [Selaginella moellendorffii]
 gi|300168258|gb|EFJ34862.1| hypothetical protein SELMODRAFT_28777 [Selaginella moellendorffii]
          Length = 122

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 13/126 (10%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------KT 56
           ++ +V+++ +LTL +A +L +RLE E GVSA+   +  APVA   G+A +E       KT
Sbjct: 1   LDKLVDEVKNLTLEQARQLVERLETELGVSAA---TFAAPVAMAGGAAPAEAAPVVEEKT 57

Query: 57  EFEVVLKGFDDPKK-KIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           EF++++     P   +IAVIK +RAIT+LGLKEAK+L+E  PK +K G++KD+A + +K+
Sbjct: 58  EFDLLIDEV--PSNARIAVIKAIRAITNLGLKEAKDLIEGLPKKIKEGVAKDDAEDAQKQ 115

Query: 116 LEDAGA 121
           LE AGA
Sbjct: 116 LEAAGA 121


>gi|229815799|ref|ZP_04446124.1| hypothetical protein COLINT_02848 [Collinsella intestinalis DSM
           13280]
 gi|229808715|gb|EEP44492.1| hypothetical protein COLINT_02848 [Collinsella intestinalis DSM
           13280]
          Length = 125

 Score = 80.5 bits (197), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L  +TL+EA+EL K +E  +GVSA+AP +VVA   A A   A EKTEF+VVL+G
Sbjct: 7   DEIIEALKEMTLLEASELVKAIEDTFGVSAAAPAAVVAGPVAAA-EEAEEKTEFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D   KI VIK VR +T LGLKEAKE+VE+APK++  G  K++A   K+KLE AGA V 
Sbjct: 66  FGD--NKIQVIKVVRELTSLGLKEAKEVVENAPKAVIEGAKKEDAEAAKEKLEAAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|313887248|ref|ZP_07820942.1| ribosomal protein L7/L12 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923301|gb|EFR34116.1| ribosomal protein L7/L12 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332176996|gb|AEE12686.1| 50S ribosomal protein L7/L12 [Porphyromonas asaccharolytica DSM
           20707]
          Length = 124

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E L +LT+ E +EL + L++E+G+  +A    VA  AA A + A EKT F+V
Sbjct: 1   MADIKAIAETLVNLTVKEVSELKELLKEEYGIEPAAAAVAVAGPAAGAAAEAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK F   K  +AV+K V+    LGLKEAKELV+ AP ++K G+ K  A  +K  LE+AG
Sbjct: 61  VLKSFGAAK--LAVVKAVKEHAGLGLKEAKELVDGAPTNVKEGVDKATAEALKAALEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|163938108|ref|YP_001642992.1| 50S ribosomal protein L7/L12 [Bacillus weihenstephanensis KBAB4]
 gi|229009609|ref|ZP_04166835.1| 50S ribosomal protein L7/L12 [Bacillus mycoides DSM 2048]
 gi|229053946|ref|ZP_04195380.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH603]
 gi|229131107|ref|ZP_04260019.1| 50S ribosomal protein L7/L12 [Bacillus cereus BDRD-ST196]
 gi|229165088|ref|ZP_04292883.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH621]
 gi|226733641|sp|A9VNB3|RL7_BACWK RecName: Full=50S ribosomal protein L7/L12
 gi|163860305|gb|ABY41364.1| ribosomal protein L7/L12 [Bacillus weihenstephanensis KBAB4]
 gi|228618351|gb|EEK75381.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH621]
 gi|228652320|gb|EEL08245.1| 50S ribosomal protein L7/L12 [Bacillus cereus BDRD-ST196]
 gi|228721364|gb|EEL72885.1| 50S ribosomal protein L7/L12 [Bacillus cereus AH603]
 gi|228751631|gb|EEM01431.1| 50S ribosomal protein L7/L12 [Bacillus mycoides DSM 2048]
          Length = 119

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 88/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K +E+E+GV+A+APV+V          AA+E+TEF+VVL  
Sbjct: 4   EQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAG----EAAAEQTEFDVVLAS 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR IT LGLKEAKELV++ PK++K G++K+EA EMK KLE+ GA VE
Sbjct: 60  --AGAQKIKVIKAVREITGLGLKEAKELVDNTPKAIKEGVTKEEAEEMKAKLEEVGAAVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|133073|sp|P05392|RL7_BACST RecName: Full=50S ribosomal protein L7/L12; AltName: Full=BL13;
           AltName: Full=Ribosomal protein 'A'
          Length = 122

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 90/122 (73%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA A  AA+EKTEF+V+L  
Sbjct: 4   EQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGA-EAAAEKTEFDVILA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+LV++ PK +K G++K+EA E+K  LE+AGA VE
Sbjct: 62  -DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEEAEEIKAALEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|221484372|gb|EEE22668.1| 50S ribosomal protein L12, putative [Toxoplasma gondii GT1]
 gi|221505651|gb|EEE31296.1| 50S ribosomal protein L12, putative [Toxoplasma gondii VEG]
          Length = 190

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 83/130 (63%), Gaps = 10/130 (7%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--------EAGSAASEKT 56
           ++++E++  LTL+EAAEL   +E  +GVSA  PV+     +A         A + A EKT
Sbjct: 61  QAVLEEIKKLTLVEAAELVSLIETTFGVSARLPVAGPGASSAAAEAEEKDNADAPAPEKT 120

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           +F+VV+K     +K+IAVIK +R + TDLGLKEAK ++++ P ++   + K +A E++K 
Sbjct: 121 QFDVVIKAVPL-EKRIAVIKTLRTVRTDLGLKEAKAVIDALPNTILKQVDKGKAEEVRKT 179

Query: 116 LEDAGATVEL 125
           L DAGA + +
Sbjct: 180 LADAGAEIAI 189


>gi|109896925|ref|YP_660180.1| 50S ribosomal protein L7/L12 [Pseudoalteromonas atlantica T6c]
 gi|123065028|sp|Q15YB2|RL7_PSEA6 RecName: Full=50S ribosomal protein L7/L12
 gi|109699206|gb|ABG39126.1| LSU ribosomal protein L12P [Pseudoalteromonas atlantica T6c]
          Length = 123

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVL  F     K+AVIK VR  T LGLKEAKE+VE+APK++K G++K+EA E+KK
Sbjct: 54  QTEFDVVLTSFGG--NKVAVIKAVRGATGLGLKEAKEVVEAAPKAIKEGVAKEEAEELKK 111

Query: 115 KLEDAGATVELR 126
            LE+AGA VEL+
Sbjct: 112 TLEEAGAEVELK 123


>gi|15603603|ref|NP_246677.1| 50S ribosomal protein L7/L12 [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|14195169|sp|Q9CK90|RL7_PASMU RecName: Full=50S ribosomal protein L7/L12
 gi|12722153|gb|AAK03822.1| RpL12 [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 122

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++S ++ E  EL   +E+++GVSA+A    VA   A    AA EKTEF+VVL G
Sbjct: 6   EQIIEAIASKSVTEIVELIAAMEEKFGVSAAAAAVAVAAGPA---EAAEEKTEFDVVLAG 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK G+SK EA  +KK+LE+AGA VE
Sbjct: 63  --AGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGISKAEAEALKKELEEAGAQVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|304557606|gb|ADM40270.1| LSU ribosomal protein L7/L12 (L23e) [Edwardsiella tarda FL6-60]
          Length = 122

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V+V A  AA    A  EKTEF+VVL  
Sbjct: 6   EQILDAVAEMSVMDVVELISMMEEKFGVSAAAAVAVAAGGAA---EAVEEKTEFDVVLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK  +SKD+A  +KK LE+AGA+VE
Sbjct: 63  A--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDDAEALKKTLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|237838121|ref|XP_002368358.1| 50s ribosomal protein L12, putative [Toxoplasma gondii ME49]
 gi|211966022|gb|EEB01218.1| 50s ribosomal protein L12, putative [Toxoplasma gondii ME49]
          Length = 190

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 83/130 (63%), Gaps = 10/130 (7%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--------EAGSAASEKT 56
           ++++E++  LTL+EAAEL   +E  +GVSA  PV+     +A         A + A EKT
Sbjct: 61  QAVLEEIKKLTLVEAAELVSLIETTFGVSARLPVAGPGASSAAAEAEEKDNADAPAPEKT 120

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           +F+VV+K     +K+IAVIK +R + TDLGLKEAK ++++ P ++   + K +A E++K 
Sbjct: 121 QFDVVIKAVPL-EKRIAVIKTLRTVRTDLGLKEAKAVIDALPNTILKQVDKGKAEEVRKT 179

Query: 116 LEDAGATVEL 125
           L DAGA + +
Sbjct: 180 LADAGAEIAI 189


>gi|226939178|ref|YP_002794249.1| RplL [Laribacter hongkongensis HLHK9]
 gi|254806378|sp|C1DAQ9|RL7_LARHH RecName: Full=50S ribosomal protein L7/L12
 gi|226714102|gb|ACO73240.1| RplL [Laribacter hongkongensis HLHK9]
          Length = 123

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + ++T++E  +L K  E+++GVSA+A         A   +AA EKTEF+VVL  
Sbjct: 6   DDILEAVGAMTVMELNDLVKAFEEKFGVSAAAMAVAAPAAGAA--AAAEEKTEFDVVLTA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   K+ VIK VRA+T LGLKEAK++V+ APK++K G+SK +A  M K+L +AGA  E
Sbjct: 64  AGD--NKVNVIKVVRALTGLGLKEAKDMVDGAPKTVKEGVSKADAEAMLKQLTEAGAKAE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|317485868|ref|ZP_07944730.1| ribosomal protein L7/L12 [Bilophila wadsworthia 3_1_6]
 gi|316922883|gb|EFV44107.1| ribosomal protein L7/L12 [Bilophila wadsworthia 3_1_6]
          Length = 126

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 87/123 (70%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +VE ++++T++E +E  K LE+++GVSA+AP + +   A    +A +E KTEF+V+LK
Sbjct: 6   EEVVEFIANMTVLELSEFIKELEEKFGVSAAAPAAAMMVAAPAEAAAPAEEKTEFDVILK 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+ V+ AP +LK  +SK+EA E KK+L +AGA V
Sbjct: 66  --SAGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAVSKEEAEEAKKQLVEAGAEV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|195605180|gb|ACG24420.1| 50S ribosomal protein L12-2 [Zea mays]
          Length = 167

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 79/136 (58%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV----APVAA---------EAG 49
            + ++V+++  LTL+EA+ L+  L    GV    P++++    AP+           E  
Sbjct: 32  RVSALVDEICGLTLLEASSLADALRGRLGVDQLPPLAILTGGAAPLVGGGVGPGAAGEEA 91

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A  EK  F+V L+GFD    K+ +IKE+RA T+LGLKEAK+LVE AP  LK G+ K+EA
Sbjct: 92  KAKEEKMAFDVKLEGFDA-AAKLKIIKELRAFTNLGLKEAKDLVEKAPAVLKAGVPKEEA 150

Query: 110 NEMKKKLEDAGATVEL 125
             + +K+   GA + L
Sbjct: 151 ESIAEKMRALGAKIVL 166


>gi|294634222|ref|ZP_06712767.1| ribosomal protein L7/L12 [Edwardsiella tarda ATCC 23685]
 gi|291092347|gb|EFE24908.1| ribosomal protein L7/L12 [Edwardsiella tarda ATCC 23685]
          Length = 122

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V+V A  AA    A  EKTEF+VVL  
Sbjct: 6   EQILDAVAEMSVMDVVELISMMEEKFGVSAAAAVAVAAGGAA---EAVEEKTEFDVVLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK  +SKD+A  +KK LE+AGA+VE
Sbjct: 63  A--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDDAEALKKALEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|138893775|ref|YP_001124228.1| 50S ribosomal protein L7/L12 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196251114|ref|ZP_03149793.1| ribosomal protein L7/L12 [Geobacillus sp. G11MC16]
 gi|166222170|sp|A4IJH9|RL7_GEOTN RecName: Full=50S ribosomal protein L7/L12
 gi|134265288|gb|ABO65483.1| LSU ribosomal protein L12P (L7/L12) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196209355|gb|EDY04135.1| ribosomal protein L7/L12 [Geobacillus sp. G11MC16]
          Length = 123

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 90/126 (71%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M   E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA  G AA+EKTEF+V
Sbjct: 1   MMTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAA-GGEAAAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIK VR IT LGLKEAK+LV++ PK LK  +SK+EA E+K KLE+ G
Sbjct: 60  ILA--DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEAVSKEEAEEIKAKLEEVG 117

Query: 121 ATVELR 126
           A VE++
Sbjct: 118 AKVEVK 123


>gi|297569430|ref|YP_003690774.1| ribosomal protein L7/L12 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925345|gb|ADH86155.1| ribosomal protein L7/L12 [Desulfurivibrio alkaliphilus AHT2]
          Length = 128

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 72/125 (57%), Positives = 97/125 (77%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E +VE +S+++++E +EL K LE+++GVSA+APV+V A  AA  G A +   EKTEF+V+
Sbjct: 6   EDVVEFISNMSVLELSELIKELEEKFGVSAAAPVAVAAGPAAAGGDAGAAAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D  KKI VIKEVRAIT LGLKEAKELVE APK +K G++K+EA E+KKK+E+AG 
Sbjct: 66  LASAGD--KKIGVIKEVRAITSLGLKEAKELVEGAPKPIKEGVTKEEAEEIKKKIEEAGG 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIK 128


>gi|221194565|ref|ZP_03567622.1| ribosomal protein L7/L12 [Atopobium rimae ATCC 49626]
 gi|221185469|gb|EEE17859.1| ribosomal protein L7/L12 [Atopobium rimae ATCC 49626]
          Length = 127

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 82/124 (66%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA   +  +   KT F+VVL
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGGAAEGAAEEKTNFDVVL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +GF     KIAVIK VR +T LGLKEAKE+VE APK++  G  KD+A   K KLE+AGAT
Sbjct: 66  EGFG--ANKIAVIKVVRELTSLGLKEAKEVVEGAPKAVLEGAKKDDAEAAKAKLEEAGAT 123

Query: 123 VELR 126
           V L+
Sbjct: 124 VTLK 127


>gi|125545632|gb|EAY91771.1| hypothetical protein OsI_13415 [Oryza sativa Indica Group]
          Length = 174

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 78/136 (57%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA-------------EAG 49
            + ++V+++  LTLIEA+ L+  L    GV    P++++   AA             E  
Sbjct: 39  RVSALVDEICGLTLIEASSLTDALRGRLGVDQLPPLAILTGGAAPLAGGGAATGAAGEEA 98

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A  EK  F+V L+GFD    K+ +IKE+RA T+LGLKEAKELVE AP  LK G+ K+EA
Sbjct: 99  KAKEEKMAFDVKLEGFDA-AAKLKIIKELRAFTNLGLKEAKELVEKAPAVLKAGVPKEEA 157

Query: 110 NEMKKKLEDAGATVEL 125
             + +K+   GA + L
Sbjct: 158 ESIAEKMRAIGAKIVL 173


>gi|115455159|ref|NP_001051180.1| Os03g0734400 [Oryza sativa Japonica Group]
 gi|50582718|gb|AAT78788.1| putative ribosomal protein [Oryza sativa Japonica Group]
 gi|108710931|gb|ABF98726.1| Ribosomal protein L7/L12 C-terminal domain containing protein,
           expressed [Oryza sativa Japonica Group]
 gi|113549651|dbj|BAF13094.1| Os03g0734400 [Oryza sativa Japonica Group]
 gi|215692972|dbj|BAG88392.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 175

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 78/136 (57%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA-------------EAG 49
            + ++V+++  LTLIEA+ L+  L    GV    P++++   AA             E  
Sbjct: 40  RVSALVDEICGLTLIEASSLTDALRGRLGVDQLPPLAILTGGAAPLAGGGAATGAAGEEA 99

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A  EK  F+V L+GFD    K+ +IKE+RA T+LGLKEAKELVE AP  LK G+ K+EA
Sbjct: 100 KAKEEKMAFDVKLEGFDA-AAKLKIIKELRAFTNLGLKEAKELVEKAPAVLKAGVPKEEA 158

Query: 110 NEMKKKLEDAGATVEL 125
             + +K+   GA + L
Sbjct: 159 ESIAEKMRAIGAKIVL 174


>gi|332172378|gb|AEE21632.1| ribosomal protein L7/L12 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 123

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 57/72 (79%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVL  F     K+AVIK VR  T LGLKEAKE+VE+APK++K G++K+EA E+KK
Sbjct: 54  QTEFDVVLTSFGG--NKVAVIKAVRGATGLGLKEAKEVVEAAPKAIKEGVAKEEAEELKK 111

Query: 115 KLEDAGATVELR 126
            LE+AGA VEL+
Sbjct: 112 TLEEAGAEVELK 123


>gi|16974117|emb|CAD11987.1| ribosomal protein L12 [Thermus thermophilus]
          Length = 125

 Score = 80.1 bits (196), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 67/125 (53%), Positives = 89/125 (71%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVV 61
           +IE I E+LS  T++E  +L   L++ WGV+A+APV+V A  AA A +A + EKTEF+V+
Sbjct: 4   DIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +   KK+ VIK+VRAIT LGLKEAK+L E     +K G+SK EA E+KKKLE  GA
Sbjct: 64  LK--EAGAKKLEVIKDVRAITGLGLKEAKDLAEKGG-PVKEGVSKQEAEEIKKKLEAVGA 120

Query: 122 TVELR 126
            VEL+
Sbjct: 121 VVELK 125


>gi|16802297|ref|NP_463782.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes EGD-e]
 gi|47096505|ref|ZP_00234096.1| ribosomal protein L7/L12 [Listeria monocytogenes str. 1/2a F6854]
 gi|224498903|ref|ZP_03667252.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes Finland 1988]
 gi|224502455|ref|ZP_03670762.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes FSL R2-561]
 gi|254828711|ref|ZP_05233398.1| ribosomal protein L7/L12 [Listeria monocytogenes FSL N3-165]
 gi|254831924|ref|ZP_05236579.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 10403S]
 gi|254900568|ref|ZP_05260492.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes J0161]
 gi|254913481|ref|ZP_05263493.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes J2818]
 gi|254937938|ref|ZP_05269635.1| ribosomal protein L7/L12 [Listeria monocytogenes F6900]
 gi|284800545|ref|YP_003412410.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 08-5578]
 gi|284993731|ref|YP_003415499.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 08-5923]
 gi|20978563|sp|Q8YAA3|RL7_LISMO RecName: Full=50S ribosomal protein L7/L12
 gi|16409616|emb|CAD00778.1| ribosomal protein L12 [Listeria monocytogenes EGD-e]
 gi|47015096|gb|EAL06038.1| ribosomal protein L7/L12 [Listeria monocytogenes str. 1/2a F6854]
 gi|258601116|gb|EEW14441.1| ribosomal protein L7/L12 [Listeria monocytogenes FSL N3-165]
 gi|258610547|gb|EEW23155.1| ribosomal protein L7/L12 [Listeria monocytogenes F6900]
 gi|284056107|gb|ADB67048.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 08-5578]
 gi|284059198|gb|ADB70137.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 08-5923]
 gi|293591489|gb|EFF99823.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes J2818]
          Length = 120

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   +++E  +L K +E+E+GV+A+APV+      A AG AA+E+TEF V L
Sbjct: 4   NIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVA-----VAAAGGAAAEQTEFTVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VR IT LGLKEAKELV++APK+LK G++KDEA E+K KLE+ GA 
Sbjct: 59  ASAGDSK--IKVIKVVREITGLGLKEAKELVDNAPKALKEGIAKDEAEEIKAKLEEVGAN 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|255014703|ref|ZP_05286829.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_1_7]
 gi|256841131|ref|ZP_05546638.1| ribosomal protein L7/L12 [Parabacteroides sp. D13]
 gi|262383748|ref|ZP_06076884.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_1_33B]
 gi|298375896|ref|ZP_06985852.1| ribosomal protein L7/L12 [Bacteroides sp. 3_1_19]
 gi|301311920|ref|ZP_07217842.1| ribosomal protein L7/L12 [Bacteroides sp. 20_3]
 gi|256736974|gb|EEU50301.1| ribosomal protein L7/L12 [Parabacteroides sp. D13]
 gi|262294646|gb|EEY82578.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_1_33B]
 gi|298266933|gb|EFI08590.1| ribosomal protein L7/L12 [Bacteroides sp. 3_1_19]
 gi|300830022|gb|EFK60670.1| ribosomal protein L7/L12 [Bacteroides sp. 20_3]
          Length = 125

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E +EL+  L++E+G+  +A    VA  AA   +AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVSELATILKEEYGIEPAAAAVAVAGPAAGGAAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+A++K V+ +T LGLKEAK++V+SAP ++K G++K +A  +KK+LE+A
Sbjct: 61  VVLKAA--GANKLAIVKLVKELTGLGLKEAKDMVDSAPSAIKEGIAKADAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|224094877|ref|XP_002310275.1| predicted protein [Populus trichocarpa]
 gi|222853178|gb|EEE90725.1| predicted protein [Populus trichocarpa]
          Length = 147

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------- 53
             + SIV++LS LTL+E ++L++ L  +  +     ++V+ P    +  A          
Sbjct: 7   DRVSSIVDELSKLTLLEVSDLTEVLRTKLEIKEMPVMAVMMPGMGFSMGAGMKGGGGGGA 66

Query: 54  ---------EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGL 104
                    EKT F+V L+GFD    KI VIKEVR  TDLGLKEAK+LVE AP  LK G+
Sbjct: 67  AAAKAEEKVEKTVFDVKLEGFD-AAVKIKVIKEVRGFTDLGLKEAKDLVEKAPTLLKKGV 125

Query: 105 SKDEANEMKKKLEDAGATVEL 125
           +KDEA ++ +K++  GA V +
Sbjct: 126 TKDEAEKIIEKMKGVGAKVTM 146


>gi|260577193|ref|ZP_05845169.1| ribosomal protein L7/L12 [Rhodobacter sp. SW2]
 gi|259020573|gb|EEW23893.1| ribosomal protein L7/L12 [Rhodobacter sp. SW2]
          Length = 124

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  + E +  LTL++A EL   L+ ++G+  +A  +V     A A +A  E +TEF+
Sbjct: 1   MTDLNKLAESIVGLTLLQAQELKTILKDKYGIEPAAGAAVAVAGPAAAAAAPVEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   +    KI VIKEVRAIT LGLKEAK+LVE+  K +K G+SK +A   KKKLE+A
Sbjct: 61  VVLT--EAGPNKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEGVSKADAEGFKKKLEEA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|221135384|ref|ZP_03561687.1| 50S ribosomal protein L7/L12 [Glaciecola sp. HTCC2999]
          Length = 124

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVL GF     K+AVIK VR  T LGLKEAKE+VESAPK++K G+SK+EA E+K 
Sbjct: 55  QTEFDVVLTGFG--ANKVAVIKAVRGATGLGLKEAKEVVESAPKAIKEGVSKEEAEELKA 112

