BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P
[Candidatus Liberibacter asiaticus str. psy62]
         (126 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|124024468|ref|YP_001018775.1| hypothetical protein P9303_27801 [Prochlorococcus marinus str. MIT
           9303]
 gi|123964754|gb|ABM79510.1| Hypothetical protein P9303_27801 [Prochlorococcus marinus str. MIT
           9303]
          Length = 179

 Score =  109 bits (272), Expect = 1e-22,   Method: Composition-based stats.
 Identities = 53/129 (41%), Positives = 82/129 (63%), Gaps = 6/129 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTE 57
             + I++ L +L+L+EA+EL K++E  +GVSA+    VV      A   A+      +TE
Sbjct: 52  KTDDILDSLKTLSLLEASELVKQIEDAFGVSAAPSAGVVMAAGGGAAGGAAAEAAEEQTE 111

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+ FD    KI V+K VR  T LGL +AK +VE+APK++K G++K++A  +KK +E
Sbjct: 112 FDVVLESFDASA-KIKVLKAVREATGLGLGDAKAMVEAAPKTIKEGIAKNDAEALKKAIE 170

Query: 118 DAGATVELR 126
           + G  V L+
Sbjct: 171 EVGGKVSLK 179


>gi|254780144|ref|YP_003064557.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|38195607|gb|AAR13470.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|94548940|gb|ABF38967.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           asiaticus]
 gi|157704383|gb|ABV68882.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           asiaticus]
 gi|254039821|gb|ACT56617.1| 50S ribosomal protein L12P [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|255957551|dbj|BAH96614.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957847|dbj|BAH96821.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957857|dbj|BAH96830.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957867|dbj|BAH96839.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957877|dbj|BAH96848.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957887|dbj|BAH96857.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957897|dbj|BAH96866.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957907|dbj|BAH96875.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957917|dbj|BAH96884.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957927|dbj|BAH96893.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957937|dbj|BAH96902.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957947|dbj|BAH96911.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957957|dbj|BAH96920.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957967|dbj|BAH96929.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957977|dbj|BAH96938.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957987|dbj|BAH96947.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255957997|dbj|BAH96956.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958007|dbj|BAH96965.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958017|dbj|BAH96974.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958027|dbj|BAH96983.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958037|dbj|BAH96992.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958047|dbj|BAH97001.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958057|dbj|BAH97010.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958067|dbj|BAH97019.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958077|dbj|BAH97028.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958087|dbj|BAH97037.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958097|dbj|BAH97046.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958107|dbj|BAH97055.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958117|dbj|BAH97064.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|255958127|dbj|BAH97073.1| 50S ribosomal subunit protein L7/L12 [Candidatus Liberibacter
           asiaticus]
 gi|283362137|dbj|BAI65924.1| ribosomal protein L12P [Candidatus Liberibacter asiaticus]
 gi|283362147|dbj|BAI65933.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362157|dbj|BAI65942.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362167|dbj|BAI65951.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362177|dbj|BAI65960.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362187|dbj|BAI65969.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362197|dbj|BAI65978.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362207|dbj|BAI65987.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362217|dbj|BAI65996.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362227|dbj|BAI66005.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
 gi|283362237|dbj|BAI66014.1| LSU ribosomal protein [Candidatus Liberibacter asiaticus]
          Length = 126

 Score =  108 bits (270), Expect = 3e-22,   Method: Composition-based stats.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG
Sbjct: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120

Query: 121 ATVELR 126
           ATVELR
Sbjct: 121 ATVELR 126


>gi|301754207|ref|XP_002912990.1| PREDICTED: 39S ribosomal protein L12, mitochondrial-like
           [Ailuropoda melanoleuca]
          Length = 317

 Score =  106 bits (264), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 68/137 (49%), Gaps = 15/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------- 49
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   +   A              
Sbjct: 181 KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGTMPGAAPAAAAPPEAAEEDI 240

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDE 108
               E+T F V L        K+ +IKEV+     + L +AK+LVES P+ +K  ++K E
Sbjct: 241 PTQKEQTHFTVRLTEAKPTD-KVKLIKEVKNYIQGINLVQAKKLVESLPQEIKANVAKAE 299

