PSIBLAST alignment of GI: 254780144 and protein with PDB id: 3i8i

gi|294979561|pdb|3I8I|I Chain I, Elongation Complex Of The 70s Ribosome With Three Trnas And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g (30s). Length = 125
>gi|294979565|pdb|3I8I|J Chain J, Elongation Complex Of The 70s Ribosome With Three Trnas And Entry 3i8i Contains 50s Ribosomal Subnit. The 30s Ribosomal Can Be Found In Pdb Entry 3i8h. Molecule A In The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g (30s). Length = 125
 Score = 67.2 bits (163), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 83/125 (66%), Gaps = 4/125 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           +IE I E+LS  T++E  +L   L++ WGV+ A+      AP A  A + A EKTEF+V+
Sbjct: 4   DIERIKEELSQATVLELKQLIDALKEAWGVTAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +   KK+ VIKE+RAIT LGLKEAK+L E     +K G+SK EA E+KKKLE  GA
Sbjct: 64  LK--EAGAKKLEVIKELRAITGLGLKEAKDLAEKGG-PVKEGVSKQEAEEIKKKLEAVGA 120

Query: 122 TVELR 126
            VEL+
Sbjct: 121 VVELK 125