Query: 115 KLEDAGATVELR 126
            L +AGA VE++
Sbjct: 113 ALTEAGAEVEVK 124


>gi|46200078|ref|YP_005745.1| 50S ribosomal protein L7/L12 [Thermus thermophilus HB27]
 gi|55980179|ref|YP_143476.1| 50S ribosomal protein L7/L12 [Thermus thermophilus HB8]
 gi|62296835|sp|Q8VVE2|RL7_THET8 RecName: Full=50S ribosomal protein L7/L12
 gi|81567555|sp|Q72GS2|RL7_THET2 RecName: Full=50S ribosomal protein L7/L12
 gi|294979561|pdb|3I8I|I Chain I, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|294979565|pdb|3I8I|J Chain J, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s
           Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 gi|46197706|gb|AAS82118.1| LSU ribosomal protein L12P (L7/L12) [Thermus thermophilus HB27]
 gi|55771592|dbj|BAD70033.1| 50S ribosomal protein L12 [Thermus thermophilus HB8]
          Length = 125

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS-APVSVVAPVAAEAGSAASEKTEFEVV 61
           +IE I E+LS  T++E  +L   L++ WGV+A+       AP A  A + A EKTEF+V+
Sbjct: 4   DIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +   KK+ VIKE+RAIT LGLKEAK+L E     +K G+SK EA E+KKKLE  GA
Sbjct: 64  LK--EAGAKKLEVIKELRAITGLGLKEAKDLAEKGG-PVKEGVSKQEAEEIKKKLEAVGA 120

Query: 122 TVELR 126
            VEL+
Sbjct: 121 VVELK 125


>gi|86131816|ref|ZP_01050413.1| 50S ribosomal protein L7/L12 [Dokdonia donghaensis MED134]
 gi|85817638|gb|EAQ38812.1| 50S ribosomal protein L7/L12 [Dokdonia donghaensis MED134]
          Length = 124

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA   A  G AA EK+EF+V
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAVAAGGAGGGDAAEEKSEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLK+AK LV+ AP  +K G++KDEA  +K +LE+AG
Sbjct: 61  ILKAAG--ASKLAVVKLVKELTGLGLKDAKGLVDGAPSPVKEGVAKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|260909711|ref|ZP_05916405.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 472 str. F0295]
 gi|260636136|gb|EEX54132.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 472 str. F0295]
          Length = 126

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 86/128 (67%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++I++I E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA   EK+ F
Sbjct: 1   MADIKAIAEELVNLTVKEVNELANVLKEEYGIEPAAAAVAVAAGPAAAGAAAGAEEKSSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL   D    K+ V+K V+    LGLKEAK+LV+  P +LK G+SKDEA  +KK +E+
Sbjct: 61  DVVL--VDAGAAKLQVVKAVKEACGLGLKEAKDLVDGVPSTLKEGMSKDEAENLKKAIEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|45437731|gb|AAS63281.1| Ribosomal protein L7/L12 [Yersinia pestis biovar Microtus str.
           91001]
          Length = 95

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVL  F +   K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK
Sbjct: 26  QTEFDVVLASFGE--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKK 83

Query: 115 KLEDAGATVELR 126
            LE+AGA+VE++
Sbjct: 84  SLEEAGASVEIK 95


>gi|67459539|ref|YP_247163.1| 50S ribosomal protein L7/L12 [Rickettsia felis URRWXCal2]
 gi|75536056|sp|Q4UKD3|RL7_RICFE RecName: Full=50S ribosomal protein L7/L12
 gi|67005072|gb|AAY61998.1| 50S ribosomal protein L7/L12 [Rickettsia felis URRWXCal2]
          Length = 125

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV+V A  AA   + A+  KTEFE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAAGAAAPAAEAAAEKTEFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +VL    D K ++   K V+ IT LGL EAK+LV+ APK +K+ + K EA E+K KLE A
Sbjct: 61  IVLMAAGDKKVEVI--KVVKDITGLGLIEAKKLVDEAPKPMKSNVKKAEAEEIKGKLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|242241128|ref|YP_002989309.1| 50S ribosomal protein L7/L12 [Dickeya dadantii Ech703]
 gi|242133185|gb|ACS87487.1| ribosomal protein L7/L12 [Dickeya dadantii Ech703]
          Length = 122

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++GVSA+A V+V A   A    AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELISAMEEKFGVSAAAAVAVAAAGPA---EAAEEKTEFDVILKA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK  +SKD+A  +KK LE+AGA VE
Sbjct: 63  V--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEAVSKDDAEALKKSLEEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|237809523|ref|YP_002893963.1| 50S ribosomal protein L7/L12 [Tolumonas auensis DSM 9187]
 gi|259491659|sp|C4LBV3|RL7_TOLAT RecName: Full=50S ribosomal protein L7/L12
 gi|237501784|gb|ACQ94377.1| ribosomal protein L7/L12 [Tolumonas auensis DSM 9187]
          Length = 121

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 84/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++S++++E  EL   +E+++GVSA+A     A   A A  A  E+TEF V+L  
Sbjct: 6   DQIIEAVASMSVMEVVELITAMEEKFGVSAAAV----AAGPAAAAEAVEEQTEFNVMLTA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VRA T LGLKEAK+LVE+AP ++K  +SKDEA  +KK+LE AGA+VE
Sbjct: 62  IG--ANKVAVIKAVRAATSLGLKEAKDLVEAAPTAVKEAVSKDEAEALKKELEAAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|53715478|ref|YP_101470.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis YCH46]
 gi|60683451|ref|YP_213595.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis NCTC 9343]
 gi|253566657|ref|ZP_04844110.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_2_5]
 gi|255011634|ref|ZP_05283760.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis 3_1_12]
 gi|265767535|ref|ZP_06095201.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_16]
 gi|313149469|ref|ZP_07811662.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis 3_1_12]
 gi|81313501|sp|Q5L896|RL7_BACFN RecName: Full=50S ribosomal protein L7/L12
 gi|81608231|sp|Q64NJ6|RL7_BACFR RecName: Full=50S ribosomal protein L7/L12
 gi|52218343|dbj|BAD50936.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis YCH46]
 gi|60494885|emb|CAH09692.1| putative 50S ribosomal protein L7/L12 [Bacteroides fragilis NCTC
           9343]
 gi|251944829|gb|EES85304.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_2_5]
 gi|263252840|gb|EEZ24352.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_16]
 gi|301164935|emb|CBW24496.1| putative 50S ribosomal protein L7/L12 [Bacteroides fragilis 638R]
 gi|313138236|gb|EFR55596.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis 3_1_12]
          Length = 124

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA EK+ F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAEEKSSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK     K  + V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKSAGAAK--LQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|196233595|ref|ZP_03132436.1| ribosomal protein L7/L12 [Chthoniobacter flavus Ellin428]
 gi|196222265|gb|EDY16794.1| ribosomal protein L7/L12 [Chthoniobacter flavus Ellin428]
          Length = 128

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 98/129 (75%), Gaps = 4/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++  ++VE+LS LT++E A+L K+LE++WGVSA+APV+V A     A  AA+  EKT F
Sbjct: 1   MADTNTLVEQLSGLTVLEVADLVKQLEEKWGVSAAAPVAVAAVGGGAAAPAAAAEEKTSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           +V+LK   D  KKIA+IKEVRA +  LGL EAK LVE APKSLK G++K+EA ++KKK+E
Sbjct: 61  DVILK-AADAAKKIAIIKEVRAAVPGLGLAEAKALVEGAPKSLKEGVTKEEAEDIKKKIE 119

Query: 118 DAGATVELR 126
            AG T+E++
Sbjct: 120 AAGGTIEIK 128


>gi|228470276|ref|ZP_04055180.1| ribosomal protein L7/L12 [Porphyromonas uenonis 60-3]
 gi|228308019|gb|EEK16894.1| ribosomal protein L7/L12 [Porphyromonas uenonis 60-3]
          Length = 124

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E L +LT+ E +EL + L++E+G+  +A    VA  AA A + A EK  F+V
Sbjct: 1   MADIKAIAETLVNLTVKEVSELKELLKEEYGIEPAAAAVAVAGPAAGAAAEAEEKNSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK F   K  +AV+K V+    LGLKEAKELV++AP ++K G+ K  A  +K  LE+AG
Sbjct: 61  VLKSFGSAK--LAVVKAVKEHAGLGLKEAKELVDAAPANIKEGVDKATAEALKAALEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|16799360|ref|NP_469628.1| 50S ribosomal protein L7/L12 [Listeria innocua Clip11262]
 gi|217965662|ref|YP_002351340.1| ribosomal protein L7/L12 [Listeria monocytogenes HCC23]
 gi|290892608|ref|ZP_06555601.1| ribosomal protein L12 [Listeria monocytogenes FSL J2-071]
 gi|315275369|ref|ZP_07869508.1| ribosomal protein L7/L12 [Listeria marthii FSL S4-120]
 gi|20978566|sp|Q92F24|RL7_LISIN RecName: Full=50S ribosomal protein L7/L12
 gi|254806379|sp|B8DF04|RL7_LISMH RecName: Full=50S ribosomal protein L7/L12
 gi|16412712|emb|CAC95516.1| ribosomal protein L12 [Listeria innocua Clip11262]
 gi|217334932|gb|ACK40726.1| ribosomal protein L7/L12 [Listeria monocytogenes HCC23]
 gi|290557917|gb|EFD91438.1| ribosomal protein L12 [Listeria monocytogenes FSL J2-071]
 gi|307569790|emb|CAR82969.1| rplL [Listeria monocytogenes L99]
 gi|313615694|gb|EFR88986.1| ribosomal protein L7/L12 [Listeria marthii FSL S4-120]
 gi|313620914|gb|EFR92091.1| ribosomal protein L7/L12 [Listeria innocua FSL S4-378]
          Length = 120

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 87/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   +++E  +L K +E+E+GV+A+APV+      A AG  A+E+TEF V L
Sbjct: 4   NIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVA-----VAAAGGGAAEQTEFTVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VR IT LGLKEAKELV++APK+LK G++KDEA E+K KLE+ GA 
Sbjct: 59  ASAGDSK--IKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKDEAEEIKAKLEEVGAN 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|33239679|ref|NP_874621.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|81665047|sp|Q7VDY8|RL7_PROMA RecName: Full=50S ribosomal protein L7/L12
 gi|33237204|gb|AAP99273.1| Ribosomal protein L7/L12 [Prochlorococcus marinus subsp. marinus
           str. CCMP1375]
          Length = 130

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 74/113 (65%), Gaps = 5/113 (4%)

Query: 18  EAAELSKRLEKEWGVSASAPVSVV----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIA 73
           EA+EL K++E+ +GVSA+A   VV            +AA EKTEF+VVL+ FD    KI 
Sbjct: 19  EASELVKQIEEAFGVSAAASAGVVMAAPGAATGGGEAAAEEKTEFDVVLESFD-ASAKIK 77

Query: 74  VIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           V+KEVR  T LGL +AK +VE+APK++K G SK++A  +KK +E  G  V L+
Sbjct: 78  VLKEVRNATGLGLGDAKAMVEAAPKTIKEGASKEDAEALKKAIEAVGGKVTLK 130


>gi|113954456|ref|YP_731912.1| 50S ribosomal protein L7/L12 [Synechococcus sp. CC9311]
 gi|123327537|sp|Q0I6L0|RL7_SYNS3 RecName: Full=50S ribosomal protein L7/L12
 gi|113881807|gb|ABI46765.1| ribosomal protein L7/L12 [Synechococcus sp. CC9311]
          Length = 128

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 75/108 (69%), Gaps = 3/108 (2%)

Query: 21  ELSKRLEKEWGVSASAPVSVV--APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEV 78
           EL K++E  +GVSA+A   VV  AP AA  G AA EKTEF+VVL+ FD    KI V+K V
Sbjct: 22  ELVKQIEDAFGVSAAASAGVVMAAPGAAGGGDAAEEKTEFDVVLESFD-AAAKIKVLKAV 80

Query: 79  RAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           R  T LGL +AK +VE+APK++K G+SKD+A  +KK +E+ G  V ++
Sbjct: 81  REATGLGLGDAKAMVEAAPKAIKEGVSKDDAEALKKAIEEVGGKVTIK 128


>gi|297737999|emb|CBI27200.3| unnamed protein product [Vitis vinifera]
          Length = 216

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 81/124 (65%), Gaps = 14/124 (11%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP--VAAEAGS---AAS-------- 53
           +V++++ LTL+E AELS  L K+ G+     V+++ P  VAA +G    AAS        
Sbjct: 74  LVDEIAGLTLVEVAELSSILRKKLGMKEPPVVAIMKPGAVAAVSGGGMKAASAAKEEKKP 133

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT FE+ L+ ++    KI +IKEVR+ TDLGLKEAK+LVE AP  LK G+SK+E  ++ 
Sbjct: 134 EKTVFELKLESYEA-ASKIKIIKEVRSFTDLGLKEAKDLVEKAPSVLKAGVSKEEGEQLV 192

Query: 114 KKLE 117
           +KL+
Sbjct: 193 EKLK 196


>gi|133085|sp|P02398|RK12_SPIOL RecName: Full=50S ribosomal protein L12, chloroplastic; AltName:
           Full=CL12; Flags: Precursor
 gi|170115|gb|AAA34031.1| ribosomal L12 precursor [Spinacia oleracea]
 gi|47154904|emb|CAA31551.1| SocL12 [Spinacia oleracea]
          Length = 189

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 80/126 (63%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTEFE 59
           IE +  +LS LTL EA  L   L+ + GVSA++     A  A  A + A+    EKTEF+
Sbjct: 64  IEQLGTQLSGLTLEEARVLVDWLQDKLGVSAASFAPAAAVAAPGAPADAAPAVEEKTEFD 123

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V +        +I+VIK VRA+T LGLKEAKEL+E  PK LK G+SKD+A + KK+LEDA
Sbjct: 124 VSIDEVPS-NARISVIKAVRALTSLGLKEAKELIEGLPKKLKEGVSKDDAEDAKKQLEDA 182

Query: 120 GATVEL 125
           GA V +
Sbjct: 183 GAKVSI 188


>gi|268592960|ref|ZP_06127181.1| ribosomal protein L7/L12 [Providencia rettgeri DSM 1131]
 gi|291311431|gb|EFE51884.1| ribosomal protein L7/L12 [Providencia rettgeri DSM 1131]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+VVL  
Sbjct: 6   DQILDAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK++VESAP ++K G SKDEA  +KK LE+AGA+VE
Sbjct: 62  V--GGNKVAVIKAVRGATGLGLKEAKDMVESAPATIKEGASKDEAEALKKSLEEAGASVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|269959040|ref|YP_003328829.1| 50S ribosomal protein L7/L12 [Anaplasma centrale str. Israel]
 gi|269848871|gb|ACZ49515.1| 50S ribosomal protein L7/L12 [Anaplasma centrale str. Israel]
          Length = 134

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 79/131 (60%), Gaps = 8/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA----GSAASEKTEF 58
           +++S+VE++  L L  AA L +++E + G      ++ +      A     S  +E+TEF
Sbjct: 5   DLDSLVEQICGLDLCSAAALVEKIEDKLGFPKGGLLTAMPAAGGAAQGAEDSGGAEQTEF 64

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVES-APKSLKTG--LSKDEANEMKKK 115
            V+  G+  P+KKIAVIK VR  T LGLKEAK+ VE    + L  G    K EA+E+KKK
Sbjct: 65  VVMFDGYA-PEKKIAVIKAVRECTTLGLKEAKDFVEQEGSRELVEGKKYKKAEADEVKKK 123

Query: 116 LEDAGATVELR 126
           LEDAGATV ++
Sbjct: 124 LEDAGATVSVK 134


>gi|308178147|ref|YP_003917553.1| 50S ribosomal protein L7/L12 [Arthrobacter arilaitensis Re117]
 gi|307745610|emb|CBT76582.1| 50S ribosomal protein L7/L12 [Arthrobacter arilaitensis Re117]
          Length = 124

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           +SN E ++     +T+IE +E  K  E+ +    +A    VA  AA   +AA E+TEF+V
Sbjct: 4   LSN-EELLSAFKEMTIIELSEFVKEFEETF--DVTAAAVAVAGPAAGGEAAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+   D  KKIAVIKEVRA+T LGLKEAKELV++APK+L  G++KD A + K+ LE AG
Sbjct: 61  VLESAGD--KKIAVIKEVRALTSLGLKEAKELVDAAPKALLEGVAKDAAEKAKEALEAAG 118

Query: 121 ATVELR 126
           ATV ++
Sbjct: 119 ATVSVK 124


>gi|217077414|ref|YP_002335132.1| 50S ribosomal protein L7/L12 [Thermosipho africanus TCF52B]
 gi|226734485|sp|B7ICR4|RL7_THEAB RecName: Full=50S ribosomal protein L7/L12
 gi|217037269|gb|ACJ75791.1| ribosomal protein L7/L12 [Thermosipho africanus TCF52B]
          Length = 128

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/129 (56%), Positives = 89/129 (68%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEV 60
            +E IV  +  LT+ E AEL K LE ++GVSASAPV  +    A AG AA+  EKTEF+V
Sbjct: 2   TLEEIVSAIEQLTVAELAELVKMLEDKFGVSASAPVMAMPMAGAAAGGAAAAEEKTEFDV 61

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESA--PKS-LKTGLSKDEANEMKKKLE 117
           VLK F    KKI VIK +R IT LGLKEAK+LVE A  P + +K G +K+EA E+KKKLE
Sbjct: 62  VLKSFG--AKKIEVIKVIREITGLGLKEAKDLVEKAGTPDAVVKQGAAKEEAEEIKKKLE 119

Query: 118 DAGATVELR 126
            AGA VEL+
Sbjct: 120 AAGAEVELK 128


>gi|317494914|ref|ZP_07953324.1| ribosomal protein L7/L12 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316917102|gb|EFV38451.1| ribosomal protein L7/L12 [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 121

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  +S +++++  EL   +E+++GVSA+A V+V A  A     AA EKTEF+V+LK 
Sbjct: 6   DDILNAVSEMSVMDVVELISMMEEKFGVSAAAAVAVAAGPA----EAAEEKTEFDVILKA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 62  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|168053626|ref|XP_001779236.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669335|gb|EDQ55924.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 150

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 79/132 (59%), Gaps = 16/132 (12%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGV-------------SASAPVSVVAPVAAEAGS 50
           ++ + E +S L+L+E ++L+  L ++ G+                   + VAP A E   
Sbjct: 18  VQRLAEDISKLSLLEVSDLTTLLRRKLGLPEGMGMMSMGMMPGMQMGGASVAPAAVE--E 75

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           A +EKT F+V L+ FD    KI +IKEVR  T+LGLKEAKELVE AP  LK+G+ K+EA 
Sbjct: 76  AKAEKTAFDVKLEKFD-AGSKIKIIKEVRTFTNLGLKEAKELVEKAPIVLKSGVGKEEAE 134

Query: 111 EMKKKLEDAGAT 122
           ++ +KL+  GAT
Sbjct: 135 QIVEKLKSVGAT 146


>gi|159902760|ref|YP_001550104.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9211]
 gi|226733721|sp|A9BDG4|RL7_PROM4 RecName: Full=50S ribosomal protein L7/L12
 gi|159887936|gb|ABX08150.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9211]
          Length = 132

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/115 (49%), Positives = 77/115 (66%), Gaps = 7/115 (6%)

Query: 18  EAAELSKRLEKEWGVSASAPVSVV------APVAAEAGSAASEKTEFEVVLKGFDDPKKK 71
           EA+EL K++E+ +GVSA+A   VV         A+ AG AA EKTEF+V+L+ FD    K
Sbjct: 19  EASELVKQIEEAFGVSAAASAGVVMAAPGAGGGASAAGEAAEEKTEFDVILESFD-AAAK 77

Query: 72  IAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           I V+KEVR  T LGL EAK +VE+APK++K G SK++A  +KK +E  G  V L+
Sbjct: 78  IKVLKEVRNATGLGLGEAKAMVEAAPKTIKEGASKEDAEALKKAIEAVGGKVTLK 132


>gi|320449276|ref|YP_004201372.1| 50S ribosomal protein L7/L12 [Thermus scotoductus SA-01]
 gi|320149445|gb|ADW20823.1| 50S ribosomal protein L7/L12 [Thermus scotoductus SA-01]
          Length = 125

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS-APVSVVAPVAAEAGSAASEKTEFEVV 61
           +IE I E+LS  T++E  +L   L++ WGV+A+       AP AA+A +   EKTEF+V+
Sbjct: 4   DIERIKEELSQATVLELKQLIDVLKETWGVTAAAPVAVAAAPAAAQAAAPVEEKTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  D   KK+ VIKE+RAIT LGLKEAK+L E     +K G+ K EA E+KKKLE  GA
Sbjct: 64  LK--DAGAKKLEVIKELRAITGLGLKEAKDLAEKGG-PIKEGIPKAEAEEIKKKLEAVGA 120

Query: 122 TVELR 126
            VEL+
Sbjct: 121 VVELK 125


>gi|104779747|ref|YP_606245.1| 50S ribosomal protein L7/L12 [Pseudomonas entomophila L48]
 gi|123381075|sp|Q1IFX4|RL7_PSEE4 RecName: Full=50S ribosomal protein L7/L12
 gi|95108734|emb|CAK13428.1| 50S ribosomal protein L7/L12 [Pseudomonas entomophila L48]
          Length = 122

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +   T++E  EL K +E+ +GV+A+A V+    VAA   +AA E+TEF VVL  
Sbjct: 6   EQIIEAIGQKTVLEIVELIKAMEETFGVTAAAAVAAGPAVAA---AAAEEQTEFNVVLTE 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+ VIK VR +T LGLKEAKE V+ AP+ +  G+SK+ A + KKKLE+AGA VE
Sbjct: 63  AGD--KKVNVIKAVRELTGLGLKEAKEKVDGAPQVIAEGVSKEAAEDAKKKLEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|242038223|ref|XP_002466506.1| hypothetical protein SORBIDRAFT_01g008970 [Sorghum bicolor]
 gi|241920360|gb|EER93504.1| hypothetical protein SORBIDRAFT_01g008970 [Sorghum bicolor]
          Length = 166

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA------------EAGS 50
            + ++V+++  LTL+EA+ L+  L    GV    P++++   AA            E   
Sbjct: 32  RVSALVDEICGLTLLEASSLADTLRGRLGVDQMPPLAILTGGAALVGGGVGPGAAGEEAK 91

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           A  EK  F+V L+GFD    K+ +IKE+RA T LGLKEAKELVE AP  LK G+ K+EA 
Sbjct: 92  AKEEKMAFDVKLEGFDA-AAKLKIIKELRAFTSLGLKEAKELVEKAPAVLKAGVPKEEAE 150

Query: 111 EMKKKLEDAGATVEL 125
            + +K+   GA + L
Sbjct: 151 SIAEKMRAVGAKIVL 165


>gi|269219021|ref|ZP_06162875.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 848 str.
           F0332]
 gi|269212132|gb|EEZ78472.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 848 str.
           F0332]
          Length = 129

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 87/127 (68%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFE 59
            IE ++     LTL+E  E  K  E+E+ V+A+APV+ VA   A  G AA+    K  F+
Sbjct: 5   TIEELIAAFKELTLVELNEFVKAFEEEFDVTAAAPVAAVAAAPAAGGEAAAVEEEKDSFD 64

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL+   D  KK+AVIKEVRA+T LGLKEAK+LV+SAPK++  G+ K+ AN+ K++LE A
Sbjct: 65  VVLEAAGD--KKVAVIKEVRALTSLGLKEAKDLVDSAPKAVLEGVDKEAANKAKEQLEGA 122