Query: 109 ANEMKKKLEDAGATVEL 125
           A ++K  LE  G TV L
Sbjct: 300 AEKIKAALEAVGGTVVL 316


>gi|296203408|ref|XP_002748880.1| PREDICTED: mitochondrial dicarboxylate carrier-like [Callithrix
           jacchus]
          Length = 454

 Score =  104 bits (259), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 14/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA--PVSVVAPVAAEAGSAAS------- 53
            I+ +V+ ++SLTL+E ++L++ L+K   +      P+  V P A  A +A         
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMPGAVPAAAAQEVVEEEIP 122

Query: 54  ---EKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
              E+T F V L   +    K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 KLKEQTHFTVRLTEANPVD-KVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVELR 126
            ++K  LE     V+LR
Sbjct: 182 EKIKAALEATQQEVKLR 198


>gi|297815044|ref|XP_002875405.1| ribosomal protein L12-B [Arabidopsis lyrata subsp. lyrata]
 gi|297321243|gb|EFH51664.1| ribosomal protein L12-B [Arabidopsis lyrata subsp. lyrata]
          Length = 190

 Score =  103 bits (257), Expect = 8e-21,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 75/128 (58%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS-----ASAPVSVVAPVAAEAGSAASEKTE 57
            I+ I  ++SSLTL EA  L   ++ ++GVS      +A      P    A +A   +T+
Sbjct: 63  KIKKIGSEISSLTLEEARILVDYVQDKFGVSILFSAPAAAAFPPPPDNGGAAAAVERQTK 122

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV+        +IAVIK +RA+T L L E+KEL E  PK  K G++KDEA E KK+LE
Sbjct: 123 FDVVINDVLIG-NRIAVIKAIRAMTSLCLNESKELTEGFPKKFKEGVTKDEAEEAKKQLE 181

Query: 118 DAGATVEL 125
           +AGA V +
Sbjct: 182 EAGAKVSI 189


>gi|15232275|ref|NP_189422.1| RPL12-B (ribosomal protein l12-b); structural constituent of
           ribosome [Arabidopsis thaliana]
 gi|21431810|sp|P36211|RK122_ARATH RecName: Full=50S ribosomal protein L12-2, chloroplastic; AltName:
           Full=CL12-B; Flags: Precursor
 gi|11994489|dbj|BAB02530.1| 50S ribosomal protein L12-like [Arabidopsis thaliana]
          Length = 193

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 48/128 (37%), Positives = 72/128 (56%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS-----ASAPVSVVAPVAAEAGSAASEKTE 57
            I+ I  ++SSLTL E+  L   ++ ++GVS      +A           A ++   +T 
Sbjct: 66  KIKKIGSEISSLTLEESRILVDYVQDKFGVSILFSAPAAAALPPPLDNGGATASVERQTT 125

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV+        +IAVI  +RA+T L L E+KEL+E  PK  K G++KDEA E K +LE
Sbjct: 126 FDVVINDVPRG-NRIAVITAIRAMTSLSLSESKELIEGFPKKFKEGVTKDEAEEDKTQLE 184

Query: 118 DAGATVEL 125
           +AGA V +
Sbjct: 185 EAGAKVSI 192


>gi|158520718|ref|YP_001528588.1| ribosomal protein L7/L12 [Desulfococcus oleovorans Hxd3]
 gi|226733675|sp|A8ZV50|RL7_DESOH RecName: Full=50S ribosomal protein L7/L12
 gi|158509544|gb|ABW66511.1| ribosomal protein L7/L12 [Desulfococcus oleovorans Hxd3]
          Length = 128

 Score =  103 bits (256), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 89/128 (69%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I  + +++ ++++T++E +EL   LE+++GVSA+APV+++A      G A + + + 
Sbjct: 1   MADITKQDVIDFIANMTVLELSELITELEEKFGVSAAAPVAMMAGGMPAGGDAGAAEEKT 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +       KKI VIKEVRAIT LGLKEAK LVE APK +K G+ KDEA ++K +LE 
Sbjct: 61  EFDVVLLTSGDKKIQVIKEVRAITGLGLKEAKALVEEAPKPVKEGVPKDEAEKLKAQLEG 120

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 121 AGAQVEIK 128


>gi|548775|sp|P36247|RL7_LIBAS RecName: Full=50S ribosomal protein L7/L12
 gi|144459|gb|AAA23108.1| ribosomal protein L12 [Candidatus Liberibacter asiaticus]
 gi|739026|prf||2002224E ribosomal protein L12
          Length = 122

 Score =  102 bits (255), Expect = 1e-20,   Method: Composition-based stats.
 Identities = 122/122 (100%), Positives = 122/122 (100%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG
Sbjct: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120

Query: 121 AT 122
           AT
Sbjct: 121 AT 122


>gi|133085|sp|P02398|RK12_SPIOL RecName: Full=50S ribosomal protein L12, chloroplastic; AltName:
           Full=CL12; Flags: Precursor
 gi|170115|gb|AAA34031.1| ribosomal L12 precursor [Spinacia oleracea]
 gi|47154904|emb|CAA31551.1| SocL12 [Spinacia oleracea]
          Length = 189

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 79/127 (62%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEF 58
            IE +  +LS LTL EA  L   L+ + GVSA++     A  A  A + A     EKTEF
Sbjct: 63  KIEQLGTQLSGLTLEEARVLVDWLQDKLGVSAASFAPAAAVAAPGAPADAAPAVEEKTEF 122

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V +        +I+VIK VRA+T LGLKEAKEL+E  PK LK G+SKD+A + KK+LED
Sbjct: 123 DVSIDEVPSNA-RISVIKAVRALTSLGLKEAKELIEGLPKKLKEGVSKDDAEDAKKQLED 181

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 182 AGAKVSI 188


>gi|15232274|ref|NP_189421.1| RPL12-A (RIBOSOMAL PROTEIN L12-A); structural constituent of
           ribosome [Arabidopsis thaliana]
 gi|548653|sp|P36210|RK121_ARATH RecName: Full=50S ribosomal protein L12-1, chloroplastic; AltName:
           Full=CL12-A; Flags: Precursor
 gi|468771|emb|CAA48181.1| ribosomal protein L12 [Arabidopsis thaliana]
 gi|11994488|dbj|BAB02529.1| 50S ribosomal protein L12-like [Arabidopsis thaliana]
 gi|15450974|gb|AAK96758.1| 50s ribosomal protein L12-like [Arabidopsis thaliana]
 gi|15810119|gb|AAL07203.1| putative 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|22530940|gb|AAM96974.1| 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|23198422|gb|AAN15738.1| 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|29824165|gb|AAP04043.1| putative 50S ribosomal protein L12-A [Arabidopsis thaliana]
 gi|30102916|gb|AAP21376.1| At3g27830 [Arabidopsis thaliana]
          Length = 191

 Score =  102 bits (254), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 62/127 (48%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEF 58
            IE I  ++SSLTL EA  L   L+ ++GVS  +     A VAA A   A     E+TEF
Sbjct: 65  KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEF 124

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+
Sbjct: 125 DVVINEV-PSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEE 183

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 184 AGAKVSI 190


>gi|225431267|ref|XP_002275239.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 189

 Score =  101 bits (253), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 80/134 (59%), Gaps = 13/134 (9%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA------------GSA 51
           + SIV+++S LTL+E ++L++ L K+  ++    ++V+ P                    
Sbjct: 56  VSSIVDEISGLTLLEVSDLTELLRKKLDINEMPVMAVMMPGMGFGVRGAGGAAPKAAEVK 115

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           A+EKT F++ L+ FD    KI +IKEVR  TDLGLKEAK+LVE AP  LK G+ K+EA  
Sbjct: 116 AAEKTAFDLKLEAFDAAA-KIKIIKEVRTFTDLGLKEAKDLVEHAPTLLKKGVPKEEAEN 174