Query: 120 GATVELR 126
           GA+V ++
Sbjct: 123 GASVTVK 129


>gi|94312266|ref|YP_585476.1| 50S ribosomal protein L7/L12 [Cupriavidus metallidurans CH34]
 gi|123383585|sp|Q1LI19|RL7_RALME RecName: Full=50S ribosomal protein L7/L12
 gi|93356118|gb|ABF10207.1| 50S ribosomal subunit protein L7/L12 [Cupriavidus metallidurans
           CH34]
          Length = 124

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + +++++E  +L K  E+++GVSA+A     AP A  A +AA EKTEF V+L  
Sbjct: 6   DDILEAVGAMSVMELNDLVKAFEEKFGVSAAAMAVAAAPGAGGA-AAAEEKTEFNVILAE 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR IT LGLKEAK+LV+ APK +K G+ K  A++ KKKLEDAGA V+
Sbjct: 65  V--GSNKVGVIKAVREITGLGLKEAKDLVDGAPKPVKEGVDKATADDAKKKLEDAGAKVD 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|315639701|ref|ZP_07894840.1| ribosomal protein L7/L12 [Enterococcus italicus DSM 15952]
 gi|315484478|gb|EFU74935.1| ribosomal protein L7/L12 [Enterococcus italicus DSM 15952]
          Length = 121

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 85/124 (68%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+IVE+L   T++E  +L K +E+E+GVSA+APV+V A  A    +AA E+TEF V L
Sbjct: 4   NIENIVEELKGATILELNDLVKAIEEEFGVSAAAPVAVAAAGA----AAAEEQTEFTVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  +K+ VIK VR  T LGLKEAK +V+ AP  +K G+SK+EA  +K  LE+ GA+
Sbjct: 60  TAAGD--QKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGISKEEAEALKATLEEVGAS 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|254525462|ref|ZP_05137514.1| ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT 9202]
 gi|221536886|gb|EEE39339.1| ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT 9202]
          Length = 131

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 74/111 (66%), Gaps = 6/111 (5%)

Query: 21  ELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVI 75
           EL K++E+ +GVSA+A   VV     A      G AA EKTEF+VVL+ FD    KI V+
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAGGDGDGGAAEEKTEFDVVLESFD-AAAKIKVL 80

Query: 76  KEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           K VR  T LGL +AK LVESAPK++K G++K +A  +KK++E+AG  V L+
Sbjct: 81  KVVRNATGLGLGDAKTLVESAPKTVKEGIAKADAESLKKEIEEAGGKVTLK 131


>gi|157412559|ref|YP_001483425.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9215]
 gi|166990987|sp|A8G2K8|RL7_PROM2 RecName: Full=50S ribosomal protein L7/L12
 gi|157387134|gb|ABV49839.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9215]
          Length = 131

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 73/111 (65%), Gaps = 6/111 (5%)

Query: 21  ELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVI 75
           EL K++E+ +GVSA+A   VV     A        AA EKTEF+VVL+ FD    KI V+
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAGGDGDDGAAEEKTEFDVVLESFD-AAAKIKVL 80

Query: 76  KEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           K VR  T LGL +AK LVESAPK++K G++K +A  +KK++E+AG  V L+
Sbjct: 81  KVVRNATGLGLGDAKTLVESAPKTVKEGIAKADAESLKKEIEEAGGKVTLK 131


>gi|183597456|ref|ZP_02958949.1| hypothetical protein PROSTU_00729 [Providencia stuartii ATCC 25827]
 gi|188023205|gb|EDU61245.1| hypothetical protein PROSTU_00729 [Providencia stuartii ATCC 25827]
          Length = 122

 Score = 79.3 bits (194), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++  EL   +E+++GVSA+A V+V    AA    AA EKTEF+VVL  
Sbjct: 6   DQILDAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAPGAAA---EAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK++VESAP ++K G SKDEA  +KK LE+AGA+VE
Sbjct: 63  V--GGNKVAVIKAVRGATGLGLKEAKDMVESAPATIKEGASKDEAEALKKSLEEAGASVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|15896393|ref|NP_349742.1| ribosomal protein L7/L12 [Clostridium acetobutylicum ATCC 824]
 gi|20978568|sp|Q97EG8|RL7_CLOAB RecName: Full=50S ribosomal protein L7/L12
 gi|15026211|gb|AAK81082.1|AE007810_1 Ribosomal protein L7/L12 [Clostridium acetobutylicum ATCC 824]
 gi|325510549|gb|ADZ22185.1| Ribosomal protein L7/L12 [Clostridium acetobutylicum EA 2018]
          Length = 123

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  ++++E  EL K  E+E+GVSA+APV+V     A   +A  EKTEF+VVL  
Sbjct: 4   EEIIEAIKGMSVLELNELVKACEEEFGVSAAAPVAVAGAAGAAGAAAGEEKTEFDVVLA- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   KK+ VIK VR +T LGLK+AK LV+ APK++K G++K+EA  MK K+E+AG  VE
Sbjct: 63  -EAGAKKLQVIKVVRELTGLGLKDAKALVDGAPKTIKEGVAKEEAESMKAKIEEAGGKVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|270265423|ref|ZP_06193682.1| 50S ribosomal protein L7/L12 [Serratia odorifera 4Rx13]
 gi|270040616|gb|EFA13721.1| 50S ribosomal protein L7/L12 [Serratia odorifera 4Rx13]
          Length = 104

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 55/73 (75%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKTEF+VVL        K+AVIK VR  T LGLKEAK+LVESAP  LK G+SKD+A  +K
Sbjct: 34  EKTEFDVVLSAIGG--NKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGISKDDAEALK 91

Query: 114 KKLEDAGATVELR 126
           K LE+AGA+VE++
Sbjct: 92  KALEEAGASVEVK 104


>gi|229586378|ref|YP_002844879.1| 50S ribosomal protein L7/L12 [Rickettsia africae ESF-5]
 gi|259491655|sp|C3PMH6|RL7_RICAE RecName: Full=50S ribosomal protein L7/L12
 gi|228021428|gb|ACP53136.1| 50S ribosomal protein L7/L12 [Rickettsia africae ESF-5]
          Length = 125

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 68/127 (53%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV+V A  AA   + A   KTEFE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKILEEKWGVSAAAPVAVAAAGAAAPAAEAVAEKTEFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL    D K ++   K V+ IT LGL EAK+LV+ APK +K+ + K +A+E+K KLE A
Sbjct: 61  VVLTAAGDKKVEVI--KVVKDITGLGLIEAKKLVDEAPKPIKSNVKKADADEIKGKLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|313206999|ref|YP_004046176.1| LSU ribosomal protein l12p [Riemerella anatipestifer DSM 15868]
 gi|312446315|gb|ADQ82670.1| LSU ribosomal protein L12P [Riemerella anatipestifer DSM 15868]
 gi|325335567|gb|ADZ11841.1| Ribosomal protein L7/L12 [Riemerella anatipestifer RA-GD]
          Length = 122

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL++ L+ E+G+  +A   V A  A  AG AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELAQILKDEYGIEPAAATVVAA--AGGAGEAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+A++K V+ +T  GLKEAK++V+ AP  +K G+SKDEA  +KK+LE+AG
Sbjct: 59  ILKSAG--ASKLAIVKLVKDLTGAGLKEAKDIVDGAPAPIKEGVSKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|78776553|ref|YP_392868.1| 50S ribosomal protein L7/L12 [Sulfurimonas denitrificans DSM 1251]
 gi|109893816|sp|Q30TP8|RL7_SULDN RecName: Full=50S ribosomal protein L7/L12
 gi|78497093|gb|ABB43633.1| LSU ribosomal protein L12P [Sulfurimonas denitrificans DSM 1251]
          Length = 122

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 79/122 (64%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +S L+++E +EL K  E+++GVSA         VAA    A  E+TEF V++  
Sbjct: 6   QDVLEFISGLSVLELSELVKEFEEKFGVSAQPVAVAGGAVAA---VAVEEQTEFNVIIT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+  E+ P ++K G+ K+ A   KK+LE+AGA VE
Sbjct: 62  -DAGDKKINVIKVVRALTGLGLKEAKDATENVPSTIKEGVDKETAMNAKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|323344619|ref|ZP_08084843.1| 50S ribosomal protein L7/L12 [Prevotella oralis ATCC 33269]
 gi|323093889|gb|EFZ36466.1| 50S ribosomal protein L7/L12 [Prevotella oralis ATCC 33269]
          Length = 125

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A   +AA+E KT F+
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAGDAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   +    K+ V+K V+    LGLKEAK+LV+ AP ++K GLSKDEA  +KK +E+A
Sbjct: 61  VVLA--EVGATKLQVVKAVKEACGLGLKEAKDLVDGAPATIKEGLSKDEAENLKKAIEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|309812284|ref|ZP_07706039.1| ribosomal protein L7/L12 [Dermacoccus sp. Ellin185]
 gi|308433589|gb|EFP57466.1| ribosomal protein L7/L12 [Dermacoccus sp. Ellin185]
          Length = 128

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 87/128 (67%), Gaps = 5/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           +SN E ++E    +TLIE +E     E  + V+A+APV+  A  AA  G A +  EK+EF
Sbjct: 4   LSNDE-LLEAFKEMTLIELSEFVTLFEDTFNVTAAAPVAAAAAPAAGGGDAGAAEEKSEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L    D  KKI VIKEVRA+T LGLKEAK+LV+ APK +  G++KD A++ K+ LE 
Sbjct: 63  DVILASAGD--KKIQVIKEVRALTSLGLKEAKDLVDGAPKPVLEGVAKDAADKAKEALEG 120

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 121 AGATVEVK 128


>gi|304310008|ref|YP_003809606.1| 50S Ribosomal protein L7/L12 [gamma proteobacterium HdN1]
 gi|301795741|emb|CBL43940.1| 50S Ribosomal protein L7/L12 [gamma proteobacterium HdN1]
          Length = 124

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/122 (41%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ +++++  EL   +E ++GV+A+APV++ A  AA A +   E+TEF V++  
Sbjct: 6   DDILNAIAEMSVMDLVELISAIEDKFGVTAAAPVAIAAGPAAAA-APVEEQTEFNVIMTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   + K+ VIK +RAIT LGLKEAK++VE  P ++K G+SK +A+++KK+LE+AGA V+
Sbjct: 65  F--GENKVNVIKVIRAITGLGLKEAKDMVEGVPATVKEGISKKDADDLKKQLEEAGAKVD 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|290477017|ref|YP_003469929.1| 50S ribosomal subunit protein L7/L12 [Xenorhabdus bovienii SS-2004]
 gi|289176362|emb|CBJ83167.1| 50S ribosomal subunit protein L7/L12 [Xenorhabdus bovienii SS-2004]
          Length = 121

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/72 (59%), Positives = 55/72 (76%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L        K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK
Sbjct: 52  KTEFDVILSSI--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGISKDDAEALKK 109

Query: 115 KLEDAGATVELR 126
            LE+AGA+VE++
Sbjct: 110 SLEEAGASVEIK 121


>gi|123967756|ref|YP_001008614.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. AS9601]
 gi|126695559|ref|YP_001090445.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9301]
 gi|166222192|sp|A3PAR9|RL7_PROM0 RecName: Full=50S ribosomal protein L7/L12
 gi|166222195|sp|A2BNZ6|RL7_PROMS RecName: Full=50S ribosomal protein L7/L12
 gi|123197866|gb|ABM69507.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. AS9601]
 gi|126542602|gb|ABO16844.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9301]
          Length = 131

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/111 (49%), Positives = 74/111 (66%), Gaps = 6/111 (5%)

Query: 21  ELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVI 75
           EL K++E+ +GVSA+A   VV     A      G AA EKTEF+VVL+ FD    KI V+
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAGGDADGGAAEEKTEFDVVLESFD-AAAKIKVL 80

Query: 76  KEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           K VR  T LGL +AK LVESAPK++K G++K +A  +KK++E+AG  V L+
Sbjct: 81  KVVRNATGLGLGDAKALVESAPKTVKEGIAKADAESLKKEIEEAGGKVTLK 131


>gi|311070752|ref|YP_003975675.1| 50S ribosomal protein L7/L12 [Bacillus atrophaeus 1942]
 gi|310871269|gb|ADP34744.1| 50S ribosomal protein L7/L12 [Bacillus atrophaeus 1942]
          Length = 123

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 83/124 (66%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   T++E  +L K +E+E+    +A   V     A AG AA E++EF+++L
Sbjct: 4   NIEEIIASVKEATVLELNDLVKAIEEEF--GVTAAAPVAVAGGAAAGGAAEEQSEFDLIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G     +KI VIK VR IT LGLKEAKELV++ PK LK G++K+EA E+K KLE+ GA+
Sbjct: 62  SGAGG--QKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGAS 119

Query: 123 VELR 126
           VE++
Sbjct: 120 VEVK 123


>gi|300857729|ref|YP_003782712.1| 50S ribosomal protein L7/L12 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|300685183|gb|ADK28105.1| 50S ribosomal protein L7/L12 [Corynebacterium pseudotuberculosis
           FRC41]
 gi|302330022|gb|ADL20216.1| 50S ribosomal protein L7/L12 [Corynebacterium pseudotuberculosis
           1002]
          Length = 127

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TLIE +E  K  E+ + V+A+APV+V AP AA A +AA EKTEF+VVL+ 
Sbjct: 7   DELIEAFKEMTLIELSEFVKEFEEVFEVTAAAPVAVAAPGAAGAEAAAEEKTEFDVVLE- 65

Query: 65  FDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            D   KKI VIK VR I + LGLKEAKELVESAPK++    SKD+A   K KLE+AGA V
Sbjct: 66  -DAGAKKIGVIKAVREIVSGLGLKEAKELVESAPKAIIEAASKDDAEAAKAKLEEAGAKV 124

Query: 124 ELR 126
            L+
Sbjct: 125 TLK 127


>gi|160934073|ref|ZP_02081460.1| hypothetical protein CLOLEP_02936 [Clostridium leptum DSM 753]
 gi|156866746|gb|EDO60118.1| hypothetical protein CLOLEP_02936 [Clostridium leptum DSM 753]
          Length = 132

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/122 (54%), Positives = 89/122 (72%), Gaps = 4/122 (3%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVLKG 64
           ++E + SLT++E +EL K LE+E+GVSA+APV+V A  AA   + A+  EKTEF+VVLK 
Sbjct: 13  LIEDVKSLTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGGAAPAAAEEKTEFDVVLKA 72

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KIAVIK VR  T LGLKEAK LV+ APK++K G+SKD+A  +K KL +AGA VE
Sbjct: 73  A--GANKIAVIKVVREATGLGLKEAKALVDGAPKNVKEGVSKDDAEALKAKLTEAGAEVE 130

Query: 125 LR 126
           ++
Sbjct: 131 VK 132


>gi|229542214|ref|ZP_04431274.1| ribosomal protein L7/L12 [Bacillus coagulans 36D1]
 gi|229326634|gb|EEN92309.1| ribosomal protein L7/L12 [Bacillus coagulans 36D1]
          Length = 121

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  +T++E  +L K +E+E+    +A   V     A  G AA+EKTEF+VVL  
Sbjct: 4   EEIISAVKEMTVLELNDLVKAIEEEF--GVTAAAPVAVAGGAAGGEAAAEKTEFDVVLT- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR IT LGLKEAKELV++APK LK G+SK+EA E+K KLE+ GA VE
Sbjct: 61  -EVGAQKIKVIKVVREITGLGLKEAKELVDNAPKPLKEGVSKEEAEELKAKLEEVGAGVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|121534750|ref|ZP_01666571.1| ribosomal protein L7/L12 [Thermosinus carboxydivorans Nor1]
 gi|121306770|gb|EAX47691.1| ribosomal protein L7/L12 [Thermosinus carboxydivorans Nor1]
          Length = 125

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (71%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+E +  +T++E AEL K LE+++GVSA+APV+V A  AA A +A +  EKTEF+V+L
Sbjct: 4   EQIMEAIEKMTVLELAELVKALEEKFGVSAAAPVAVAAAPAAGAAAAPAAEEKTEFDVIL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR IT LGLKEAK+LV+ APK +K  +SK +A  +K KL +AGAT
Sbjct: 64  T--NPGAGKINVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKADAEAIKAKLVEAGAT 121

Query: 123 VELR 126
           VE++
Sbjct: 122 VEIK 125


>gi|297838809|ref|XP_002887286.1| hypothetical protein ARALYDRAFT_476144 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297333127|gb|EFH63545.1| hypothetical protein ARALYDRAFT_476144 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 204

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 82/130 (63%), Gaps = 12/130 (9%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP--------VAAEAG---SAASEK 55
           +V+++SSLTL E +EL K + K+ G++    V+V+ P        + +++G    A  EK
Sbjct: 75  LVDEISSLTLSEISELGKIIMKKKGMTELPTVAVMKPGAGGGGGGMVSQSGVSEEAKVEK 134

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           T FE+ L+ F+    KI +IKE+R+ TDLGLKEAK LVE  P  LK GLSK+E  ++ +K
Sbjct: 135 TVFEIKLESFE-ASAKIKIIKELRSFTDLGLKEAKALVEKTPAILKAGLSKEEGEKILEK 193

Query: 116 LEDAGATVEL 125
           L+  GA V L
Sbjct: 194 LKALGAKVVL 203


>gi|330718915|ref|ZP_08313515.1| 50S ribosomal protein L7/L12 [Leuconostoc fallax KCTC 3537]
          Length = 121

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++I+  L   T+++ A+L   +E+E+GVSA+APV+          + A+ KTEF+V L  
Sbjct: 6   DAIIASLKDATILDLADLVSAIEEEFGVSAAAPVAAAGADG----AGAAAKTEFDVELTS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR +T LGLKEAK+LV++AP ++K G+S+DEANE+K KLE+ GA+V 
Sbjct: 62  A--GTAKVKVIKAVREVTGLGLKEAKDLVDNAPSNIKEGISEDEANELKAKLEETGASVT 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|326334488|ref|ZP_08200699.1| 50S ribosomal protein L7/L12 [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325693257|gb|EGD35185.1| 50S ribosomal protein L7/L12 [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 125

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV-SASAPVSVVAPVAAEAGSAASEKTEFE 59
           M+++++  E+L +LT+ E  EL++ L+ E+G+  A+A V+V A  AA  G AA+EKTEF+
Sbjct: 1   MADLKNFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAGPAAGGGEAAAEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK +A  +KK LE+A
Sbjct: 61  VILKSA--GANKLAVVKLVKDLTGLGLKEAKEMVDGAPSKVKEGVSKADAENLKKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|198277435|ref|ZP_03209966.1| hypothetical protein BACPLE_03654 [Bacteroides plebeius DSM 17135]
 gi|325299611|ref|YP_004259528.1| ribosomal protein L7/L12 [Bacteroides salanitronis DSM 18170]
 gi|198269933|gb|EDY94203.1| hypothetical protein BACPLE_03654 [Bacteroides plebeius DSM 17135]
 gi|324319164|gb|ADY37055.1| ribosomal protein L7/L12 [Bacteroides salanitronis DSM 18170]
          Length = 125

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 87/127 (68%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAAGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK     K  + V+K V+    LGLKEAK+LV+ AP ++K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKSAGAAK--LQVVKAVKEACGLGLKEAKDLVDGAPSTVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|16077173|ref|NP_387986.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|154684623|ref|YP_001419784.1| 50S ribosomal protein L7/L12 [Bacillus amyloliquefaciens FZB42]
 gi|221307917|ref|ZP_03589764.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221312238|ref|ZP_03594043.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. subtilis
           str. NCIB 3610]
 gi|221317172|ref|ZP_03598466.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. subtilis
           str. JH642]
 gi|221321435|ref|ZP_03602729.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. subtilis
           str. SMY]
 gi|296333102|ref|ZP_06875556.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305672804|ref|YP_003864475.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|308171996|ref|YP_003918701.1| 50S ribosomal protein L12 (BL9) [Bacillus amyloliquefaciens DSM 7]
 gi|321313776|ref|YP_004206063.1| 50S ribosomal protein L7/L12 [Bacillus subtilis BSn5]
 gi|1173064|sp|P02394|RL7_BACSU RecName: Full=50S ribosomal protein L7/L12; AltName: Full=BL9;
           AltName: Full=Vegetative protein 341; Short=VEG341
 gi|166222134|sp|A7Z0M7|RL7_BACA2 RecName: Full=50S ribosomal protein L7/L12
 gi|2632372|emb|CAB11881.1| ribosomal protein L12 (BL9) [Bacillus subtilis subsp. subtilis str.
           168]
 gi|154350474|gb|ABS72553.1| RplL [Bacillus amyloliquefaciens FZB42]
 gi|291482477|dbj|BAI83552.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. natto
           BEST195]
 gi|296149718|gb|EFG90613.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. spizizenii
           ATCC 6633]
 gi|305411047|gb|ADM36165.1| 50S ribosomal protein L7/L12 [Bacillus subtilis subsp. spizizenii
           str. W23]
 gi|307604860|emb|CBI41231.1| ribosomal protein L12 (BL9) [Bacillus amyloliquefaciens DSM 7]
 gi|320020050|gb|ADV95036.1| 50S ribosomal protein L7/L12 [Bacillus subtilis BSn5]
 gi|328551806|gb|AEB22298.1| 50S ribosomal protein L7/L12 [Bacillus amyloliquefaciens TA208]
 gi|328910067|gb|AEB61663.1| 50S ribosomal protein L7/L12 [Bacillus amyloliquefaciens LL3]
          Length = 123

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 83/124 (66%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   T++E  +L K +E+E+    +A   V     A AG AA E++EF+++L
Sbjct: 4   NIEEIIASVKEATVLELNDLVKAIEEEF--GVTAAAPVAVAGGAAAGGAAEEQSEFDLIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G     +KI VIK VR IT LGLKEAKELV++ PK LK G++K+EA E+K KLE+ GA+
Sbjct: 62  AGAGS--QKIKVIKVVREITGLGLKEAKELVDNTPKPLKEGIAKEEAEELKAKLEEVGAS 119

Query: 123 VELR 126
           VE++
Sbjct: 120 VEVK 123


>gi|120436716|ref|YP_862402.1| 50S ribosomal protein L7/L12 [Gramella forsetii KT0803]
 gi|166222171|sp|A0M3Z0|RL7_GRAFK RecName: Full=50S ribosomal protein L7/L12
 gi|117578866|emb|CAL67335.1| 50S ribosomal protein L7/L12 [Gramella forsetii KT0803]
          Length = 124

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G  A E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGGAAGGEEAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L        K+AV+K V+ +T LGLK+AK LV+ APK +K G++KDEA  +K +LE+AG
Sbjct: 61  ILTA--PGGSKLAVVKLVKELTGLGLKDAKALVDEAPKPVKEGVAKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|4469298|emb|CAB38448.1| 50S ribosomal protein L12 [Prototheca wickerhamii]
          Length = 134

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 79/123 (64%), Gaps = 5/123 (4%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAP-VSVVAPVAAE---AGSAASEKTEFEVVL 62
           I+EKL ++TL+EA EL  ++EK +GV ASAP VS + P+  E         EKT F+V+L
Sbjct: 12  ILEKLKAITLLEATELVSQIEKTFGVDASAPAVSGLRPILVEPIKQEDIIEEKTTFDVIL 71

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +      K++ ++K +RA+T L LK+AKE +   PK++  G+SK+E+   K++LE  G  
Sbjct: 72  EEVPS-DKRVPILKVIRALTSLDLKQAKESITDLPKTILQGVSKEESEAAKQQLEAVGGK 130