Query: 112 MKKKLEDAGATVEL 125
           + +K++  GA V +
Sbjct: 175 IIEKMKAVGAKVTM 188


>gi|304414673|ref|ZP_07395726.1| 50S ribosomal protein L7/L12 [Candidatus Regiella insecticola LSR1]
 gi|304283174|gb|EFL91583.1| 50S ribosomal protein L7/L12 [Candidatus Regiella insecticola LSR1]
          Length = 154

 Score =  101 bits (252), Expect = 3e-20,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +++LT++E  EL   +E+++GVSA+A V+      A   +   EKTEF+V+L  
Sbjct: 38  EQILEGVAALTVMEVVELIADMEEKFGVSAAAAVAA---GPAMTAAVVEEKTEFDVILTT 94

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR  T LGLK+AK+LVE APK++K G+SKD+A  +KKKLE+ GA+ E
Sbjct: 95  V--GANKIQVIKAVREATGLGLKDAKDLVEGAPKAVKEGISKDDAEALKKKLEETGASCE 152

Query: 125 LR 126
           L+
Sbjct: 153 LK 154


>gi|468772|emb|CAA48182.1| ribosomal protein L12 [Arabidopsis thaliana]
          Length = 193

 Score =  101 bits (251), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 71/128 (55%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS-----ASAPVSVVAPVAAEAGSAASEKTE 57
            I+ I  ++SSLTL E+  L   ++ ++GVS      +A           A ++   +T 
Sbjct: 66  KIKKIGSEISSLTLEESRILVDYVQDKFGVSILFSAPAAAALPPPLDNGGATASVERQTT 125

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV+        +IAVI  +RA+T L L E+KEL+E  PK  K G++KDEA E K +LE
Sbjct: 126 FDVVINDVPRG-NRIAVITAIRAMTSLSLSESKELIEGFPKKFKEGVTKDEAEEDKTQLE 184

Query: 118 DAGATVEL 125
           + GA V +
Sbjct: 185 EPGAKVSI 192


>gi|332185597|ref|ZP_08387345.1| ribosomal protein L7/L12 [Sphingomonas sp. S17]
 gi|332014575|gb|EGI56632.1| ribosomal protein L7/L12 [Sphingomonas sp. S17]
          Length = 124

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 75/126 (59%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ ++V++LS LT++EAAELSK LE++WGVSA+A V+        A  AA EKTEF+V
Sbjct: 1   MADLNALVDQLSELTVLEAAELSKMLEEKWGVSAAAAVAAAPAAGGAAAPAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGL EAK LVE APK +K G++KDEA ++KK+LE+AG
Sbjct: 61  ILTG--DGGKKINVIKEVRAITGLGLTEAKALVEGAPKPVKEGIAKDEAEKIKKQLEEAG 118

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 119 ATVELK 124


>gi|301059223|ref|ZP_07200160.1| ribosomal protein L7/L12 [delta proteobacterium NaphS2]
 gi|300446658|gb|EFK10486.1| ribosomal protein L7/L12 [delta proteobacterium NaphS2]
          Length = 127

 Score =  100 bits (249), Expect = 7e-20,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + +VE +S++T++E +E  K LE+++GVSA+APV++ A         A+E+TEF+VVL  
Sbjct: 8   DDVVEFISNMTVLELSEFVKELEEKFGVSAAAPVAMAAAAPGAPAEEAAEQTEFDVVLTA 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT LGLKEAK +V+ AP  +K G+ KDEA  +K +LE+AGATVE
Sbjct: 68  V--GDKKIQVIKVVRAITGLGLKEAKGVVDGAPGPVKEGIPKDEAEGIKTQLEEAGATVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|126308886|ref|XP_001379773.1| PREDICTED: similar to mitochondrial ribosomal protein L7/12
           [Monodelphis domestica]
          Length = 254

 Score =   99 bits (248), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-----------A 51
            I+ +V+ ++ LTL+E ++L++ L+K   +     V +   V + A              
Sbjct: 120 KIQQLVQDIAGLTLLEISDLNELLKKTLKIQDVGLVPMGGMVPSAATVAPEAAEEEEVPK 179

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEAN 110
             E+T F V L        K+ +IKEV+     + L +AK+LVES P+ +K  ++K EA 
Sbjct: 180 QKERTHFTVRLTEAKPVD-KVKLIKEVKNYIQGINLVQAKKLVESLPQEIKANVAKSEAE 238

Query: 111 EMKKKLEDAGATVEL 125
           ++K  LE AG TV L
Sbjct: 239 KIKVALEAAGGTVVL 253


>gi|284106475|ref|ZP_06386261.1| Ribosomal protein L10 [Candidatus Poribacteria sp. WGA-A3]
 gi|283830071|gb|EFC34342.1| Ribosomal protein L10 [Candidatus Poribacteria sp. WGA-A3]
          Length = 310

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 88/122 (72%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  + S+T++E +EL K  E+++GV+A+APV+V AP A +AG+ A+E+ +   V+  
Sbjct: 189 EDILGAVESMTVLELSELVKGFEEKFGVTAAAPVAVAAPAAGDAGAQAAEEKDAFDVVLA 248

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR IT LGLKEAK+LVE+APK +K G +KDEA  +KKKL D GATVE
Sbjct: 249 GVPADKKIQVIKVVREITGLGLKEAKDLVEAAPKPVKEGAAKDEAETIKKKLTDVGATVE 308

Query: 125 LR 126
           ++
Sbjct: 309 VK 310


>gi|297702041|ref|XP_002827998.1| PREDICTED: mitochondrial dicarboxylate carrier-like [Pongo abelii]
          Length = 442

 Score = 99.6 bits (247), Expect = 1e-19,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 68/137 (49%), Gaps = 14/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     V +   +                  
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMPGVVPAAAAQEAVEEDIP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 IAKERTHFTVRLTEAKPVD-KVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVELR 126
            ++K  LE     V+LR
Sbjct: 182 EKIKAALEATQQEVKLR 198


>gi|468773|emb|CAA48183.1| ribosomal protein L12 [Arabidopsis thaliana]
          Length = 187

 Score = 99.2 bits (246), Expect = 2e-19,   Method: Composition-based stats.
 Identities = 62/127 (48%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEF 58
            IE I  ++SSLTL EA  L   L+ ++GVS  +     A VAA A   A     E+TEF
Sbjct: 61  KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEF 120

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+
Sbjct: 121 DVVINEV-PSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEE 179

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 180 AGAKVSI 186


>gi|297815046|ref|XP_002875406.1| ribosomal protein L12-C [Arabidopsis lyrata subsp. lyrata]
 gi|297321244|gb|EFH51665.1| ribosomal protein L12-C [Arabidopsis lyrata subsp. lyrata]
          Length = 186

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 77/127 (60%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA----AEAGSAASEKTEF 58
            IE I  ++SSLTL EA  L   L+ ++GVS  +     A VA      A +   E+TEF
Sbjct: 60  KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPSDGGAAAVVEEQTEF 119

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+
Sbjct: 120 DVVINEV-PSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGVTKDEAEEAKKTLEE 178

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 179 AGAKVSI 185


>gi|304321429|ref|YP_003855072.1| 50S ribosomal protein L7/L12 [Parvularcula bermudensis HTCC2503]
 gi|303300331|gb|ADM09930.1| ribosomal protein L7/L12 [Parvularcula bermudensis HTCC2503]
          Length = 127

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 69/129 (53%), Positives = 88/129 (68%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA---AEAGSAASEKTE 57
           M++I+++ E++  LTL+EA EL   L+ E+G+  +    VV          G AA EKTE
Sbjct: 1   MADIKALAEQIVGLTLLEAKELQDLLKDEYGIEPATGGGVVMAGPVGGDGGGDAAEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L       KKI VIKEVR IT LGLKEAKELVE APK +K G+SKDEA E+KKKLE
Sbjct: 61  FDVILTS--AGDKKINVIKEVRGITGLGLKEAKELVEGAPKPVKEGVSKDEAEELKKKLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAGVELK 127


>gi|194386058|dbj|BAG59593.1| unnamed protein product [Homo sapiens]
          Length = 442