Query: 123 VEL 125
           +++
Sbjct: 131 IKV 133


>gi|15612685|ref|NP_240988.1| 50S ribosomal protein L7/L12 [Bacillus halodurans C-125]
 gi|14195174|sp|Q9KGE3|RL7_BACHD RecName: Full=50S ribosomal protein L7/L12
 gi|10172734|dbj|BAB03841.1| 50S ribosomal protein L7/L12 [Bacillus halodurans C-125]
          Length = 121

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 80/122 (65%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  +T++E  +L K +E+E+    +A   V     A A   A+EKTEF+VVL+ 
Sbjct: 4   DQIIEAIKEMTVLELNDLVKAIEEEF--GVTAAAPVAVAGGAAAEGGAAEKTEFDVVLES 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               K  I VIK VR IT LGLKEAK LV+ AP  +K G++K+EA EMK KLE+AGA+VE
Sbjct: 62  AGGSK--INVIKVVREITGLGLKEAKALVDGAPAPIKEGVAKEEAEEMKAKLEEAGASVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|325680457|ref|ZP_08160006.1| ribosomal protein L7/L12 [Ruminococcus albus 8]
 gi|324107826|gb|EGC02093.1| ribosomal protein L7/L12 [Ruminococcus albus 8]
          Length = 123

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 84/123 (68%), Gaps = 5/123 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I + VE++ +++++E  EL   +++E+GV+A    +  A   A   +A +EKTEF+VVL 
Sbjct: 6   IMNFVEEIKTMSVLELKELVDAIQEEFGVTAVVAAAGPAAGGA---AAEAEKTEFDVVLA 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D  +K+AVIK V+ IT LGLKEAK LVE APK++K    K EA ++K KLE AGATV
Sbjct: 63  SFGD--QKMAVIKAVKEITGLGLKEAKALVEEAPKAIKEAAPKAEAEDIKAKLEAAGATV 120

Query: 124 ELR 126
           EL+
Sbjct: 121 ELK 123


>gi|282858389|ref|ZP_06267569.1| ribosomal protein L7/L12 [Prevotella bivia JCVIHMP010]
 gi|282588837|gb|EFB93962.1| ribosomal protein L7/L12 [Prevotella bivia JCVIHMP010]
          Length = 125

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA   +A +E KT F+
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAGPAAAGAAAGAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    K+ V+K V+    LGLKEAK+LV+ AP +LK G+SKDEA  +KK +E  
Sbjct: 61  VVLA--DAGANKLKVVKAVKEACGLGLKEAKDLVDGAPSTLKEGMSKDEAENLKKAIEAE 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|33866870|ref|NP_898429.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 8102]
 gi|81573732|sp|Q7U3T9|RL7_SYNPX RecName: Full=50S ribosomal protein L7/L12
 gi|33639471|emb|CAE08855.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 8102]
          Length = 131

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 72/111 (64%), Gaps = 6/111 (5%)

Query: 21  ELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVI 75
           EL K++E+ +GVSA+A   VV     A      G  A EKTEF+V+L+ FD    KI V+
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAAGGGGGEVAEEKTEFDVILESFD-AAAKIKVL 80

Query: 76  KEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           K VR  T LGL +AK LVE+APK +K G+SKDEA  +KK++E+ G  V L+
Sbjct: 81  KAVRNATGLGLGDAKALVEAAPKPIKEGISKDEAEALKKEIEEVGGKVTLK 131


>gi|261880896|ref|ZP_06007323.1| ribosomal protein L7/L12 [Prevotella bergensis DSM 17361]
 gi|270332404|gb|EFA43190.1| ribosomal protein L7/L12 [Prevotella bergensis DSM 17361]
          Length = 126

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 84/128 (65%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++++I E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA   + A+  EK+ F
Sbjct: 1   MADVKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAGPAAGGAADAAAEEKSSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL   D    K+ V+K V+    LGLKEAK LVE AP ++K GLSKDEA  +KK +E+
Sbjct: 61  DVVLT--DIGATKLQVVKAVKEACGLGLKEAKALVEGAPAAIKEGLSKDEAENLKKAIEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|85058111|ref|YP_453813.1| 50S ribosomal protein L7/L12 [Sodalis glossinidius str.
           'morsitans']
 gi|109893803|sp|Q2NWR7|RL7_SODGM RecName: Full=50S ribosomal protein L7/L12
 gi|84778631|dbj|BAE73408.1| 50S ribosomal subunit protein L7/L12 [Sodalis glossinidius str.
           'morsitans']
          Length = 122

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 54/72 (75%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+VVL        K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK
Sbjct: 53  KTEFDVVLSAI--GANKVAVIKAVRGATGLGLKEAKDLVESAPATLKEGVSKDDAETLKK 110

Query: 115 KLEDAGATVELR 126
            LE AGA+VE++
Sbjct: 111 DLEQAGASVEVK 122


>gi|300871175|ref|YP_003786047.1| 50S ribosomal protein L7 L12 [Brachyspira pilosicoli 95/1000]
 gi|300688875|gb|ADK31546.1| 50S ribosomal protein L7 L12 [Brachyspira pilosicoli 95/1000]
          Length = 129

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/125 (45%), Positives = 91/125 (72%), Gaps = 4/125 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E I++ +  + +IE  EL + +++++ V+A+ PV+ VA   A  G+AA+   EK++F+V+
Sbjct: 6   EEILQAIEEMKVIELHELVEAIKEKFNVTAAMPVAAVAAAPAAGGAAAAADEEKSDFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L GFD   +KIA+IKEVRA++ LGLKEAK+ VE   +++K+G+SKDEA  +KK+LE AG 
Sbjct: 66  LTGFD-AAQKIALIKEVRAVSGLGLKEAKDAVEKGGETIKSGVSKDEAAAIKKQLEAAGG 124

Query: 122 TVELR 126
            VE++
Sbjct: 125 KVEIK 129


>gi|85057742|ref|YP_456658.1| 50S ribosomal protein L7/L12 [Aster yellows witches'-broom
           phytoplasma AYWB]
 gi|84789847|gb|ABC65579.1| LSU ribosomal protein L12P [Aster yellows witches'-broom
           phytoplasma AYWB]
          Length = 136

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E+ V  L  ++L+E  EL   L++++G+  +A ++V AP A  A     EKTEF VV+K 
Sbjct: 18  EAFVSALKEMSLLEIKELLDGLKEDFGIDPTA-LAVAAPGANNAAEV-EEKTEFTVVMKS 75

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           FD+ KKK+AVIK VR +T LGL +A   V+     +K  +SK  A ++K KLE AGA VE
Sbjct: 76  FDE-KKKLAVIKTVREVTGLGLLDAANFVKVPGSKVKENVSKVLAEDIKNKLEQAGAVVE 134

Query: 125 LR 126
           L+
Sbjct: 135 LQ 136


>gi|14195108|sp|O99010|RK12_PROWI RecName: Full=50S ribosomal protein L12, plastid
          Length = 130

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/123 (39%), Positives = 79/123 (64%), Gaps = 5/123 (4%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAP-VSVVAPVAAEA---GSAASEKTEFEVVL 62
           I+EKL ++TL+EA EL  ++EK +GV ASAP VS + P+  E         EKT F+V+L
Sbjct: 8   ILEKLKAITLLEATELVSQIEKTFGVDASAPAVSGLRPILVEPIKQEDIIEEKTTFDVIL 67

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +      K++ ++K +RA+T L LK+AKE +   PK++  G+SK+E+   K++LE  G  
Sbjct: 68  EEVPS-DKRVPILKVIRALTSLDLKQAKESITDLPKTILQGVSKEESEAAKQQLEAVGGK 126

Query: 123 VEL 125
           +++
Sbjct: 127 IKV 129


>gi|301155465|emb|CBW14931.1| 50S ribosomal subunit protein L7/L12 [Haemophilus parainfluenzae
           T3T1]
          Length = 123

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKTEF+VVL   +    K+AVIK VR  T LGLKEAK+LVESAP +LK G+SK+EA  +K
Sbjct: 53  EKTEFDVVLA--EAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGISKEEAEALK 110

Query: 114 KKLEDAGATVELR 126
           K+LE+AGA VE++
Sbjct: 111 KELEEAGAKVEIK 123


>gi|256852102|ref|ZP_05557489.1| ribosomal protein L7/L12 [Lactobacillus jensenii 27-2-CHN]
 gi|260661328|ref|ZP_05862241.1| ribosomal protein L7/L12 [Lactobacillus jensenii 115-3-CHN]
 gi|282934789|ref|ZP_06340027.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
 gi|297205023|ref|ZP_06922419.1| ribosomal protein L7/L12 [Lactobacillus jensenii JV-V16]
 gi|256615514|gb|EEU20704.1| ribosomal protein L7/L12 [Lactobacillus jensenii 27-2-CHN]
 gi|260547783|gb|EEX23760.1| ribosomal protein L7/L12 [Lactobacillus jensenii 115-3-CHN]
 gi|281301152|gb|EFA93458.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
 gi|297149601|gb|EFH29898.1| ribosomal protein L7/L12 [Lactobacillus jensenii JV-V16]
          Length = 120

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 89/124 (71%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E+L   T++E  +L K +E+E+ V+A+APV+     AA A + A+ KTEF+V L
Sbjct: 4   DTEKIIEELKGATILELNDLVKAIEEEFDVTAAAPVA-----AAGAAAGAAAKTEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK +K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVREITGLGLKDSKDLVDGAPKVIKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V ++
Sbjct: 117 VTVK 120


>gi|226942769|ref|YP_002797842.1| 50S ribosomal protein L7/L12 [Azotobacter vinelandii DJ]
 gi|259491638|sp|C1DKK4|RL7_AZOVD RecName: Full=50S ribosomal protein L7/L12
 gi|226717696|gb|ACO76867.1| 50S ribosomal protein L7/L12 [Azotobacter vinelandii DJ]
          Length = 122

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +S +++++  EL K +E+++GV+A+A V+     AA     A E+TEF VVL  
Sbjct: 6   EDIINAVSEMSVMQIVELIKAMEEKFGVTAAAAVAAGPAAAA---PVAEEQTEFTVVLAE 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+ VIK VR +T LGLKEAK +V+ AP  +K G+SKDEA   KK LE+AGA VE
Sbjct: 63  AGD--KKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGISKDEAEAAKKALEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|227502621|ref|ZP_03932670.1| 50S ribosomal protein L7/L12 [Corynebacterium accolens ATCC 49725]
 gi|306835188|ref|ZP_07468224.1| ribosomal protein L7/L12 [Corynebacterium accolens ATCC 49726]
 gi|227076661|gb|EEI14624.1| 50S ribosomal protein L7/L12 [Corynebacterium accolens ATCC 49725]
 gi|304568943|gb|EFM44472.1| ribosomal protein L7/L12 [Corynebacterium accolens ATCC 49726]
          Length = 129

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 83/125 (66%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG--SAASEKTEFEVVL 62
           + ++E    +TLIE +E  K  E  + V A+APV+  AP A   G  SAA E+TEF+VVL
Sbjct: 7   DELIEAFKEMTLIELSEFVKEFEDVFDVEAAAPVAAAAPGAPAEGGASAAEEQTEFDVVL 66

Query: 63  KGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
              D   KKI VIK VR  ++ LGLKEAKE+VE APK++  G SKD+A   K KLE+AGA
Sbjct: 67  T--DAGAKKIGVIKAVRELVSGLGLKEAKEMVEGAPKAIIEGASKDDAEAAKTKLEEAGA 124

Query: 122 TVELR 126
           +VEL+
Sbjct: 125 SVELK 129


>gi|123965465|ref|YP_001010546.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9515]
 gi|166222194|sp|A2BUH8|RL7_PROM5 RecName: Full=50S ribosomal protein L7/L12
 gi|123199831|gb|ABM71439.1| 50S ribosomal protein L7/L12 [Prochlorococcus marinus str. MIT
           9515]
          Length = 131

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 74/111 (66%), Gaps = 6/111 (5%)

Query: 21  ELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVI 75
           EL K++E+ +GVSA+A   VV     A      G AA EKTEF+V+L+ FD    KI V+
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAGGDGDGGAAEEKTEFDVILESFD-AAAKIKVL 80

Query: 76  KEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           K VR  T LGL +AK LVESAPK++K G++K +A  +KK++E+AG  V L+
Sbjct: 81  KVVRNATGLGLGDAKALVESAPKTVKEGIAKADAETLKKEIEEAGGKVTLK 131


>gi|160871566|ref|ZP_02061698.1| ribosomal protein L7/L12 [Rickettsiella grylli]
 gi|159120365|gb|EDP45703.1| ribosomal protein L7/L12 [Rickettsiella grylli]
          Length = 129

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 85/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  +S+++++E  +L KR+E+++ VSA+A     AP    A + A EKTEF V LK 
Sbjct: 9   DDILNTISNMSVMEIVDLIKRMEEKFEVSAAAATVAAAPAPGAAAAVAEEKTEFNVELK- 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKS-LKTGLSKDEANEMKKKLEDAGATV 123
            +    KI+VIK VR +T LGLKEAK+LVESAPK+ +K GLSK +A  +  KL++AGAT 
Sbjct: 68  -EVGANKISVIKAVREVTGLGLKEAKDLVESAPKAVIKEGLSKADAEALVAKLKEAGATA 126

Query: 124 ELR 126
           E++
Sbjct: 127 EMK 129


>gi|88802466|ref|ZP_01117993.1| 50S ribosomal protein L7/L12 [Polaribacter irgensii 23-P]
 gi|88781324|gb|EAR12502.1| 50S ribosomal protein L7/L12 [Polaribacter irgensii 23-P]
          Length = 124

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+ ++   E+L +LT+ E  EL+  L+ E+G+  +A  +VV   AA    AA E+TEF+V
Sbjct: 1   MAELKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAAVVVGPAAGGEEAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L        K+AV+K V+ +T LGLKEAK +V+SAP ++K G+SKDEA  +K  LE+AG
Sbjct: 61  ILTA--AGASKLAVVKLVKELTGLGLKEAKGIVDSAPAAVKEGVSKDEAAALKASLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|313677112|ref|YP_004055108.1| LSU ribosomal protein l12p [Marivirga tractuosa DSM 4126]
 gi|312943810|gb|ADR23000.1| LSU ribosomal protein L12P [Marivirga tractuosa DSM 4126]
          Length = 125

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 87/127 (68%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++I++I ++L  LT+ E  EL+  L++  G+  A+A   V+A   A  G AA EKT F+
Sbjct: 1   MADIKAIGDQLVELTVKEVNELADYLKETHGIEPAAAAAPVMAAGGAGGGDAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL      K  + V+K V+ +T LGLKEAKELV+ APK++K G++KDEA  +KK+LE+A
Sbjct: 61  VVLTSAGAAK--LQVVKAVKELTGLGLKEAKELVDGAPKAVKEGVAKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|168187823|ref|ZP_02622458.1| ribosomal protein L7/L12 [Clostridium botulinum C str. Eklund]
 gi|169294317|gb|EDS76450.1| ribosomal protein L7/L12 [Clostridium botulinum C str. Eklund]
          Length = 121

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 81/122 (66%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  ++++E  EL K  E+E+    SA   V     A A  AA EK+EF+VVL  
Sbjct: 4   EEMIQAIKEMSVLELNELVKACEEEF--GVSAAAPVAVAGVAGAAGAAEEKSEFDVVLA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR +T LGLKEAKE+V+ APK+LK G++K+ A EMK KLE+ GAT+E
Sbjct: 61  -NAGSQKIKVIKAVRELTGLGLKEAKEIVDGAPKTLKEGVAKEAAEEMKAKLEEVGATIE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|118443491|ref|YP_877189.1| ribosomal protein L7/L12 [Clostridium novyi NT]
 gi|166222161|sp|A0PXT7|RL7_CLONN RecName: Full=50S ribosomal protein L7/L12
 gi|118133947|gb|ABK60991.1| ribosomal protein L7/L12 [Clostridium novyi NT]
          Length = 121

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 81/122 (66%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  ++++E  EL K  E+E+    SA   V     A A  AA EK+EF+VVL  
Sbjct: 4   EEMIQAIKEMSVLELNELVKACEEEF--GVSAAAPVAVAGVAGAVGAAEEKSEFDVVLA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR +T LGLKEAKE+V+ APK+LK G++K+ A EMK KLE+ GAT+E
Sbjct: 61  -NAGSQKIKVIKAVRELTGLGLKEAKEIVDGAPKTLKEGVAKEAAEEMKAKLEEVGATIE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|227487142|ref|ZP_03917458.1| 50S ribosomal protein L7/L12 [Corynebacterium glucuronolyticum ATCC
           51867]
 gi|227092800|gb|EEI28112.1| 50S ribosomal protein L7/L12 [Corynebacterium glucuronolyticum ATCC
           51867]
          Length = 128

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 86/124 (69%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E    +TLIE +E +K  E+ + V+A+APV+V A  AA   + A E KTEF+VVL+
Sbjct: 7   EELIEAFKEMTLIELSEFTKLFEETFDVTAAAPVAVAAAGAAGGDAPAEEEKTEFDVVLE 66

Query: 64  GFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             D   KKI VIK VR I + LGLKEAKELVE+APK++  G SK++A   K KLE+AGA+
Sbjct: 67  --DAGAKKIGVIKAVREIVSGLGLKEAKELVEAAPKAILEGASKEDAEAAKTKLEEAGAS 124

Query: 123 VELR 126
           V L+
Sbjct: 125 VTLK 128


>gi|169333762|ref|ZP_02860955.1| hypothetical protein ANASTE_00146 [Anaerofustis stercorihominis DSM
           17244]
 gi|169259611|gb|EDS73577.1| hypothetical protein ANASTE_00146 [Anaerofustis stercorihominis DSM
           17244]
          Length = 124

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 88/123 (71%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
            + I+E++ S++++E +EL   LE+E+GVSA+A   VVA  A  A  +A+E+TEF+VVL 
Sbjct: 5   FDKIIEEVKSMSVLELSELVSALEEEFGVSAAAAQVVVAGDAGAA-GSAAEQTEFDVVLT 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              D K K  V+K VR +T L LKEAKE+V++APK++K G SK+EA E+K K+E+ G  +
Sbjct: 64  SAGDAKLK--VVKAVREVTGLALKEAKEIVDNAPKAIKEGASKEEAEEIKAKIEEVGGQI 121

Query: 124 ELR 126
           EL+
Sbjct: 122 ELK 124


>gi|187918256|ref|YP_001883819.1| 50S ribosomal protein L7/L12 [Borrelia hermsii DAH]
 gi|226733646|sp|B2S093|RL7_BORHD RecName: Full=50S ribosomal protein L7/L12
 gi|119861104|gb|AAX16899.1| LSU ribosomal protein L12P (L7/L12) [Borrelia hermsii DAH]
          Length = 122

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L  F D K  I VIKEVRAIT LGL EAK LVE+ PK++K G+SK +A E+K
Sbjct: 52  EQTEFDVMLVSFGDSK--INVIKEVRAITGLGLGEAKALVEAVPKAVKEGVSKADAEEIK 109

Query: 114 KKLEDAGATVELR 126
           KKLE  GA VE++
Sbjct: 110 KKLEAVGAKVEIK 122


>gi|330505215|ref|YP_004382084.1| 50S ribosomal protein L7/L12 [Pseudomonas mendocina NK-01]
 gi|328919501|gb|AEB60332.1| 50S ribosomal protein L7/L12 [Pseudomonas mendocina NK-01]
          Length = 122

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +   +++E  EL K +E+ +GV+A+A V+     AA   +A  E+TEF VVL  
Sbjct: 6   EQIIEAIGQKSVMEIVELIKAMEETFGVTAAAAVAAGPAAAA---AAVEEQTEFNVVLAE 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+ VIK VR +T LGLKEAKE V++AP+ +  GL+K+ A + KKKLE+AGA VE
Sbjct: 63  AGD--KKVNVIKAVRELTGLGLKEAKEKVDTAPQVIAEGLTKEAAEDAKKKLEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|154491722|ref|ZP_02031348.1| hypothetical protein PARMER_01333 [Parabacteroides merdae ATCC
           43184]
 gi|218264356|ref|ZP_03478213.1| hypothetical protein PRABACTJOHN_03904 [Parabacteroides johnsonii
           DSM 18315]
 gi|154087963|gb|EDN87008.1| hypothetical protein PARMER_01333 [Parabacteroides merdae ATCC
           43184]
 gi|218222054|gb|EEC94704.1| hypothetical protein PRABACTJOHN_03904 [Parabacteroides johnsonii
           DSM 18315]
          Length = 125

 Score = 78.6 bits (192), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E +EL+  L++E+G+  +A    VA  AA   +AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVSELATILKEEYGIEPAAAAVAVAGPAAGGAAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+A++K V+ +T LGLKEAK++V+ AP ++K G++K +A  +KK+LE+A
Sbjct: 61  VVLKA--AGANKLAIVKLVKELTGLGLKEAKDMVDGAPSAIKEGIAKADAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|251772650|gb|EES53214.1| ribosomal protein L7/L12 [Leptospirillum ferrodiazotrophum]
          Length = 128

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 91/125 (72%), Gaps = 2/125 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
           +++ I+  + +L+++E   L K +E+++GVSA+APV+VVA  A  A +A +E KTEF+V+
Sbjct: 5   SVDEILGGIETLSVLELVSLIKSMEEKFGVSAAAPVAVVAAGAGAAAAAPAEEKTEFDVI 64

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK      KKI +IK VR IT LGLKEAK+LVE APK +KTG++K +A+  K+KL  AGA
Sbjct: 65  LKSAP-ADKKINIIKVVREITSLGLKEAKDLVEGAPKPIKTGVAKADADSTKEKLVAAGA 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 EVEVK 128


>gi|258543813|ref|ZP_05704047.1| ribosomal protein L7/L12 [Cardiobacterium hominis ATCC 15826]
 gi|258520942|gb|EEV89801.1| ribosomal protein L7/L12 [Cardiobacterium hominis ATCC 15826]
          Length = 124

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +T+++  +L   +E+++GV+A+A V+     A    +AA E+TEF+VVL  
Sbjct: 6   EDILNAIAEMTVMDIVDLISAMEEKFGVTAAAAVAAAPAAAGPV-AAAEEQTEFDVVLT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K+AVIK VRA+T LGLKEAKE V+ AP +LK G++K+EA ++K +LE AGA  E
Sbjct: 64  -DAGANKVAVIKVVRAVTGLGLKEAKEAVDGAPSTLKEGVAKEEAEKIKAELEGAGAKAE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|304384448|ref|ZP_07366852.1| ribosomal protein L7/L12 [Prevotella marshii DSM 16973]
 gi|304334468|gb|EFM00757.1| ribosomal protein L7/L12 [Prevotella marshii DSM 16973]
          Length = 126

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/128 (44%), Positives = 84/128 (65%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M+++++I E+L +LT+ E  EL+  L+ E+G+  +A    VA     AG+A    EKT F
Sbjct: 1   MADVKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPVAAGAAGGAEEKTSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL   +    K+ V+K V+    LGLKEAK+LV+ AP +LK G+SKDEA  +KK +E+
Sbjct: 61  DVVLT--EAGAAKLQVVKAVKEACGLGLKEAKDLVDGAPSTLKEGMSKDEAENLKKVIEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|315617349|gb|EFU97955.1| ribosomal protein L7/L12 [Escherichia coli 3431]
          Length = 95

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKTEF+V+LK       K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +K
Sbjct: 25  EKTEFDVILKAA--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALK 82

Query: 114 KKLEDAGATVELR 126
           K LE+AGA VE++
Sbjct: 83  KALEEAGAEVEVK 95


>gi|238855643|ref|ZP_04645943.1| ribosomal protein L7/L12 [Lactobacillus jensenii 269-3]
 gi|260664916|ref|ZP_05865767.1| ribosomal protein L7/L12 [Lactobacillus jensenii SJ-7A-US]
 gi|282932785|ref|ZP_06338188.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
 gi|313472537|ref|ZP_07813027.1| ribosomal protein L7/L12 [Lactobacillus jensenii 1153]
 gi|238831709|gb|EEQ24046.1| ribosomal protein L7/L12 [Lactobacillus jensenii 269-3]
 gi|239529974|gb|EEQ68975.1| ribosomal protein L7/L12 [Lactobacillus jensenii 1153]
 gi|260561399|gb|EEX27372.1| ribosomal protein L7/L12 [Lactobacillus jensenii SJ-7A-US]
 gi|281303093|gb|EFA95292.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
          Length = 120

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/124 (46%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E+L   T++E  +L K +E E+ V+A+APV+     AA A + A+ KTEF+V L
Sbjct: 4   DTEKIIEELKGATILELNDLVKAIEDEFDVTAAAPVA-----AAGAAAGAAAKTEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK +K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVREITGLGLKDSKDLVDGAPKVIKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V ++
Sbjct: 117 VTVK 120


>gi|329944329|ref|ZP_08292588.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531059|gb|EGF57915.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 129

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 81/125 (64%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A    +    K EF+V+
Sbjct: 7   EELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGGEAAAEEKDEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+   D  KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++LE AGA
Sbjct: 67  LEAAGD--KKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKEAAEKAKEQLEGAGA 124

Query: 122 TVELR 126
           TV L+
Sbjct: 125 TVTLK 129


>gi|313673489|ref|YP_004051600.1| LSU ribosomal protein l12p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940245|gb|ADR19437.1| LSU ribosomal protein L12P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 127

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 88/124 (70%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E ++E + ++T+IE A   K LE+++GVSA+APV+++A  AA A +A +   KTEF+V+L
Sbjct: 6   EQVIEFIENMTVIELANFVKELEEKFGVSAAAPVAMMAAPAAAAAAAEAPAEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +   +K+ VIK VR +T LGLKEAK LV+ APK +K G+ KDEA ++K  L + GAT
Sbjct: 66  T--NAGAQKVQVIKVVRELTGLGLKEAKALVDEAPKPVKEGVKKDEAEKIKAALAEVGAT 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEIK 127


>gi|124514451|gb|EAY55964.1| ribosomal protein L7/L12 [Leptospirillum rubarum]
          Length = 128

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 2/124 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           ++ I+  + +LT++E   L K +E+++GVSA+APV+V A  A+ A +AA+E KTEF+V+L
Sbjct: 6   VDEILTGIENLTVLELVGLIKNMEEKFGVSAAAPVAVAAAPASSAAAAATEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K      KKI +IK VR +T LGLKEAK+LVE APK LK G +K+EA  MK+KL  AGA 
Sbjct: 66  KSAP-ADKKINIIKVVRELTSLGLKEAKDLVEGAPKPLKNGATKEEAASMKEKLTAAGAE 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEVK 128


>gi|229497096|ref|ZP_04390800.1| ribosomal protein L7/L12 [Porphyromonas endodontalis ATCC 35406]
 gi|229316021|gb|EEN81950.1| ribosomal protein L7/L12 [Porphyromonas endodontalis ATCC 35406]
          Length = 125

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/127 (44%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I++I E L +LT+ E +EL+  L++E+G+  +A    VA     AG+A +E KT F+
Sbjct: 1   MADIKAIAETLVNLTVKEVSELANVLKEEYGIEPAAAAVAVAAAPGAAGAAEAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK F   K  + V+K V+    LGLKEAK++V++AP +LK G+ K  A+ MK  LE+A
Sbjct: 61  VVLKSFGSAK--LQVVKAVKEHCGLGLKEAKDIVDAAPATLKEGVDKATADAMKAALEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|161505366|ref|YP_001572478.1| 50S ribosomal protein L7/L12 [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|189043007|sp|A9MHF3|RL7_SALAR RecName: Full=50S ribosomal protein L7/L12
 gi|160866713|gb|ABX23336.1| hypothetical protein SARI_03511 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 123

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E ++++++++  EL   +E+++    SA  +V    A  A  AA EKTEF+V+LK 
Sbjct: 6   DQIIEAVAAMSVMDVVELITAMEEKF--GVSAAAAVAVAGAGAAAEAAEEKTEFDVILKA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA VE
Sbjct: 64  A--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKSLEEAGAEVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|145345754|ref|XP_001417365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144577592|gb|ABO95658.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 149

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 80/124 (64%), Gaps = 3/124 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           ++I+E++ +LTL+EA+EL  ++E+ +GV ASAP   +   A  A    +   KTEF++V+
Sbjct: 27  DAIIEEMKTLTLLEASELVAQIEEVFGVDASAPAGGMMMAAGPAAGGEAAEEKTEFDLVI 86

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D   K+IA+IK VR +TDLGLKEAK+ V + P ++  G +K E  E KK LE+ GA 
Sbjct: 87  DNVD-ADKRIAIIKVVRGLTDLGLKEAKDAVTNVPFTILAGKTKGEVEEAKKALEEGGAK 145

Query: 123 VELR 126
             ++
Sbjct: 146 CSIK 149


>gi|167626047|ref|YP_001676341.1| 50S ribosomal protein L7/L12 [Shewanella halifaxensis HAW-EB4]
 gi|189043010|sp|B0TM20|RL7_SHEHH RecName: Full=50S ribosomal protein L7/L12
 gi|167356069|gb|ABZ78682.1| ribosomal protein L7/L12 [Shewanella halifaxensis HAW-EB4]
          Length = 121

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 82/122 (67%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L++++++E  EL + +E+++GVSA+A V      A    +AA EKTEF+V+L  
Sbjct: 6   DQILEALAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGGEA----AAAEEKTEFDVILT- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK +R  T LGLKEAK + ES+P ++K  +SK+EA+ +K  LE AGA VE
Sbjct: 61  -SHGANKVAVIKALRGATGLGLKEAKTMAESSPIAVKEAISKEEADALKADLEAAGAEVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|119714946|ref|YP_921911.1| 50S ribosomal protein L7/L12 [Nocardioides sp. JS614]
 gi|166222186|sp|A1SEI9|RL7_NOCSJ RecName: Full=50S ribosomal protein L7/L12
 gi|119535607|gb|ABL80224.1| LSU ribosomal protein L12P [Nocardioides sp. JS614]
          Length = 131

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 87/127 (68%), Gaps = 7/127 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EKTEFE 59
           + +++    +TLIE +E  K+ E+ +GV+A+APV+V A  AA   +AA      E+ EF+
Sbjct: 7   DELLDAFKEMTLIELSEFVKQFEETFGVTAAAPVAVAAAPAAGGAAAAGGDAGAEQDEFD 66

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L+   D  KKI VIKEVRA+T LGLKEAKELVE+APK +   ++KD A + K+ LE A
Sbjct: 67  VILESAGD--KKINVIKEVRALTSLGLKEAKELVEAAPKPILEKVAKDAAEKAKEALEGA 124

Query: 120 GATVELR 126
           GATV L+
Sbjct: 125 GATVTLK 131


>gi|294675847|ref|YP_003576462.1| 50S ribosomal protein L7/L12 [Rhodobacter capsulatus SB 1003]
 gi|294474667|gb|ADE84055.1| 50S ribosomal protein L7/L12 [Rhodobacter capsulatus SB 1003]
          Length = 124

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 88/127 (69%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M++++++ E++ +LTL++A EL   L+ E+G+  +A  +VV A  AA    AA EKTEF+
Sbjct: 1   MADLKALAEQIVNLTLLQAQELKTILKDEYGIEPAAGGAVVMAGPAAGPAEAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE+  K  +   +K EA ++KKKLE A
Sbjct: 61  VVL--VDAGANKINVIKEVRAITGLGLKEAKDLVEAGGKVKEA-AAKAEAEDIKKKLEAA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|213965001|ref|ZP_03393200.1| ribosomal protein L7/L12 [Corynebacterium amycolatum SK46]
 gi|213952537|gb|EEB63920.1| ribosomal protein L7/L12 [Corynebacterium amycolatum SK46]
          Length = 127

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E    +TL+E  E  K  E+E+ V+A+APV+V A  AA   +AA EK EF+V+L+ 
Sbjct: 7   EELLEAFKEMTLVELTEFKKAFEEEFDVTAAAPVAVAAAGAAGGDAAAEEKDEFDVILE- 65

Query: 65  FDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            D   KKI VIK VR I + LGLKEAKE+VESAPK++  G SKD+A   K KLE+AGA V
Sbjct: 66  -DAGAKKIGVIKAVREIVSGLGLKEAKEMVESAPKAILEGASKDDAEAAKAKLEEAGAKV 124

Query: 124 ELR 126
            L+
Sbjct: 125 SLK 127


>gi|187251833|ref|YP_001876315.1| 50S ribosomal protein L7/L12 [Elusimicrobium minutum Pei191]
 gi|226733686|sp|B2KEN2|RL7_ELUMP RecName: Full=50S ribosomal protein L7/L12
 gi|186971993|gb|ACC98978.1| Ribosomal protein L7/L12 [Elusimicrobium minutum Pei191]
          Length = 126

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++ +T++E +EL K +E ++GV A+AP   VA  A  A +AA EKTEF V L  
Sbjct: 7   EEILEAIAGMTVLELSELVKAVEDKFGVKAAAPAVAVAAAAPAA-AAAEEKTEFNVELTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKIAVIK VR IT LGLKEAK+LV+ APK +K  ++K EA EMKKK+ +AG  V 
Sbjct: 66  -AAADKKIAVIKVVREITGLGLKEAKDLVDGAPKVIKENVAKAEAEEMKKKVTEAGGVVT 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|317054803|ref|YP_004103270.1| 50S ribosomal protein L7/L12 [Ruminococcus albus 7]
 gi|315447072|gb|ADU20636.1| ribosomal protein L7/L12 [Ruminococcus albus 7]
          Length = 123

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 83/123 (67%), Gaps = 5/123 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I + VE++ +++++E  EL   +++E+GV+A    +  A   A   +A +EKTEF+VVL 
Sbjct: 6   IMNFVEEIKTMSVLELKELVDAIQEEFGVTAVVAAAGPAAGGA---AAEAEKTEFDVVLA 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F D   K+AVIK V+ IT LGLKEAK LVE APK++K    K EA ++K KLE AGATV
Sbjct: 63  SFGD--NKMAVIKAVKEITGLGLKEAKALVEEAPKAVKEAAPKAEAEDIKAKLEAAGATV 120

Query: 124 ELR 126
           EL+
Sbjct: 121 ELK 123


>gi|310829147|ref|YP_003961504.1| hypothetical protein ELI_3582 [Eubacterium limosum KIST612]
 gi|308740881|gb|ADO38541.1| hypothetical protein ELI_3582 [Eubacterium limosum KIST612]
          Length = 126

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVV 61
            +  ++E +  LT++E +EL K LE+E+GVSA+APV+V A  AA   + A+E KTEF+VV
Sbjct: 4   KVTQLIEDVKGLTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGGAAPAAEEKTEFDVV 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    D  +KI VIK VR +T LGLKEAK +V+ APK LK G++K+EA+E+K K+E+ G 
Sbjct: 64  LAAAGD--QKIKVIKVVRELTGLGLKEAKAVVDEAPKPLKEGVTKEEADEIKAKIEEVGG 121

Query: 122 TVELR 126
           +VE++
Sbjct: 122 SVEVK 126


>gi|119502914|ref|ZP_01624999.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2080]
 gi|119461260|gb|EAW42350.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2080]
          Length = 127

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEFEVVL 62
           E I+E ++++++++  EL + +E+++GV+A+A V+     A  A  AA+  E+TEF+V+L
Sbjct: 6   EDILEAIAAMSVMDVVELIEAMEEKFGVTAAAAVAAAPAAAGGADGAAAEAEQTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               +  KK+ VIK VRA+T LGLKEAK +V+ AP  +K G SKDEA ++KK+LE+AG  
Sbjct: 66  TSAGE--KKVNVIKVVRAVTGLGLKEAKAVVDGAPGPVKEGASKDEAEDIKKQLEEAGGA 123

Query: 123 VELR 126
            EL+
Sbjct: 124 AELK 127


>gi|133080|sp|P14134|RL7_HALPR RecName: Full=50S ribosomal protein L7/L12
 gi|309389941|gb|ADO77821.1| LSU ribosomal protein L12P [Halanaerobium praevalens DSM 2228]
          Length = 122

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  +  ++++E +EL + LE+++GVSA+APV+V    A    +AA EK+EF+V L
Sbjct: 2   NKEEIMSAIEEMSVLELSELVEDLEEKFGVSAAAPVAVAGGAAGAG-AAAEEKSEFDVFL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D   KKI VIK VR +T LGLKEAK +V+ AP ++K GLSK++A EMK+KLE+AGAT
Sbjct: 61  A--DIGGKKIKVIKAVRELTGLGLKEAKGVVDDAPGNVKEGLSKEDAEEMKEKLEEAGAT 118

Query: 123 VELR 126
           VEL+
Sbjct: 119 VELK 122


>gi|310817019|ref|YP_003964983.1| ribosomal protein L7/L12 [Ketogulonicigenium vulgare Y25]
 gi|308755754|gb|ADO43683.1| ribosomal protein L7/L12 [Ketogulonicigenium vulgare Y25]
          Length = 123

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++ +LTL++A EL + L+ E+G+  +A  +VV    A AG AA EKTEF+V
Sbjct: 1   MADLKKLAEEIVALTLLQAQELKQILKDEYGIEPAAGGAVVMAGPAAAGEAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  D    KI VIKEVRAIT LGLKEAK+LVE+  K +K G +K EA E+KKKLE+AG
Sbjct: 61  VLK--DAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEGAAKAEAEEIKKKLEEAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AKVEL 122


>gi|317153965|ref|YP_004122013.1| 50S ribosomal protein L7/L12 [Desulfovibrio aespoeensis Aspo-2]
 gi|316944216|gb|ADU63267.1| ribosomal protein L7/L12 [Desulfovibrio aespoeensis Aspo-2]
          Length = 127

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/129 (45%), Positives = 90/129 (69%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           M++I  E +VE + ++T++E ++  K LE  +GV A+AP + V    A A + A+E +TE
Sbjct: 1   MADITKEQVVEFIGNMTVLELSKFIKELEDVFGVEAAAPAAAVMLAPAAAAADAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+L   +    KIAVIK VRA+T LGLKEAK +V+ APK++K  +SKDEA++  K+L+
Sbjct: 61  FTVMLT--NAGANKIAVIKAVRALTGLGLKEAKAVVDEAPKAIKEAVSKDEADDAAKQLK 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAEVEIK 127


>gi|224537808|ref|ZP_03678347.1| hypothetical protein BACCELL_02695 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520628|gb|EEF89733.1| hypothetical protein BACCELL_02695 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 125

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G+AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK     K  + V+K V+    LGLKEAK+LV+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKSAGSAK--LQVVKAVKEACGLGLKEAKDLVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|229917368|ref|YP_002886014.1| ribosomal protein L7/L12 [Exiguobacterium sp. AT1b]
 gi|229468797|gb|ACQ70569.1| ribosomal protein L7/L12 [Exiguobacterium sp. AT1b]
          Length = 122

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L S+T++E  EL K +E+E+GVSA+APV+V    A    +AA EKTEF+V+L
Sbjct: 4   NKEQFIEDLKSMTVLELNELVKTIEEEFGVSAAAPVAVAGAGAG---AAAEEKTEFDVIL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR IT LGLKEAK LV+  P  +K G+SK++A+ +K KLE+AGA+
Sbjct: 61  T--NAGAGKINVIKAVREITGLGLKEAKALVDGTPAPVKEGVSKEDADAIKAKLEEAGAS 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|167957238|ref|ZP_02544312.1| 50S ribosomal protein L7/L12 [candidate division TM7 single-cell
           isolate TM7c]
          Length = 125

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/126 (47%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE-FE 59
           M++I+ + E+L+ LT++E  EL   L+ E+G+  +A    VA  AA   + A E+ + F 
Sbjct: 1   MADIKKLAEELTKLTVLEVNELKNVLKDEYGIEPAAAAVAVAGPAAGGAAEAEEEKKEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V LK  D   +K+AVIK V+ IT LGL EAK LV+ AP ++K  +SKDEA E KKKLE+A
Sbjct: 61  VQLK--DAGGQKVAVIKAVKEITGLGLGEAKALVDDAPSAIKEKVSKDEAEEAKKKLEEA 118

Query: 120 GATVEL 125
           GA+VEL
Sbjct: 119 GASVEL 124


>gi|303247798|ref|ZP_07334067.1| ribosomal protein L7/L12 [Desulfovibrio fructosovorans JJ]
 gi|302490882|gb|EFL50781.1| ribosomal protein L7/L12 [Desulfovibrio fructosovorans JJ]
          Length = 130

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 90/132 (68%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           MS+I  E +V+ ++++T++E ++  K LE+++GVSA+AP   +   A  AG  A+     
Sbjct: 1   MSDITKEQVVDFIANMTVLELSQFIKELEEKFGVSAAAPAMGMMMAAPAAGGDAAAAEEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+VVL   +    KIAVIK VRA+T LGLKEAK  V+  P ++K G++K +A E KK
Sbjct: 61  KTEFDVVLT--NAGGNKIAVIKVVRALTGLGLKEAKAKVDELPSTIKEGVAKADAEEAKK 118

Query: 115 KLEDAGATVELR 126
           +L++AGAT E++
Sbjct: 119 QLDEAGATCEIK 130


>gi|283851495|ref|ZP_06368775.1| ribosomal protein L7/L12 [Desulfovibrio sp. FW1012B]
 gi|283573029|gb|EFC21009.1| ribosomal protein L7/L12 [Desulfovibrio sp. FW1012B]
          Length = 128

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/130 (44%), Positives = 89/130 (68%), Gaps = 6/130 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KT 56
           MS I  E +V+ ++++T++E ++  K LE+++GVSA+AP   +   A  A +A +E  KT
Sbjct: 1   MSEITKEQVVDFIANMTVLELSQFIKELEEKFGVSAAAPAMGMMMAAPAADAAPAEEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L G      KIAVIK VRA+T LGLKEAK  V+  P ++K  +SK EA + KK+L
Sbjct: 61  EFDVILTG--AGGNKIAVIKVVRALTGLGLKEAKAKVDELPSTIKEAVSKAEAEDAKKQL 118

Query: 117 EDAGATVELR 126
           +++GAT E++
Sbjct: 119 DESGATCEIK 128


>gi|197117315|ref|YP_002137742.1| 50S ribosomal protein L7/L12 [Geobacter bemidjiensis Bem]
 gi|259491647|sp|B5EFP2|RL7_GEOBB RecName: Full=50S ribosomal protein L7/L12
 gi|197086675|gb|ACH37946.1| ribosomal protein L7/L12 [Geobacter bemidjiensis Bem]
          Length = 126

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 90/123 (73%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-AASEKTEFEVVLK 63
           E ++  + +++++E A L K LE+++GVSA+APV+V A   A   + +A EKTEF+V+LK
Sbjct: 6   EEVISFIENMSVLELANLVKELEEKFGVSAAAPVAVAAAGPAAGPAESAEEKTEFDVILK 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KIAVIK VR +T LGLKEAK+LV+ AP+ +KTG+SK+EA + +K+L +AGA V
Sbjct: 66  A--AGANKIAVIKVVRGLTSLGLKEAKDLVDGAPQPVKTGISKEEAADAQKQLVEAGAEV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|184200242|ref|YP_001854449.1| 50S ribosomal protein L7/L12 [Kocuria rhizophila DC2201]
 gi|226733700|sp|B2GIJ4|RL7_KOCRD RecName: Full=50S ribosomal protein L7/L12
 gi|183580472|dbj|BAG28943.1| 50S ribosomal protein L7/L12 [Kocuria rhizophila DC2201]
          Length = 128

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEV 60
             E ++E    L+LIE ++  K  E+ + V+A+APV+V     A   + A+E  KTEF+V
Sbjct: 5   TTEELIEAFKELSLIELSDFVKAFEETFDVTAAAPVAVAGAAPAAGDAGAAEEEKTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+   D  KKI VIKEVR +T LGLKEAK+LV+SAPK++  G +K+ A++ K+ LE AG
Sbjct: 65  VLESAGD--KKIQVIKEVRGLTSLGLKEAKDLVDSAPKAVLEGATKEAADKAKEALEGAG 122

Query: 121 ATVELR 126
           ATV ++
Sbjct: 123 ATVTVK 128


>gi|90020570|ref|YP_526397.1| 50S ribosomal protein L7/L12 [Saccharophagus degradans 2-40]
 gi|109893797|sp|Q21M94|RL7_SACD2 RecName: Full=50S ribosomal protein L7/L12
 gi|89950170|gb|ABD80185.1| LSU ribosomal protein L12P [Saccharophagus degradans 2-40]
          Length = 126

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V+L    +  KK+ VIK VR IT LGLKEAKELV+ AP  +K G+SKD+A E K
Sbjct: 56  EQTEFDVILASAGE--KKVNVIKAVRGITGLGLKEAKELVDGAPSPIKEGVSKDDAEEAK 113

Query: 114 KKLEDAGATVELR 126
           K LE+AGA+VEL+
Sbjct: 114 KLLEEAGASVELK 126


>gi|298708207|emb|CBJ30546.1| 50S ribosomal protein L7/L12, putative [Ectocarpus siliculosus]
          Length = 244

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 53/72 (73%), Gaps = 1/72 (1%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F+V + GF D K KI VIKEVR IT LGL+EAKE+VES P+ +K  L +DEA  MK
Sbjct: 173 EKTIFKVKVTGFGD-KAKIKVIKEVRVITGLGLREAKEMVESLPQVVKEDLKEDEAEAMK 231

Query: 114 KKLEDAGATVEL 125
            KLE  GATVEL
Sbjct: 232 AKLEAVGATVEL 243


>gi|260063558|ref|YP_003196638.1| 50S ribosomal protein L7/L12 [Robiginitalea biformata HTCC2501]
 gi|88783002|gb|EAR14176.1| 50S ribosomal protein L7/L12 [Robiginitalea biformata HTCC2501]
          Length = 127

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 91/129 (70%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV---SASAPVSVVAPVAAEAGSAASEKTE 57
           M++++   E+L +LT+ E  EL+  L++E+G+   +A+  V+  A    +AG AA E+TE
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGAAAGGDAGEAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK     K  +AV+K V+ +T LGLK+AK++V+SAPK++K  +SKDEA  +KK LE
Sbjct: 61  FDVILKAAGGSK--LAVVKLVKELTGLGLKDAKDIVDSAPKAVKEAVSKDEAEGIKKSLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAEVELK 127


>gi|305664387|ref|YP_003860674.1| putative 50S ribosomal protein L7/L12 [Maribacter sp. HTCC2170]
 gi|88708404|gb|EAR00640.1| putative 50S ribosomal protein L7/L12 [Maribacter sp. HTCC2170]
          Length = 126