 Score = 98.4 bits (244), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 39/137 (28%), Positives = 69/137 (50%), Gaps = 14/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     V +   ++                 
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 IAKERTHFTVRLTEAKPVD-KVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVELR 126
            ++K  LE     V+LR
Sbjct: 182 EKIKAALEATQQEVKLR 198


>gi|15232276|ref|NP_189423.1| RPL12-C (ribosomal protein l12-c); structural constituent of
           ribosome [Arabidopsis thaliana]
 gi|21431811|sp|P36212|RK123_ARATH RecName: Full=50S ribosomal protein L12-3, chloroplastic; AltName:
           Full=CL12-C; Flags: Precursor
 gi|11994490|dbj|BAB02531.1| 50S ribosomal protein L12-like [Arabidopsis thaliana]
 gi|14335124|gb|AAK59841.1| AT3g27850/K16N12_7 [Arabidopsis thaliana]
 gi|22530924|gb|AAM96966.1| 50S ribosomal protein L12-C [Arabidopsis thaliana]
 gi|23506071|gb|AAN28895.1| At3g27850/K16N12_7 [Arabidopsis thaliana]
          Length = 187

 Score = 98.1 bits (243), Expect = 3e-19,   Method: Composition-based stats.
 Identities = 62/127 (48%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEF 58
            IE I  ++SSLTL EA  L   L+ ++GVS  +     A VAA A   A     E+TEF
Sbjct: 61  KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEF 120

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+
Sbjct: 121 DVVINEV-PSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEE 179

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 180 AGAKVSI 186


>gi|316978280|gb|EFV61287.1| ribosomal protein L7/L12 [Trichinella spiralis]
          Length = 273

 Score = 98.1 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 71/132 (53%), Gaps = 12/132 (9%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---------- 53
           +  +VEK+++L+L+E ++L++ L K   +  +  V     + + AG              
Sbjct: 64  VTELVEKIANLSLLEVSDLNRLLRKRLNLPDTPTVFPGMGMFSPAGEIGEMKKDEKKDVQ 123

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           +KT F + L  F D  KKIA+IKE++ +   L L +AK+ VE+ P+ +K  + + EA ++
Sbjct: 124 QKTSFTLRLVKF-DESKKIALIKEIKNVVPGLNLVQAKKYVETLPQIVKEDIGQTEAEKL 182

Query: 113 KKKLEDAGATVE 124
           K+++  AG    
Sbjct: 183 KEQITAAGGECS 194


>gi|148556378|ref|YP_001263960.1| 50S ribosomal protein L7/L12 [Sphingomonas wittichii RW1]
 gi|166222214|sp|A5VC06|RL7_SPHWW RecName: Full=50S ribosomal protein L7/L12
 gi|148501568|gb|ABQ69822.1| LSU ribosomal protein L12P [Sphingomonas wittichii RW1]
          Length = 126

 Score = 98.1 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 70/126 (55%), Positives = 96/126 (76%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ +V+ LS+LT++EAAELSK LE++WGVSA+A V+V AP       A + + + E 
Sbjct: 1   MADLQKLVDDLSALTVLEAAELSKLLEEKWGVSAAAAVAVAAPAGGAGAGAPAAEVKDEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +    D  KKI VIKEVRAIT LGL EAK LVESAPK++K G++KDEA ++KK+LE+AG
Sbjct: 61  DVILTGDGGKKINVIKEVRAITGLGLTEAKTLVESAPKAVKEGVNKDEAEKLKKQLEEAG 120

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 121 ATVELK 126


>gi|71361655|ref|NP_001025071.1| 39S ribosomal protein L12, mitochondrial [Rattus norvegicus]
          Length = 276

 Score = 98.1 bits (243), Expect = 4e-19,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------- 49
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V                  
Sbjct: 139 KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAVPAAAPAPEAAEEED 198

Query: 50  -SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKD 107
                E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K 
Sbjct: 199 LPKQKEQTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKA 257

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++K  LE  G TV L
Sbjct: 258 EAEKIKAALEAVGGTVVL 275


>gi|325192001|emb|CCA26468.1| mitochondrial inner membrane protease ATP23 putativ [Albugo
           laibachii Nc14]
          Length = 393