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 89/128 (69%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A+A        AAE G AA E++EF
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELADILKDEYGIEPAAAAVAVAAGGGAAEGGEAAEEQSEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L        K+AV+K V+ +T LGLK+AK++V+SAPK++K G+SKDEA  +KK LE+
Sbjct: 61  DVILTAA--GGSKLAVVKLVKELTGLGLKDAKDIVDSAPKAVKEGVSKDEAEGIKKSLEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|326792618|ref|YP_004310439.1| ribosomal protein L7/L12 [Clostridium lentocellum DSM 5427]
 gi|326543382|gb|ADZ85241.1| ribosomal protein L7/L12 [Clostridium lentocellum DSM 5427]
          Length = 123

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +I+ I++ +  LT++E  EL    E+E+GVSA+A V V A  A    +AA EKT+F+V L
Sbjct: 5   SIQEIIDAVKELTILELNELVTACEEEFGVSAAAGVMVAAGPAG---AAAEEKTDFDVEL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +   +KI VIK VR IT LGLKEAKE V+ APK LK G++KDEA  +K KLE+ GA 
Sbjct: 62  T--EAGAEKIKVIKVVREITGLGLKEAKEAVDGAPKVLKEGVAKDEAESIKAKLEEVGAK 119

Query: 123 VELR 126
           V L+
Sbjct: 120 VTLK 123


>gi|227879341|ref|ZP_03997205.1| ribosomal protein L7/L12 [Lactobacillus crispatus JV-V01]
 gi|256844516|ref|ZP_05550002.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 125-2-CHN]
 gi|256849095|ref|ZP_05554528.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-1A-US]
 gi|262047577|ref|ZP_06020532.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-3A-US]
 gi|293381051|ref|ZP_06627072.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 214-1]
 gi|295692233|ref|YP_003600843.1| 50S ribosomal protein l7/l12 [Lactobacillus crispatus ST1]
 gi|312977930|ref|ZP_07789676.1| ribosomal protein L7/L12 [Lactobacillus crispatus CTV-05]
 gi|227861062|gb|EEJ68717.1| ribosomal protein L7/L12 [Lactobacillus crispatus JV-V01]
 gi|256613594|gb|EEU18797.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 125-2-CHN]
 gi|256713871|gb|EEU28859.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-1A-US]
 gi|260572153|gb|EEX28718.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-3A-US]
 gi|290922351|gb|EFD99332.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 214-1]
 gi|295030339|emb|CBL49818.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus ST1]
 gi|310895237|gb|EFQ44305.1| ribosomal protein L7/L12 [Lactobacillus crispatus CTV-05]
          Length = 120

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 57/124 (45%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + + I+E+L   T++E  +L K +E E+ V+A+APV+     AA A  A + K+EF+V L
Sbjct: 4   DTDKIIEELKGATILELNDLVKAIEDEFDVTAAAPVA-----AAGAADAGAAKSEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V L+
Sbjct: 117 VTLK 120


>gi|269926925|ref|YP_003323548.1| ribosomal protein L7/L12 [Thermobaculum terrenum ATCC BAA-798]
 gi|269790585|gb|ACZ42726.1| ribosomal protein L7/L12 [Thermobaculum terrenum ATCC BAA-798]
          Length = 133

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 85/126 (67%), Gaps = 6/126 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK----TEFEV 60
           E I++ + ++T++E ++L K LE+ +GV+A APV+     AA   +A +E+    TEF+V
Sbjct: 10  EEIIQAIENMTVLELSQLVKALEERFGVTAVAPVAAAGVAAAPGAAAPAEEQEEQTEFDV 69

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KIAVIK VR +T LGLKEAK+LVESAP  +K G+SK+EA     KL++AG
Sbjct: 70  VLT--DVGANKIAVIKAVRELTSLGLKEAKDLVESAPAPVKQGVSKEEAQAAVAKLQEAG 127

Query: 121 ATVELR 126
           A  E++
Sbjct: 128 AKAEMK 133


>gi|189502705|ref|YP_001958422.1| 50S ribosomal protein L7/L12 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|226733635|sp|B3ETZ1|RL7_AMOA5 RecName: Full=50S ribosomal protein L7/L12
 gi|189498146|gb|ACE06693.1| hypothetical protein Aasi_1397 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 127

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (62%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA---GSAASEKTE 57
           MS+++   E+L +LT+ E  EL+  L++E G+  +A   VV            AA EKT 
Sbjct: 1   MSDLKKFAEQLVNLTVKEVNELAAILKEEHGIEPAAAAPVVVAGGGAQGGDSKAAEEKTH 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       K++V+K V+ +T LGLKEAK+LV++APK +K G  K EA  +K KLE
Sbjct: 61  FDVILKSAG--ASKLSVVKLVKDLTGLGLKEAKDLVDAAPKPIKEGAPKAEAESLKSKLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAEVELK 127


>gi|326319226|ref|YP_004236898.1| 50S ribosomal protein L7/L12 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323376062|gb|ADX48331.1| ribosomal protein L7/L12 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 125

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++ +  L S++++E  +L K +E+++GVSA+A  +  A     A +AA EKTEF VVL  
Sbjct: 6   DAFLTALDSMSVMELNDLVKAIEEKFGVSAAAMAAPAAAGGGGAAAAAEEKTEFNVVLA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA  E
Sbjct: 65  -EAGANKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGAKAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|296126982|ref|YP_003634234.1| ribosomal protein L7/L12 [Brachyspira murdochii DSM 12563]
 gi|296018798|gb|ADG72035.1| ribosomal protein L7/L12 [Brachyspira murdochii DSM 12563]
          Length = 128

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E I++ +  + +IE  EL + +++++ V+A+ PV+ VA   A   +A +E  K EF+++L
Sbjct: 6   EEILQAIEEMKVIELHELVEAIKEKFNVTAAMPVAAVAAAPAGGAAAPAEEEKNEFDIIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GF+   KKIA+IKEVRA++ LGLKEAK+ VE   +++K+G+SKDEA  +KK+LE AG  
Sbjct: 66  TGFE-ADKKIALIKEVRAVSGLGLKEAKDAVEKGGETIKSGVSKDEAAAIKKQLEAAGGK 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEVK 128


>gi|91205969|ref|YP_538324.1| 50S ribosomal protein L7/L12 [Rickettsia bellii RML369-C]
 gi|157826667|ref|YP_001495731.1| 50S ribosomal protein L7/L12 [Rickettsia bellii OSU 85-389]
 gi|109893796|sp|Q1RHC9|RL7_RICBR RecName: Full=50S ribosomal protein L7/L12
 gi|166222203|sp|A8GV23|RL7_RICB8 RecName: Full=50S ribosomal protein L7/L12
 gi|91069513|gb|ABE05235.1| 50S ribosomal protein L7/L12 [Rickettsia bellii RML369-C]
 gi|157801971|gb|ABV78694.1| 50S ribosomal protein L7/L12 [Rickettsia bellii OSU 85-389]
          Length = 123

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 69/126 (54%), Positives = 91/126 (72%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+APV+V A  A  A  AA+EKT+FEV
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPVAVAAAAAPAA-EAAAEKTDFEV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL    D K ++     V+ IT LGL EAK+LV+ APK +K+ + K EA E+K KLE AG
Sbjct: 60  VLASSGDKKVEVIK--VVKEITGLGLIEAKKLVDEAPKPIKSNVKKAEAEEIKSKLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|62130239|gb|AAX67942.1| 50S ribosomal subunit protein L7/L12 [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
          Length = 107

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+LK       K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK
Sbjct: 38  KTEFDVILKAA--GANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKK 95

Query: 115 KLEDAGATVELR 126
            LE+AGA VE++
Sbjct: 96  SLEEAGAEVEVK 107


>gi|297179998|gb|ADI16223.1| hypothetical protein [uncultured bacterium HF0010_16H03]
          Length = 125

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 52/122 (42%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +++++  +L   +E+++GV+A+A V+     A+    AA EK  F+VVL  
Sbjct: 6   EDILKTIEEMSVMDLVDLISDIEEKFGVTAAAAVAAAPAAASGDAPAAEEKDAFDVVLNA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  +K+ VIK VRAIT LGLKEAK++V+ AP ++K G SKD+A  M  +L +AGAT E
Sbjct: 66  AGD--QKVQVIKAVRAITGLGLKEAKDMVDGAPSTVKEGASKDDAEAMVAQLTEAGATAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|297802186|ref|XP_002868977.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297314813|gb|EFH45236.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 167

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEFE 59
           +E I + L +L  IE  + S     + G++       VA    EA  +     +EKT F+
Sbjct: 42  LERIADDLLNLNRIELYDYSILFSHKLGLNRYGSAVAVAGSDGEASGSTETKTAEKTAFD 101

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V L+ F+   K I VIKE+RA TDLGLKEAKELVE AP  +K GL+K+EA ++ +KL+  
Sbjct: 102 VKLEKFETASK-IKVIKEIRAFTDLGLKEAKELVEKAPVIVKKGLTKEEAEKIMEKLKAV 160

Query: 120 GATVEL 125
           GA V L
Sbjct: 161 GAIVAL 166


>gi|254517461|ref|ZP_05129517.1| ribosomal protein L7/L12 [Clostridium sp. 7_2_43FAA]
 gi|226911210|gb|EEH96411.1| ribosomal protein L7/L12 [Clostridium sp. 7_2_43FAA]
          Length = 122

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E  EL K  E+E+GVSA+APV+V   VA  A +AA EKTEF+VVL  
Sbjct: 4   EDIIQAIKEMTVLELNELVKACEEEFGVSAAAPVAVAGAVAGGA-AAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR +T LGLKEAKE+V+ APK+LK G+SK+EA +MK KL + GA VE
Sbjct: 63  AGS--QKIKVIKVVRELTGLGLKEAKEIVDGAPKTLKEGVSKEEAEDMKAKLAEVGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|307128567|ref|YP_003880597.1| 50S ribosomal protein L7/L12 [Candidatus Sulcia muelleri CARI]
 gi|306483029|gb|ADM89899.1| 50S ribosomal protein L7/L12 [Candidatus Sulcia muelleri CARI]
          Length = 124

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 78/126 (61%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ +  KL +LT+ E  ELS  L+K++G+ ++   S       +      EKT F V
Sbjct: 1   MTDLKKLANKLVNLTVKEVNELSNLLKKDYGLVSNKISSEEQITNNKNLETKVEKTTFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK    P K +AV+K ++ IT  GLKE+KELV+S PK++K  L+K+EA  +KKK E  G
Sbjct: 61  ILKS-SGPSK-LAVVKLIKEITGKGLKESKELVDSVPKTIKESLNKEEAELLKKKFEYIG 118

Query: 121 ATVELR 126
           A +EL 
Sbjct: 119 AEIELN 124


>gi|149925885|ref|ZP_01914148.1| Ribosomal protein L7/L12 [Limnobacter sp. MED105]
 gi|149825173|gb|EDM84384.1| Ribosomal protein L7/L12 [Limnobacter sp. MED105]
          Length = 125

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 95/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+    I++ ++ +T++E +EL K +E+++GVSA+A    VA  AA  G+AA+E KTEF+
Sbjct: 1   MATKAEILDAIAGMTVLELSELIKEMEEKFGVSAAAAAVAVAAPAAGGGAAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L    + K  + VIK VRA+T LGLKEAK+LV+ APK++K G+SK EA+++KK+LE+A
Sbjct: 61  VILTAAGESK--VNVIKVVRALTGLGLKEAKDLVDGAPKAVKEGVSKAEADDVKKQLEEA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|319791334|ref|YP_004152974.1| ribosomal protein l7/l12 [Variovorax paradoxus EPS]
 gi|315593797|gb|ADU34863.1| ribosomal protein L7/L12 [Variovorax paradoxus EPS]
          Length = 125

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++ +  L S+T++E  +L K +E+++GVSA+A  +        A +A  E+TEF VVL  
Sbjct: 6   DAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAGAGGGAAAAAVEEQTEFNVVLA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K++VIK VR IT LGLKEAK+LVE+APK++K  LSK +A   KKKLE+AGA VE
Sbjct: 65  -DVGANKVSVIKAVREITGLGLKEAKDLVEAAPKAVKEALSKADAEAAKKKLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|116871634|ref|YP_848415.1| 50S ribosomal protein L7/L12 [Listeria welshimeri serovar 6b str.
           SLCC5334]
 gi|123458021|sp|A0AF50|RL7_LISW6 RecName: Full=50S ribosomal protein L7/L12
 gi|116740512|emb|CAK19632.1| ribosomal protein L7/L12 [Listeria welshimeri serovar 6b str.
           SLCC5334]
          Length = 120

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   +++E  +L K +E+E+GV+A+APV+      A AG  A+E+TEF V L
Sbjct: 4   NIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVA-----VAAAGGGAAEQTEFTVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VR IT LGLKEAKELV++APK+LK G++K+EA E+K KLE+ GA 
Sbjct: 59  SSAGDSK--IKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKEEAEEIKAKLEEVGAN 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|226501436|ref|NP_001150377.1| 50S ribosomal protein L12-2 [Zea mays]
 gi|195638766|gb|ACG38851.1| 50S ribosomal protein L12-2 [Zea mays]
          Length = 167

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 77/135 (57%), Gaps = 14/135 (10%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA-------------EAGS 50
           + ++V+++  LTL+EA+ L+  L    GV    P++++    A             E   
Sbjct: 33  VSALVDEICGLTLLEASSLADALRGRLGVDQLPPLAILTGGGAPLVGGGVGPGAAGEEAK 92

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           A  EK  F+V L+GFD    K+ +IKE+RA T+LGLKEAK+LVE AP  LK G+ K+EA 
Sbjct: 93  AKEEKMAFDVKLEGFDA-AAKLKIIKELRAFTNLGLKEAKDLVEKAPAVLKAGVPKEEAE 151

Query: 111 EMKKKLEDAGATVEL 125
            + +K+   GA + L
Sbjct: 152 SIAEKMRALGAKIVL 166


>gi|228475264|ref|ZP_04059989.1| ribosomal protein L7/L12 [Staphylococcus hominis SK119]
 gi|314937155|ref|ZP_07844502.1| ribosomal protein L7/L12 [Staphylococcus hominis subsp. hominis
           C80]
 gi|228270729|gb|EEK12138.1| ribosomal protein L7/L12 [Staphylococcus hominis SK119]
 gi|313655774|gb|EFS19519.1| ribosomal protein L7/L12 [Staphylococcus hominis subsp. hominis
           C80]
          Length = 122

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 59/126 (46%), Positives = 91/126 (72%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+  A  AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVA--AAGAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L      K  I V+K V+  T LGLK+AKELV++APK +K  ++K++A ++K++LE+ G
Sbjct: 59  ELTSAGSSK--IKVVKAVKEATGLGLKDAKELVDNAPKVIKEAVAKEDAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|261344390|ref|ZP_05972034.1| ribosomal protein L7/L12 [Providencia rustigianii DSM 4541]
 gi|282567663|gb|EFB73198.1| ribosomal protein L7/L12 [Providencia rustigianii DSM 4541]
          Length = 121

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++  EL   +E+++GVSA+A V+V A  A      A EKTEF+VVL  
Sbjct: 6   DQILDAVAEMSVMDVVELITMMEEKFGVSAAAAVAVAAGPA----EVAEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK++VESAP ++K   SKDEA  +KK LE+AGAT E
Sbjct: 62  V--GANKVAVIKAVRGATGLGLKEAKDMVESAPATIKEAASKDEAEALKKVLEEAGATAE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|288929386|ref|ZP_06423231.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329488|gb|EFC68074.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 126

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 82/128 (64%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++I++I E+L +LT+ E  EL+  L++E+G+  +A    VA       +A    EK+ F
Sbjct: 1   MADIKAIAEELVNLTVKEVNELANVLKEEYGIEPAAAAVAVAAAPGAGAAAGGAEEKSSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL   +    K+ V+K V+    LGLKEAK+LV+  P +LK G+SKDEA  +KK +E+
Sbjct: 61  DVVL--VEAGAAKLQVVKAVKEACGLGLKEAKDLVDGVPSTLKEGMSKDEAENLKKAIEE 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAKVELK 126


>gi|78213976|ref|YP_382755.1| 50S ribosomal protein L7/L12 [Synechococcus sp. CC9605]
 gi|109893812|sp|Q3AGT2|RL7_SYNSC RecName: Full=50S ribosomal protein L7/L12
 gi|78198435|gb|ABB36200.1| ribosomal protein L7/L12 [Synechococcus sp. CC9605]
          Length = 129

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 54/109 (49%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 21  ELSKRLEKEWGVSASAPVSVV---APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKE 77
           EL K++E+ +GVSA+A   VV      A   G AA EKTEF+V+L+GF+    KI V+K 
Sbjct: 22  ELVKQIEEAFGVSAAASAGVVMAAPGAAGGGGEAAEEKTEFDVILEGFE-ASAKIKVLKA 80

Query: 78  VRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           VR  T LGL +AK LVE+APK+ K G+SK++A   KK +E+AG  V L+
Sbjct: 81  VREATGLGLGDAKALVEAAPKAFKEGVSKEDAEAAKKAIEEAGGKVTLK 129


>gi|167627268|ref|YP_001677768.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667824|ref|ZP_04755402.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876367|ref|ZP_05249077.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189042995|sp|B0TX09|RL7_FRAP2 RecName: Full=50S ribosomal protein L7/L12
 gi|167597269|gb|ABZ87267.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254842388|gb|EET20802.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 124

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  +L K +E+++GVSA+A V+V A  AA A  AA EKTEF+VVL  
Sbjct: 6   EDILNAVAEMSVMDVCDLVKMMEEKFGVSAAAAVAVAAAPAAAA-EAAEEKTEFDVVL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KIA IK VR  T LGLKEAK+ VE  P ++K   SKDEA  +KK+LE+AGA VE
Sbjct: 63  VDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKDEAEALKKQLEEAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|85712786|ref|ZP_01043830.1| Ribosomal protein L7/L12 [Idiomarina baltica OS145]
 gi|85693426|gb|EAQ31380.1| Ribosomal protein L7/L12 [Idiomarina baltica OS145]
          Length = 125

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+V+LKG      K+A IK VR  T LGLKEAK +VESAP ++K G+SKD+A E+KK
Sbjct: 56  QTEFDVILKGAGS--NKVAAIKAVRGATGLGLKEAKAMVESAPVAVKEGISKDDAEELKK 113

Query: 115 KLEDAGATVELR 126
           +LE+AGA VE++
Sbjct: 114 QLEEAGAEVEVK 125


>gi|222112412|ref|YP_002554676.1| 50S ribosomal protein l7/l12 [Acidovorax ebreus TPSY]
 gi|254806371|sp|B9MH48|RL7_DIAST RecName: Full=50S ribosomal protein L7/L12
 gi|221731856|gb|ACM34676.1| ribosomal protein L7/L12 [Acidovorax ebreus TPSY]
          Length = 126

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/123 (48%), Positives = 85/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           ++ +  L S+T++E  +L K +E+++GVSA+A  +  A  AA  G+AA+E KTEF VVL 
Sbjct: 6   DAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAGGAAGGGAAAAEEKTEFNVVLA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    K+AVIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA  
Sbjct: 66  --DAGANKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGAKA 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|146318637|ref|YP_001198349.1| 50S ribosomal protein L7/L12 [Streptococcus suis 05ZYH33]
 gi|146320844|ref|YP_001200555.1| 50S ribosomal protein L7/L12 [Streptococcus suis 98HAH33]
 gi|223933020|ref|ZP_03625014.1| ribosomal protein L7/L12 [Streptococcus suis 89/1591]
 gi|253751758|ref|YP_003024899.1| 50S ribosomal protein L7/L12 [Streptococcus suis SC84]
 gi|253753582|ref|YP_003026723.1| 50S ribosomal protein L7/L12 [Streptococcus suis P1/7]
 gi|253755537|ref|YP_003028677.1| 50S ribosomal protein L7/L12 [Streptococcus suis BM407]
 gi|330832816|ref|YP_004401641.1| 50S ribosomal protein L7/L12 [Streptococcus suis ST3]
 gi|166222217|sp|A4W1B6|RL7_STRS2 RecName: Full=50S ribosomal protein L7/L12
 gi|166222219|sp|A4VV10|RL7_STRSY RecName: Full=50S ribosomal protein L7/L12
 gi|145689443|gb|ABP89949.1| Ribosomal protein L7/L12 [Streptococcus suis 05ZYH33]
 gi|145691650|gb|ABP92155.1| Ribosomal protein L7/L12 [Streptococcus suis 98HAH33]
 gi|223898337|gb|EEF64704.1| ribosomal protein L7/L12 [Streptococcus suis 89/1591]
 gi|251816047|emb|CAZ51667.1| 50S ribosomal protein L7/L12 [Streptococcus suis SC84]
 gi|251818001|emb|CAZ55783.1| 50S ribosomal protein L7/L12 [Streptococcus suis BM407]
 gi|251819828|emb|CAR45797.1| 50S ribosomal protein L7/L12 [Streptococcus suis P1/7]
 gi|319758107|gb|ADV70049.1| 50S ribosomal protein L7/L12 [Streptococcus suis JS14]
 gi|329307039|gb|AEB81455.1| 50S ribosomal protein L7/L12 [Streptococcus suis ST3]
          Length = 121

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/124 (47%), Positives = 83/124 (66%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   T++E  +L K +E+E+GV+A+APV+V A       +A   K  F+V L
Sbjct: 4   NIENIIAEIKEATILELNDLVKAIEEEFGVTAAAPVAVAAAGG----AAEEAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D  KK+ VIK VR IT LGLKEAKELV+ AP  +K G++  EA E+K KLE+AGA+
Sbjct: 60  TSAGD--KKVGVIKVVREITGLGLKEAKELVDGAPAMVKEGVATAEAEEIKAKLEEAGAS 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|322801920|gb|EFZ22473.1| hypothetical protein SINV_07411 [Solenopsis invicta]
          Length = 183

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 79/130 (60%), Gaps = 10/130 (7%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------KT 56
           I+ I   +++L LIE AELS  L+K   +   AP+  V    A + +A  E       +T
Sbjct: 55  IDKIANDITALNLIEVAELSDLLKKRLNL-PDAPMMPVGGFVAPSQAAEEEEETHKHVQT 113

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           EF V L GFD+ K+K+A+IKEV++ + D  L +AK+ VESAP  +K  +SKDEA +++  
Sbjct: 114 EFTVKLTGFDE-KQKVALIKEVKSLLPDTNLVQAKKFVESAPTVVKADVSKDEAEKLRDA 172

Query: 116 LEDAGATVEL 125
           L   GAT+E+
Sbjct: 173 LTKVGATIEI 182


>gi|319761185|ref|YP_004125122.1| ribosomal protein l7/l12 [Alicycliphilus denitrificans BC]
 gi|330823045|ref|YP_004386348.1| 50S ribosomal protein L7/L12 [Alicycliphilus denitrificans K601]
 gi|317115746|gb|ADU98234.1| ribosomal protein L7/L12 [Alicycliphilus denitrificans BC]
 gi|329308417|gb|AEB82832.1| ribosomal protein L7/L12 [Alicycliphilus denitrificans K601]
          Length = 126

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           ++ +  L S+T++E  +L K +E+++GVSA+A  +  A  AA   +AA+E KTEF VVL 
Sbjct: 6   DAFLTALDSMTVMELNDLVKAIEEKFGVSAAAMAAPAAGGAAGGAAAAAEEKTEFNVVLA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    K+AVIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL DAGA  
Sbjct: 66  --EAGANKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVDAGAKA 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|53723863|ref|YP_104175.1| 50S ribosomal protein L7/L12 [Burkholderia mallei ATCC 23344]
 gi|76809553|ref|YP_335151.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1710b]
 gi|121601618|ref|YP_994466.1| 50S ribosomal protein L7/L12 [Burkholderia mallei SAVP1]
 gi|124386315|ref|YP_001027884.1| 50S ribosomal protein L7/L12 [Burkholderia mallei NCTC 10229]
 gi|126438766|ref|YP_001060759.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 668]
 gi|126450775|ref|YP_001082980.1| 50S ribosomal protein L7/L12 [Burkholderia mallei NCTC 10247]
 gi|126455177|ref|YP_001068047.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1106a]
 gi|134283125|ref|ZP_01769826.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 305]
 gi|167003565|ref|ZP_02269351.1| 50S ribosomal protein L7/L12 [Burkholderia mallei PRL-20]
 gi|167721585|ref|ZP_02404821.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei DM98]
 gi|167740559|ref|ZP_02413333.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 14]
 gi|167817764|ref|ZP_02449444.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 91]
 gi|167826161|ref|ZP_02457632.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 9]
 gi|167847673|ref|ZP_02473181.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei B7210]
 gi|167896245|ref|ZP_02483647.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 7894]
 gi|167904627|ref|ZP_02491832.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei NCTC 13177]
 gi|167912892|ref|ZP_02499983.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 112]
 gi|167920852|ref|ZP_02507943.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei BCC215]
 gi|217424826|ref|ZP_03456323.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 576]
 gi|226198228|ref|ZP_03793799.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei Pakistan 9]
 gi|237814157|ref|YP_002898608.1| ribosomal protein L7/L12 [Burkholderia pseudomallei MSHR346]
 gi|238563286|ref|ZP_00439111.2| 50S ribosomal protein L7/L12 [Burkholderia mallei GB8 horse 4]
 gi|242314608|ref|ZP_04813624.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1106b]
 gi|254174758|ref|ZP_04881419.1| 50S ribosomal protein L7/L12 [Burkholderia mallei ATCC 10399]
 gi|254180332|ref|ZP_04886930.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1655]
 gi|254190293|ref|ZP_04896801.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei Pasteur
           52237]
 gi|254198462|ref|ZP_04904883.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei S13]
 gi|254201248|ref|ZP_04907612.1| 50S ribosomal protein L7/L12 [Burkholderia mallei FMH]
 gi|254206589|ref|ZP_04912940.1| 50S ribosomal protein L7/L12 [Burkholderia mallei JHU]
 gi|254260388|ref|ZP_04951442.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1710a]
 gi|254300571|ref|ZP_04968016.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 406e]
 gi|254357128|ref|ZP_04973402.1| 50S ribosomal protein L7/L12 [Burkholderia mallei 2002721280]
 gi|81604179|sp|Q62GJ6|RL7_BURMA RecName: Full=50S ribosomal protein L7/L12
 gi|109893750|sp|Q3JMQ2|RL7_BURP1 RecName: Full=50S ribosomal protein L7/L12
 gi|109893751|sp|Q63Q02|RL7_BURPS RecName: Full=50S ribosomal protein L7/L12
 gi|166222143|sp|A3MRU4|RL7_BURM7 RecName: Full=50S ribosomal protein L7/L12
 gi|166222144|sp|A2S7G5|RL7_BURM9 RecName: Full=50S ribosomal protein L7/L12
 gi|166222145|sp|A1V8B3|RL7_BURMS RecName: Full=50S ribosomal protein L7/L12
 gi|166222146|sp|A3P0C6|RL7_BURP0 RecName: Full=50S ribosomal protein L7/L12
 gi|166222147|sp|A3NEI8|RL7_BURP6 RecName: Full=50S ribosomal protein L7/L12
 gi|52427286|gb|AAU47879.1| ribosomal protein L7/L12 [Burkholderia mallei ATCC 23344]
 gi|76579006|gb|ABA48481.1| ribosomal protein L7/L12 [Burkholderia pseudomallei 1710b]
 gi|121230428|gb|ABM52946.1| 50S ribosomal protein L7/L12 [Burkholderia mallei SAVP1]
 gi|124294335|gb|ABN03604.1| 50S ribosomal protein L7/L12 [Burkholderia mallei NCTC 10229]
 gi|126218259|gb|ABN81765.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 668]
 gi|126228819|gb|ABN92359.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1106a]
 gi|126243645|gb|ABO06738.1| 50S ribosomal protein L7/L12 [Burkholderia mallei NCTC 10247]
 gi|134245320|gb|EBA45413.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 305]
 gi|147747142|gb|EDK54218.1| 50S ribosomal protein L7/L12 [Burkholderia mallei FMH]
 gi|147752131|gb|EDK59197.1| 50S ribosomal protein L7/L12 [Burkholderia mallei JHU]
 gi|148026192|gb|EDK84277.1| 50S ribosomal protein L7/L12 [Burkholderia mallei 2002721280]
 gi|157810498|gb|EDO87668.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 406e]
 gi|157937969|gb|EDO93639.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei Pasteur
           52237]
 gi|160695803|gb|EDP85773.1| 50S ribosomal protein L7/L12 [Burkholderia mallei ATCC 10399]
 gi|169655202|gb|EDS87895.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei S13]
 gi|184210871|gb|EDU07914.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1655]
 gi|217392282|gb|EEC32307.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 576]
 gi|225929748|gb|EEH25764.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei Pakistan 9]
 gi|237504772|gb|ACQ97090.1| ribosomal protein L7/L12 [Burkholderia pseudomallei MSHR346]
 gi|238520993|gb|EEP84448.1| 50S ribosomal protein L7/L12 [Burkholderia mallei GB8 horse 4]
 gi|242137847|gb|EES24249.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1106b]
 gi|243060925|gb|EES43111.1| 50S ribosomal protein L7/L12 [Burkholderia mallei PRL-20]
 gi|254219077|gb|EET08461.1| 50S ribosomal protein L7/L12 [Burkholderia pseudomallei 1710a]
          Length = 124

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/122 (50%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  +T++E  EL K  E+++GVSA+A           A +AA EKTEF VVL  
Sbjct: 6   EDILAAVEGMTVLELNELVKAFEEKFGVSAAAVAVAGPAAGGAA-AAAEEKTEFTVVLA- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K+AVIK VR IT LGLKEAK+LV+ APK +K G+ K  A+E KKKLEDAGA VE
Sbjct: 64  -EAGSNKVAVIKAVREITGLGLKEAKDLVDGAPKPVKEGVDKASADEAKKKLEDAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|313625364|gb|EFR95156.1| ribosomal protein L7/L12 [Listeria innocua FSL J1-023]
          Length = 120

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 87/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   +++E  +L K +E+E+GV+A+APV+      A AG  A+E+TEF V L
Sbjct: 4   NIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVA-----VAAAGGGAAEQTEFTVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VR IT LGLKEAKELV++APK+LK G++K+EA E+K KLE+ GA 
Sbjct: 59  ASAGDSK--IKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKEEAEEIKAKLEEVGAN 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|46906484|ref|YP_012873.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes str. 4b F2365]
 gi|47094528|ref|ZP_00232195.1| ribosomal protein L7/L12 [Listeria monocytogenes str. 4b H7858]
 gi|226222879|ref|YP_002756986.1| ribosomal protein L12 [Listeria monocytogenes Clip81459]
 gi|254825705|ref|ZP_05230706.1| ribosomal protein L12 [Listeria monocytogenes FSL J1-194]
 gi|254853482|ref|ZP_05242830.1| ribosomal protein L7/L12 [Listeria monocytogenes FSL R2-503]
 gi|254932470|ref|ZP_05265829.1| ribosomal protein L7/L12 [Listeria monocytogenes HPB2262]
 gi|254991749|ref|ZP_05273939.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes FSL J2-064]
 gi|300764624|ref|ZP_07074616.1| ribosomal protein L7/L12 [Listeria monocytogenes FSL N1-017]
 gi|67461160|sp|Q724G1|RL7_LISMF RecName: Full=50S ribosomal protein L7/L12
 gi|259491651|sp|C1KYI3|RL7_LISMC RecName: Full=50S ribosomal protein L7/L12
 gi|46879748|gb|AAT03050.1| ribosomal protein L7/L12 [Listeria monocytogenes serotype 4b str.
           F2365]
 gi|47017100|gb|EAL07966.1| ribosomal protein L7/L12 [Listeria monocytogenes str. 4b H7858]
 gi|225875341|emb|CAS04038.1| ribosomal protein L12 [Listeria monocytogenes serotype 4b str. CLIP
           80459]
 gi|258606854|gb|EEW19462.1| ribosomal protein L7/L12 [Listeria monocytogenes FSL R2-503]
 gi|293584026|gb|EFF96058.1| ribosomal protein L7/L12 [Listeria monocytogenes HPB2262]
 gi|293594949|gb|EFG02710.1| ribosomal protein L12 [Listeria monocytogenes FSL J1-194]
 gi|300514731|gb|EFK41786.1| ribosomal protein L7/L12 [Listeria monocytogenes FSL N1-017]
 gi|328467860|gb|EGF38900.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 1816]
 gi|328476089|gb|EGF46798.1| 50S ribosomal protein L7/L12 [Listeria monocytogenes 220]
          Length = 120

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   +++E  +L K +E+E+GV+A+APV+      A AG AA+E+TEF V L
Sbjct: 4   NIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVA-----VAAAGGAAAEQTEFTVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VR IT LGLKEAKELV++APK+LK G++K+EA E+K KLE+ GA 
Sbjct: 59  ASAGDSK--IKVIKVVREITGLGLKEAKELVDNAPKALKEGVAKEEAEEIKAKLEEVGAN 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|224055553|ref|XP_002298536.1| predicted protein [Populus trichocarpa]
 gi|118483906|gb|ABK93843.1| unknown [Populus trichocarpa]
 gi|222845794|gb|EEE83341.1| predicted protein [Populus trichocarpa]
          Length = 187

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 77/124 (62%), Gaps = 7/124 (5%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS------EKTE 57
           IE +  ++SSLTL EA  L   L+ + GVSA+A     A   A   +A +      EKTE
Sbjct: 60  IEKLGAEISSLTLEEARTLVDYLQDKLGVSAAAFAPAAAVGVAPGAAADAGAAVVEEKTE 119

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV++       +IAVIK VRA+T L LKEAKEL+E  PK  K G+SKDEA E KK+LE
Sbjct: 120 FDVVIEEVPS-NVRIAVIKSVRALTSLALKEAKELIEGLPKKFKEGVSKDEAEEAKKQLE 178

Query: 118 DAGA 121
            AGA
Sbjct: 179 AAGA 182


>gi|260905743|ref|ZP_05914065.1| 50S ribosomal protein L7/L12 [Brevibacterium linens BL2]
          Length = 126

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E    LTLIE ++  K+ E+ + V A+AP + VA   A A  AA E+TEF+V+L+ 
Sbjct: 7   EELIEGFKELTLIELSDFVKKFEEVFEVEAAAPAAAVAAAPAAAAEAAEEQTEFDVILES 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             +  KK+ VIKEVR +T LGLKEAK+LV+ APK++  G+SKD A + K+ LE AGATV 
Sbjct: 67  AGE--KKVPVIKEVRGLTSLGLKEAKDLVDGAPKAVLEGVSKDAAEKAKETLEGAGATVT 124

Query: 125 LR 126
           ++
Sbjct: 125 VK 126


>gi|160888407|ref|ZP_02069410.1| hypothetical protein BACUNI_00820 [Bacteroides uniformis ATCC 8492]
 gi|167764380|ref|ZP_02436505.1| hypothetical protein BACSTE_02764 [Bacteroides stercoris ATCC
           43183]
 gi|218131346|ref|ZP_03460150.1| hypothetical protein BACEGG_02957 [Bacteroides eggerthii DSM 20697]
 gi|270294760|ref|ZP_06200961.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D20]
 gi|317476373|ref|ZP_07935622.1| ribosomal protein L7/L12 [Bacteroides eggerthii 1_2_48FAA]
 gi|317477759|ref|ZP_07936952.1| ribosomal protein L7/L12 [Bacteroides sp. 4_1_36]
 gi|329962258|ref|ZP_08300264.1| ribosomal protein L7/L12 [Bacteroides fluxus YIT 12057]
 gi|156862084|gb|EDO55515.1| hypothetical protein BACUNI_00820 [Bacteroides uniformis ATCC 8492]
 gi|167697785|gb|EDS14364.1| hypothetical protein BACSTE_02764 [Bacteroides stercoris ATCC
           43183]
 gi|217986278|gb|EEC52615.1| hypothetical protein BACEGG_02957 [Bacteroides eggerthii DSM 20697]
 gi|270274007|gb|EFA19868.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D20]
 gi|316906104|gb|EFV27865.1| ribosomal protein L7/L12 [Bacteroides sp. 4_1_36]
 gi|316907399|gb|EFV29104.1| ribosomal protein L7/L12 [Bacteroides eggerthii 1_2_48FAA]
 gi|328530366|gb|EGF57243.1| ribosomal protein L7/L12 [Bacteroides fluxus YIT 12057]
          Length = 125

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 57/127 (44%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G+AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK     K  + V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKSAGSAK--LQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|221128025|ref|XP_002154945.1| PREDICTED: similar to chloroplast 50S ribosomal protein L7 [Hydra
           magnipapillata]
 gi|260222517|emb|CBA32159.1| 50S ribosomal protein L7/L12 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 125

 Score = 77.4 bits (189), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           ++ +  L S+T++E  +L K +E+++GVSA+A  +  A  AA   +AA EKTEF VVL  
Sbjct: 6   DAFLSALDSMTVMELNDLVKAIEEKFGVSAAAMAAPAAGGAAGGAAAAEEKTEFNVVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K++VIK VR IT LGLKEAK+LV+ APK++K G+SK +A   KKKLE+AGA VE
Sbjct: 65  -EAGANKVSVIKAVREITGLGLKEAKDLVDGAPKAVKEGISKADAEAAKKKLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|224475688|ref|YP_002633294.1| 50S ribosomal protein L7/L12 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420295|emb|CAL27109.1| 50S ribosomal protein L7/L12 [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 121

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/126 (43%), Positives = 85/126 (67%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+            A+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAAGAAGG---GEAAEKTEFDV 57

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L      K  I V+K V+  T LGLK+AKELV++APK +K  L K+EA ++K++LE+ G
Sbjct: 58  ELTSAGSSK--IKVVKAVKDATGLGLKDAKELVDNAPKVIKEALPKEEAEKLKEQLEEVG 115

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 116 ASVELK 121


>gi|332169096|gb|AEE18351.1| ribosomal protein L7/L12 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 123

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 85/126 (67%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A   V  P  A A  AA EK+EF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVVAGPAGAGA-EAAEEKSEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLK+AKELV++AP  +K G+SKDEA  +K +LE+AG
Sbjct: 60  ILKAA--GSSKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGVSKDEAEALKAQLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AEVELK 123


>gi|258647509|ref|ZP_05734978.1| ribosomal protein L7/L12 [Prevotella tannerae ATCC 51259]
 gi|260852282|gb|EEX72151.1| ribosomal protein L7/L12 [Prevotella tannerae ATCC 51259]
          Length = 124

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 81/125 (64%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A   +AA EKT F+V
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAGAAAAEEKTAFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK     K  + V+K V+    LGLKEAK+LV+  P  LK G++K+EA  +KK LE+AG
Sbjct: 61  ILKAAGSAK--LQVVKAVKENCGLGLKEAKDLVDGVPSKLKEGVAKEEAESLKKVLEEAG 118

Query: 121 ATVEL 125
           A VE+
Sbjct: 119 AEVEI 123


>gi|294674791|ref|YP_003575407.1| 50S ribosomal protein L7/L12 [Prevotella ruminicola 23]
 gi|294471910|gb|ADE81299.1| ribosomal protein L7/L12 [Prevotella ruminicola 23]
          Length = 126

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 85/128 (66%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS--EKTEF 58
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A AG+A +  EKT F
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAAGAADAAEEKTSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVLK     K  + V+K V+    LGLKEAK+LV+ AP ++K GLSK+EA  +KK +E 
Sbjct: 61  DVVLKSAGAAK--LQVVKAVKEACGLGLKEAKDLVDGAPATVKEGLSKEEAENLKKTIEA 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|312144256|ref|YP_003995702.1| ribosomal protein L7/L12 [Halanaerobium sp. 'sapolanicus']
 gi|311904907|gb|ADQ15348.1| ribosomal protein L7/L12 [Halanaerobium sp. 'sapolanicus']
          Length = 122

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 57/73 (78%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+V L   D   KKI VIK VR +T LGLKEAK +V+ AP ++K GLSK++A EMK
Sbjct: 52  EQTEFDVFLA--DIGSKKIKVIKAVRELTGLGLKEAKGVVDDAPGNIKEGLSKEDAEEMK 109

Query: 114 KKLEDAGATVELR 126
           +KLE+AGATVEL+
Sbjct: 110 EKLEEAGATVELK 122


>gi|325954354|ref|YP_004238014.1| 50S ribosomal protein L7/L12 [Weeksella virosa DSM 16922]
 gi|323436972|gb|ADX67436.1| 50S ribosomal protein L7/L12 [Weeksella virosa DSM 16922]
          Length = 122

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E+L +LT++E  ELS  L+ E+G+  +A             +AA E++EF+V
Sbjct: 1   MADLKKLAEELVNLTVVEVNELSTILKDEYGIEPAAAAV--VVAGGAGEAAAEEQSEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLKEAK+LV+SAP ++K  +SK+EA  +KK+LE+AG
Sbjct: 59  ILKA--GGANKLAVVKLVKDLTGKGLKEAKDLVDSAPATIKEQVSKEEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|291613228|ref|YP_003523385.1| ribosomal protein L7/L12 [Sideroxydans lithotrophicus ES-1]
 gi|291583340|gb|ADE10998.1| ribosomal protein L7/L12 [Sideroxydans lithotrophicus ES-1]
          Length = 126

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 87/123 (70%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           ++ +  L S++++E  EL K +E+++GVSA+A  +  A  AA  G+AA+ E+TEF V LK
Sbjct: 6   DAFLAALDSMSVLELNELVKAVEEKFGVSAAAMAAPAAGGAAAGGAAAAAEQTEFTVTLK 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              D  +K+ VIK VR IT LGLKEAK+LV+ APK +K G+SK +A+ + K+L +AGAT 
Sbjct: 66  SAGD--QKVNVIKVVRTITGLGLKEAKDLVDGAPKVVKEGISKADADAIAKQLIEAGATA 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|328953166|ref|YP_004370500.1| 50S ribosomal protein L7/L12 [Desulfobacca acetoxidans DSM 11109]
 gi|328453490|gb|AEB09319.1| 50S ribosomal protein L7/L12 [Desulfobacca acetoxidans DSM 11109]
          Length = 126

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 61/123 (49%), Positives = 89/123 (72%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +++ ++S++++E +++ K LE+++GV+A+APV+V A  A    + A E KTEF+V+L 
Sbjct: 6   EEVIDFIASMSVLELSQMIKDLEEKFGVTAAAPVAVAAGPAMAEAAPAVEEKTEFDVILT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIKEVRAIT LGLKEAKE VE  P ++K  +SK EA E+KKKLE+ GATV
Sbjct: 66  VIG--ANKIQVIKEVRAITGLGLKEAKEAVEGVPTNIKEAVSKAEAEEIKKKLEEQGATV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|332178507|gb|AEE14196.1| 50S ribosomal protein L7/L12 [Thermodesulfobium narugense DSM
           14796]
          Length = 128

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 86/125 (68%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTEFEVV 61
           E I+E +S +T++E +EL K  E+++GV+A+APV+V A  A  A +      E+TEF+V+
Sbjct: 6   EEILEAISQMTVLELSELIKAFEEKFGVTAAAPVAVAAAGAGAAAAPQEEVEEQTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D   KKI V+K VR IT LGLKEAKELV++ PK +K  + K+EA E+K K+E AG 
Sbjct: 66  LT--DVGAKKIDVLKVVREITSLGLKEAKELVDNVPKPIKEKVKKEEAAEIKAKVEAAGG 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 KVEVK 128


>gi|82701891|ref|YP_411457.1| 50S ribosomal protein L7/L12 [Nitrosospira multiformis ATCC 25196]
 gi|109893774|sp|Q2YB06|RL7_NITMU RecName: Full=50S ribosomal protein L7/L12
 gi|82409956|gb|ABB74065.1| LSU ribosomal protein L12P [Nitrosospira multiformis ATCC 25196]
          Length = 126

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 88/121 (72%), Gaps = 3/121 (2%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLKGF 65
           I++ ++++T++E ++L K +E+++GVSA+A   V A  AA A +A +E +TEF V+L   
Sbjct: 8   ILDAIANMTVLELSQLIKEMEEKFGVSAAAAAVVAAAPAAGAAAAPAEEQTEFTVMLTAV 67

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
            + K  + VIK VRA+T LGLKEAK+LV+ APK +K G++K +A  ++K+L +AGAT E+
Sbjct: 68  GESK--VNVIKVVRAVTGLGLKEAKDLVDGAPKPVKEGIAKADAEAIQKQLAEAGATAEI 125

Query: 126 R 126
           +
Sbjct: 126 K 126


>gi|298372781|ref|ZP_06982771.1| ribosomal protein L7/L12 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275685|gb|EFI17236.1| ribosomal protein L7/L12 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 126

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 88/128 (68%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEF 58
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A+A      P AA    AA EKT F
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAEILKNEYGIEPAAAAVAVAAGPAAAAGAPAAEEKTSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK       K+AV+K V+ +T LGLKEAK++V++AP  +K G+SK+EA E++K+L  
Sbjct: 61  DVMLKSAG--ANKLAVVKLVKELTGLGLKEAKDIVDAAPSKVKEGVSKEEAEELQKQLTG 118

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 119 AGAEVELK 126


>gi|71905953|ref|YP_283540.1| 50S ribosomal protein L7/L12 [Dechloromonas aromatica RCB]
 gi|109893759|sp|Q47JB1|RL7_DECAR RecName: Full=50S ribosomal protein L7/L12
 gi|71845574|gb|AAZ45070.1| LSU ribosomal protein L12P [Dechloromonas aromatica RCB]
          Length = 123

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA E+TEF V+L G
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEQTEFTVMLTG 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KK+ VIK VRA T LGLKEAK+LV+ APK++K G+SK +A  +K +LE AGA VE
Sbjct: 64  AGD--KKVEVIKVVRAATGLGLKEAKDLVDGAPKAVKEGVSKADAEALKAQLEAAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|297815042|ref|XP_002875404.1| ribosomal protein L12-A [Arabidopsis lyrata subsp. lyrata]
 gi|297321242|gb|EFH51663.1| ribosomal protein L12-A [Arabidopsis lyrata subsp. lyrata]
          Length = 184

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/123 (47%), Positives = 75/123 (60%), Gaps = 11/123 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------EKT 56
           IE I  ++SSLTL EA  L   L+ ++GVS   P+S+    AA A  A         E+T
Sbjct: 66  IEKIGSEISSLTLEEARILVDYLQDKFGVS---PLSLAPAAAAVAAPADGGAAAVVEEQT 122

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK L
Sbjct: 123 EFDVVINEVPS-SSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGVTKDEAEEAKKTL 181

Query: 117 EDA 119
           E+A
Sbjct: 182 EEA 184


>gi|48474735|sp|Q8KTP9|RL7_TREPR RecName: Full=50S ribosomal protein L7/L12
 gi|21702603|gb|AAM75999.1|AF481103_9 ribosomal protein L7/L12 [Candidatus Tremblaya princeps]
          Length = 121

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/128 (40%), Positives = 76/128 (59%), Gaps = 9/128 (7%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSN + IV +++S+T +E ++L   LE+ + +S       +AP   + GS A E  +   
Sbjct: 1   MSN-DDIVSRIASMTALELSDLVGLLEQRFNISR------IAPAPCQPGSNAVEAEQDRR 53

Query: 61  VLKGF--DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
             K F       KIAVI+ VR +T LGLKE+K LV+SAP  +  GLS DEA +++ K+E 
Sbjct: 54  DRKVFLTHSGSNKIAVIRAVRDVTKLGLKESKGLVDSAPSLVAEGLSADEAEDIRAKVEA 113

Query: 119 AGATVELR 126
           AGA  E+R
Sbjct: 114 AGAKAEVR 121


>gi|224023599|ref|ZP_03641965.1| hypothetical protein BACCOPRO_00306 [Bacteroides coprophilus DSM
           18228]
 gi|224016821|gb|EEF74833.1| hypothetical protein BACCOPRO_00306 [Bacteroides coprophilus DSM
           18228]
          Length = 125

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 86/127 (67%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAAGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK     K  + V+K V+    LGLKEAK+LV+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKSAGAAK--LQVVKAVKESCGLGLKEAKDLVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|167521063|ref|XP_001744870.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163776484|gb|EDQ90103.1| predicted protein [Monosiga brevicollis MX1]
          Length = 143

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (62%), Gaps = 5/126 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVS---ASAPVSVVAPVAAEAGSAASEKTEFEV 60
           IE+IV ++SS+T++E A+L   L+    ++    +   +     A  A     E+TEF++
Sbjct: 18  IENIVSEVSSMTILEVADLVAALKDRLNIADMPMAVAAAPAGGAAPAAEEPKEEQTEFDI 77

Query: 61  VLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
            L  FDD K KI VIKEVR I  DL L EAK+LVE AP+ LK G+SK+EA ++K  +E A
Sbjct: 78  KLVKFDD-KAKIKVIKEVRNILPDLKLAEAKKLVEDAPQPLKKGISKEEAEKIKAVIEAA 136

Query: 120 GATVEL 125
           G TVE+
Sbjct: 137 GGTVEI 142


>gi|149184032|ref|ZP_01862392.1| 50S ribosomal protein L7/L12 [Bacillus sp. SG-1]
 gi|148848260|gb|EDL62550.1| 50S ribosomal protein L7/L12 [Bacillus sp. SG-1]
          Length = 92

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/72 (62%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+VVL+      +KI VIK VR IT LGLKEAKELV++ PK+LK G+SKDEA E+K 
Sbjct: 23  KTEFDVVLESAGS--QKIKVIKVVREITGLGLKEAKELVDNTPKALKEGVSKDEAEELKA 80

Query: 115 KLEDAGATVELR 126
           KLE+ GA VE++
Sbjct: 81  KLEEVGAGVEVK 92


>gi|331007099|ref|ZP_08330322.1| LSU ribosomal protein L7/L12 (L23e) [gamma proteobacterium
           IMCC1989]
 gi|330419094|gb|EGG93537.1| LSU ribosomal protein L7/L12 (L23e) [gamma proteobacterium
           IMCC1989]
          Length = 124

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 43/72 (59%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVL    D  KK+  IK VRAIT LGLKEAK +VESAP ++K G+SK +A E+KK
Sbjct: 55  QTEFDVVLTAAGD--KKVNAIKAVRAITGLGLKEAKTMVESAPATVKEGVSKADAEEVKK 112

Query: 115 KLEDAGATVELR 126
           +LE+AGA+ EL+
Sbjct: 113 QLEEAGASAELK 124


>gi|168063646|ref|XP_001783781.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162664724|gb|EDQ51433.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 195

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/133 (40%), Positives = 80/133 (60%), Gaps = 13/133 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            ++ I +++S+L+++EA +LS  L+K+ G+ A   +  +  +    G   S         
Sbjct: 61  KVQRIADEISTLSMVEAVDLSTLLKKKLGLPAGMGMMPMGMMPPGMGMPGSSGAAAAAEE 120

Query: 55  ----KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
               KT F+V L+ FD    KI +IKEVR  T LGLKEAKELVE AP  LK G+SK+EA+
Sbjct: 121 KKPEKTSFDVKLEKFD-AASKIKIIKEVRTFTALGLKEAKELVEKAPIVLKAGVSKEEAD 179

Query: 111 EMKKKLEDAGATV 123
           ++ +KL+  GATV
Sbjct: 180 QIIEKLKSVGATV 192


>gi|254282147|ref|ZP_04957115.1| ribosomal protein L7/L12 [gamma proteobacterium NOR51-B]
 gi|219678350|gb|EED34699.1| ribosomal protein L7/L12 [gamma proteobacterium NOR51-B]
          Length = 126

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           + I++ ++ +++++   L + +E+++GV+A+A V+       +AG  A+ EK EF+VVL 
Sbjct: 6   DEILDAIAEMSVMDIVSLIEAMEEKFGVTAAAAVAAAPAAGGDAGGEAAAEKDEFDVVLT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
              +  KK+ VIK VRAIT LGLKEAK LV+ AP  +K G SKDEA ++KK+LE+AG +V
Sbjct: 66  AAGE--KKVNVIKVVRAITGLGLKEAKGLVDGAPSPIKEGASKDEAEDIKKQLEEAGGSV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|18409467|ref|NP_564986.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|13430422|gb|AAK25833.1|AF360123_1 unknown protein [Arabidopsis thaliana]
 gi|2194123|gb|AAB61098.1| Similar to Secale chloroplast ribosomal protein L12 (gb|SCL121A).
           EST gb|H36579 comes from this gene [Arabidopsis
           thaliana]
 gi|15293181|gb|AAK93701.1| unknown protein [Arabidopsis thaliana]
 gi|332196909|gb|AEE35030.1| ribosomal protein L7/L12 domain-containing protein [Arabidopsis
           thaliana]
 gi|332196910|gb|AEE35031.1| ribosomal protein L7/L12 domain-containing protein [Arabidopsis
           thaliana]
          Length = 208

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 82/135 (60%), Gaps = 17/135 (12%)

Query: 7   IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP-------------VAAEAG---S 50
           +V+++SSLTL+E +EL   + K+ G++    V+V+ P             + +++G    
Sbjct: 74  LVDEISSLTLLEISELGSIIMKKKGMTELPTVAVMKPGAGGGVGVGGGGGMVSQSGVSEE 133

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           A  EKT FE+ L+ F+    KI +IKE+R+ TDLGLKEAK LVE  P  LK GLSK+E  
Sbjct: 134 AKVEKTVFEIKLESFE-ASAKIKIIKELRSFTDLGLKEAKALVEKTPAILKAGLSKEEGE 192

Query: 111 EMKKKLEDAGATVEL 125
           ++ +KL+  GA V L
Sbjct: 193 KILEKLKALGAKVVL 207


>gi|87123512|ref|ZP_01079363.1| Ribosomal protein L7/L12 [Synechococcus sp. RS9917]
 gi|86169232|gb|EAQ70488.1| Ribosomal protein L7/L12 [Synechococcus sp. RS9917]
          Length = 130

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 5/110 (4%)

Query: 21  ELSKRLEKEWGVSASAPVSVV----APVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIK 76
           EL K++E  +GVSA+A   VV       A   G AA EKTEF+VVL+ F+    KI V+K
Sbjct: 22  ELVKQIEDAFGVSAAASAGVVMAAPGAAAGGGGEAAEEKTEFDVVLESFE-ASAKIKVLK 80

Query: 77  EVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
            VR  T LGL +AK +VE+APK++K G+SKDEA  +KK +E+ G  V L+
Sbjct: 81  AVREATGLGLGDAKAMVEAAPKAIKEGVSKDEAEALKKAIEEVGGKVTLK 130


>gi|225621224|ref|YP_002722482.1| 50S ribosomal protein L7/L12 [Brachyspira hyodysenteriae WA1]
 gi|254806264|sp|C0QWX5|RL7_BRAHW RecName: Full=50S ribosomal protein L7/L12
 gi|225216044|gb|ACN84778.1| 50S ribosomal protein L7/L12 [Brachyspira hyodysenteriae WA1]
          Length = 128

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEVVL 62
           E I++ +  + +IE  EL + +++++ V+A+ PV+ VA   A   +A +E  K EF+++L
Sbjct: 6   EEILQAIEEMKVIELHELVEAIKEKFNVTAAMPVAAVAAAPAGGAAAPAEEEKNEFDIIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GFD   +KIA+IKEVRA++ LGLKEAK+ VE   +++K+G+SK+EA  +KK+LE AG  
Sbjct: 66  TGFD-AAQKIALIKEVRAVSGLGLKEAKDAVEKGGETIKSGVSKEEAAAIKKQLEAAGGK 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEVK 128


>gi|171914822|ref|ZP_02930292.1| 50S ribosomal protein L7/L12 [Verrucomicrobium spinosum DSM 4136]
          Length = 126

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 94/128 (73%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFE 59
           M+++  IV++LS LT++E AEL K LE +WGVSA+APV+V A   A   +AA+ EKTEF+
Sbjct: 1   MADLNKIVDELSGLTVLEVAELVKTLEDKWGVSAAAPVAVAAAGGAAPAAAAAVEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           V+L   +    KI VIKEVRA+   LGL EAK LVE AP+ LK G+SK+EA E+KKK+E 
Sbjct: 61  VILT--EGGTNKIGVIKEVRAVVAGLGLAEAKALVEKAPQPLKQGVSKEEAEEIKKKIEA 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAKVEIK 126


>gi|86134001|ref|ZP_01052583.1| 50S ribosomal protein L7/L12 [Polaribacter sp. MED152]
 gi|85820864|gb|EAQ42011.1| 50S ribosomal protein L7/L12 [Polaribacter sp. MED152]
          Length = 125

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 58/127 (45%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV-SASAPVSVVAPVAAEAGSAASEKTEFE 59
           M+ ++   E+L +LT+ E  EL+  L+ E+G+  A+A V+V  P A     AA E+TEF+
Sbjct: 1   MAELKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAVAGPAAGGGDDAADEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L        K+AV+K V+ +T LGLK+AK +V+SAP  +K G+SKDEA  +KK LE+A
Sbjct: 61  VILTAA--GASKLAVVKLVKELTGLGLKDAKGIVDSAPAPIKEGVSKDEAEGLKKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|330432332|gb|AEC17391.1| 50S ribosomal protein L7/L12 [Gallibacterium anatis UMN179]
          Length = 123

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 45/73 (61%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKTEF+VVL   +    K+AVIK VR+ T LGLKEAK+LVESAP +LK GL+K EA  +K
Sbjct: 53  EKTEFDVVLA--EAGANKVAVIKAVRSATGLGLKEAKDLVESAPATLKEGLAKAEAEALK 110

Query: 114 KKLEDAGATVELR 126
           K LE+AGA VE++
Sbjct: 111 KDLEEAGAKVEIK 123


>gi|255657878|ref|ZP_05403287.1| ribosomal protein L7/L12 [Mitsuokella multacida DSM 20544]
 gi|260850068|gb|EEX70075.1| ribosomal protein L7/L12 [Mitsuokella multacida DSM 20544]
          Length = 122

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E +EL K +E+++GVSA+APV+V A  AA   +AA EKTEF VVL  
Sbjct: 4   EEIMEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGAAAG-AAAEEKTEFTVVLSA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VR  T LGLKEAK LV+ AP  +K  +SK +A+ +K KLE+AGATVE
Sbjct: 63  VGD--KKINVIKAVREATGLGLKEAKALVDGAPAPVKENVSKADADALKAKLEEAGATVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|189465410|ref|ZP_03014195.1| hypothetical protein BACINT_01763 [Bacteroides intestinalis DSM
           17393]
 gi|319900916|ref|YP_004160644.1| LSU ribosomal protein L12P [Bacteroides helcogenes P 36-108]
 gi|189437684|gb|EDV06669.1| hypothetical protein BACINT_01763 [Bacteroides intestinalis DSM
           17393]
 gi|319415947|gb|ADV43058.1| LSU ribosomal protein L12P [Bacteroides helcogenes P 36-108]
          Length = 125

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/127 (44%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G+AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK     K  + V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKSAGAAK--LQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|256819270|ref|YP_003140549.1| 50S ribosomal protein L7/L12 [Capnocytophaga ochracea DSM 7271]
 gi|315224713|ref|ZP_07866536.1| ribosomal protein L7/L12 [Capnocytophaga ochracea F0287]
 gi|256580853|gb|ACU91988.1| ribosomal protein L7/L12 [Capnocytophaga ochracea DSM 7271]
 gi|314945341|gb|EFS97367.1| ribosomal protein L7/L12 [Capnocytophaga ochracea F0287]
          Length = 127

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 58/129 (44%), Positives = 87/129 (67%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV---SASAPVSVVAPVAAEAGSAASEKTE 57
           M++++   E+L +LT+ E  EL++ L+ E+G+   +A+  V+    VA  A  A +EKTE
Sbjct: 1   MADLKKFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAGGAVAGGAAEAGAEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V LK       K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK+EA  +KK LE
Sbjct: 61  FDVFLK--SAGANKLAVVKLVKDLTGLGLKEAKEVVDGAPSKVKEGVSKEEAEGLKKSLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAEVELK 127


>gi|127511084|ref|YP_001092281.1| ribosomal protein L7/L12 [Shewanella loihica PV-4]
 gi|166222209|sp|A3Q974|RL7_SHELP RecName: Full=50S ribosomal protein L7/L12
 gi|126636379|gb|ABO22022.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Shewanella
           loihica PV-4]
          Length = 122

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 57/122 (46%), Positives = 86/122 (70%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L++++++E  EL + +E+++GVSA+A V      A    +AA EKTEF+VV+  
Sbjct: 6   DQILEALAAMSVMEVVELIEAMEEKFGVSAAAAVVSGGADAG---AAAEEKTEFDVVMTS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   K+AVIK +R  T LGLKEAK + ESAP ++K G+SK+EA  +KK+LE+AGA VE
Sbjct: 63  HGD--NKVAVIKALRGATGLGLKEAKGMAESAPVAVKEGISKEEAEALKKELEEAGAQVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|289433605|ref|YP_003463477.1| hypothetical protein lse_0236 [Listeria seeligeri serovar 1/2b str.
           SLCC3954]
 gi|289169849|emb|CBH26387.1| rplL [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|313635079|gb|EFS01429.1| ribosomal protein L7/L12 [Listeria seeligeri FSL N1-067]
 gi|313639745|gb|EFS04500.1| ribosomal protein L7/L12 [Listeria seeligeri FSL S4-171]
          Length = 120

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   +++E  +L K +E+E+GV+A+APV+      A AG AA+E+TEF + L
Sbjct: 4   NIEEIIASVKEASVLELNDLVKAIEEEFGVTAAAPVA-----VAAAGGAAAEQTEFTLEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
               D K  I VIK VR IT LGLKEAKELV++APK+LK G++K+EA E+K KLE+ GA 
Sbjct: 59  SSAGDSK--IKVIKVVREITGLGLKEAKELVDNAPKALKEGVTKEEAEELKAKLEEVGAN 116

Query: 123 VELR 126
           VE++
Sbjct: 117 VEVK 120


>gi|254424556|ref|ZP_05038274.1| ribosomal protein L7/L12 [Synechococcus sp. PCC 7335]
 gi|196192045|gb|EDX87009.1| ribosomal protein L7/L12 [Synechococcus sp. PCC 7335]
          Length = 127

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (70%), Gaps = 2/123 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           + I+EKL +L+L+EA+EL  ++E+ +GVSA+APV+V       A +   E KTEF+VVL 
Sbjct: 6   DEILEKLKTLSLLEASELVSQIEEAFGVSAAAPVAVAGGGGGAAAAEEVEEKTEFDVVLD 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                KK IA++K VR++T LGLKEAK +VESAP ++K  ++KD A E KK LEDAGA V
Sbjct: 66  EVPGDKK-IAILKAVRSMTGLGLKEAKGMVESAPVTVKEAVAKDAAEEAKKTLEDAGAKV 124

Query: 124 ELR 126
            ++
Sbjct: 125 TVK 127


>gi|228995490|ref|ZP_04155158.1| 50S ribosomal protein L7/L12 [Bacillus mycoides Rock3-17]
 gi|229003115|ref|ZP_04160962.1| 50S ribosomal protein L7/L12 [Bacillus mycoides Rock1-4]
 gi|228758130|gb|EEM07328.1| 50S ribosomal protein L7/L12 [Bacillus mycoides Rock1-4]
 gi|228764219|gb|EEM13098.1| 50S ribosomal protein L7/L12 [Bacillus mycoides Rock3-17]
          Length = 119

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K +E+E+GV+A+AP      VA  AG AA+E+TEF+VVL  
Sbjct: 4   EQIIEAVKSMTVLELNDLVKAIEEEFGVTAAAP----VAVAGGAGEAAAEQTEFDVVLAS 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR IT LGLKEAKE+V++ PK++K G SK+EA E+K KLE+ GA+VE
Sbjct: 60  --AGAQKIKVIKVVREITGLGLKEAKEVVDNTPKAVKEGASKEEAEEIKAKLEEVGASVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|319944813|ref|ZP_08019076.1| 50S ribosomal protein L7/L12 [Lautropia mirabilis ATCC 51599]
 gi|319741927|gb|EFV94351.1| 50S ribosomal protein L7/L12 [Lautropia mirabilis ATCC 51599]
          Length = 128

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 88/125 (70%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTEFEVV 61
           E I++ ++ +T++E +EL K +E+++GVSA+A    VA  AA   +  +   E+TEF VV
Sbjct: 6   EEILDAVAGMTVLELSELIKMMEEKFGVSAAAAAVAVAAPAAGGAAGGAAAEEQTEFTVV 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L    +  KK+ VIK VRA T LGLKEAK+LV+ APK +K G+SK +A+ +KK+LEDAGA
Sbjct: 66  LAAAGE--KKVEVIKVVRAATGLGLKEAKDLVDGAPKPVKEGISKADADALKKQLEDAGA 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 KVEVK 128


>gi|288554715|ref|YP_003426650.1| 50S ribosomal protein L7/L12 [Bacillus pseudofirmus OF4]
 gi|288545875|gb|ADC49758.1| 50S ribosomal protein L7/L12 [Bacillus pseudofirmus OF4]
          Length = 120

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T++E  +L K +E+E+GV+A+APV+V    A      A+E+TEF+++L  
Sbjct: 4   EQIIEAVKEMTVLELNDLVKAIEEEFGVTAAAPVAVAGGAAE---GGAAEQTEFDLILTS 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               K  I VIK VR IT LGLKEAK LV+ AP  +K G++K+EA EMK KLEDAGA+VE
Sbjct: 61  AGGSK--IGVIKVVREITGLGLKEAKALVDGAPSPVKEGIAKEEAEEMKAKLEDAGASVE 118

Query: 125 LR 126
           ++
Sbjct: 119 VK 120


>gi|227541691|ref|ZP_03971740.1| 50S ribosomal protein L7/L12 [Corynebacterium glucuronolyticum ATCC
           51866]
 gi|227182506|gb|EEI63478.1| 50S ribosomal protein L7/L12 [Corynebacterium glucuronolyticum ATCC
           51866]
          Length = 128

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E ++E    +TLIE +E +K  E+ + V+A+APV+V A  AA   +AA E KTEF+VVL+
Sbjct: 7   EELIEAFKEMTLIELSEFTKLFEETFDVTAAAPVAVAAAGAAGGEAAAEEEKTEFDVVLE 66

Query: 64  GFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             D   KKI VIK VR I + LGLKEAKELVE+APK++  G SK++A   K KLE+AGA+
Sbjct: 67  --DAGAKKIGVIKAVREIVSGLGLKEAKELVEAAPKAILEGASKEDAEAAKTKLEEAGAS 124

Query: 123 VELR 126
           V L+
Sbjct: 125 VTLK 128


>gi|254785055|ref|YP_003072483.1| 50S ribosomal protein L7/L12 [Teredinibacter turnerae T7901]
 gi|259491658|sp|C5BQ38|RL7_TERTT RecName: Full=50S ribosomal protein L7/L12
 gi|237687256|gb|ACR14520.1| ribosomal protein L7/L12 [Teredinibacter turnerae T7901]
          Length = 126

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           E+TEF+VVL    +  KK+ VIK VRAIT LGLKEAK +V+ AP ++K  LSKD+A   K
Sbjct: 56  EQTEFDVVLASAGE--KKVNVIKAVRAITGLGLKEAKAMVDGAPSTVKEALSKDDAEAAK 113

Query: 114 KKLEDAGATVELR 126
           K+LE+AGATVEL+
Sbjct: 114 KELEEAGATVELK 126


>gi|270291190|ref|ZP_06197413.1| 50S ribosomal protein L7/L12 [Pediococcus acidilactici 7_4]
 gi|304385475|ref|ZP_07367820.1| ribosomal protein L7/L12 [Pediococcus acidilactici DSM 20284]
 gi|270280586|gb|EFA26421.1| 50S ribosomal protein L7/L12 [Pediococcus acidilactici 7_4]
 gi|304328682|gb|EFL95903.1| ribosomal protein L7/L12 [Pediococcus acidilactici DSM 20284]
          Length = 121

 Score = 76.6 bits (187), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           +  +E L   ++ +  +L K +E E+GVSA+APV+           AA  KT F V L G
Sbjct: 6   DQFIEDLKGASISDLNDLVKAIEDEFGVSAAAPVAAAGAAG----GAAEAKTSFNVELTG 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT  GLK+AK++V++AP  +K  LS+DEAN+MK KLE+AGATVE
Sbjct: 62  A--GSAKIKVIKAVREITGAGLKDAKDMVDNAPTVIKEDLSEDEANDMKAKLEEAGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|224827270|ref|ZP_03700364.1| ribosomal protein L7/L12 [Lutiella nitroferrum 2002]
 gi|224600559|gb|EEG06748.1| ribosomal protein L7/L12 [Lutiella nitroferrum 2002]
          Length = 123

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + +LT++E  +L K  E+++    SA    VA  AA   +AA EKTEF+V+L  
Sbjct: 6   EDILEAVGALTVMELNDLVKAFEEKF--GVSAAAVAVAGPAAGGAAAAEEKTEFDVILSA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D   K+ VIK VRAIT LGLKEAK+LV+ APK++K G+SK EA E+ K+L +AGA  E
Sbjct: 64  AGD--NKVNVIKVVRAITGLGLKEAKDLVDGAPKAVKEGVSKAEAEEVLKQLTEAGAKAE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|160895958|ref|YP_001561540.1| 50S ribosomal protein L7/L12 [Delftia acidovorans SPH-1]
 gi|226733672|sp|A9BR97|RL7_DELAS RecName: Full=50S ribosomal protein L7/L12
 gi|160361542|gb|ABX33155.1| ribosomal protein L7/L