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 50/131 (38%), Positives = 71/131 (54%), Gaps = 10/131 (7%)

Query: 1   MS---NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPV------AAEAGSA 51
           M+   N+E+ +  +  L ++E AELS+ ++K++ +                   A   + 
Sbjct: 43  MALSPNVETALNYILELNMLEIAELSRAVQKQFDLPEPTLGMGGGSNTGGNTEGAATQAK 102

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
              KT F+V L  F D K KI VIKEVR+IT LGLKEAKELVE AP  +K  + K+EA  
Sbjct: 103 EEVKTAFDVKLVSF-DAKMKIKVIKEVRSITGLGLKEAKELVEGAPNVIKKDVKKEEAEV 161

Query: 112 MKKKLEDAGAT 122
           +  KL + GA 
Sbjct: 162 LIAKLSELGAV 172


>gi|255560996|ref|XP_002521510.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
 gi|223539188|gb|EEF40781.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
          Length = 192

 Score = 97.7 bits (242), Expect = 5e-19,   Method: Composition-based stats.
 Identities = 52/138 (37%), Positives = 81/138 (58%), Gaps = 16/138 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------- 49
            + ++V+++S LTL+E ++L++ L  +  +     ++V+ P    +G             
Sbjct: 55  KVAALVDEISELTLLEISDLTEVLRNKLDIKEMPVMAVMMPGMGFSGMKGGVKGGAAGAA 114

Query: 50  --SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
                 EKT F+V L+GFD    KI VIKEVR  TDLGLKEAK+LVE AP  LK G++K+
Sbjct: 115 KAEEKVEKTVFDVKLEGFDAAA-KIKVIKEVRGFTDLGLKEAKDLVEKAPTLLKKGVTKE 173

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++  K+++ GA V +
Sbjct: 174 EAEKITAKMKEVGAKVSM 191


>gi|294012920|ref|YP_003546380.1| ribosomal protein L7/L12 [Sphingobium japonicum UT26S]
 gi|292676250|dbj|BAI97768.1| ribosomal protein L7/L12 [Sphingobium japonicum UT26S]
          Length = 126

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 99/126 (78%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I ++V++LS+LT++EAAELSK LE++WGVSA+A V+V AP    AG+A +E+ + E 
Sbjct: 1   MADINALVDQLSALTVLEAAELSKALEEKWGVSAAAAVAVAAPAGGGAGAAPAEEAKDEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +    D  KKI VIKEVRAIT LGL EAK LVE APK++K G+ KDEA ++KK+LE+AG
Sbjct: 61  DVVLTGDGGKKINVIKEVRAITGLGLTEAKALVEGAPKAVKEGVGKDEAEKIKKQLEEAG 120

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 121 ATVELK 126


>gi|21592776|gb|AAM64725.1| 50S ribosomal protein L12-C [Arabidopsis thaliana]
          Length = 187

 Score = 97.3 bits (241), Expect = 6e-19,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEF 58
            IE I  ++SSLTL EA  L   L+ ++GVS  +     A VAA A   A     E+T+F
Sbjct: 61  KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTKF 120

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+
Sbjct: 121 DVVINEV-PSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGITKDEAEEAKKTLEE 179

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 180 AGAKVSI 186


>gi|307293949|ref|ZP_07573793.1| ribosomal protein L7/L12 [Sphingobium chlorophenolicum L-1]
 gi|306880100|gb|EFN11317.1| ribosomal protein L7/L12 [Sphingobium chlorophenolicum L-1]
          Length = 126

 Score = 96.9 bits (240), Expect = 8e-19,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 99/126 (78%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I ++V++LS+LT++EAAELSK LE++WGVSA+A V+V AP    AG+A +E+ + E 
Sbjct: 1   MADINALVDQLSALTVLEAAELSKALEEKWGVSAAAAVAVAAPAGGAAGAAPAEEAKDEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +    D  KKI VIKEVRAIT LGL EAK LVE APK++K G+ KDEA ++KK+LE+AG
Sbjct: 61  DVVLTGDGGKKINVIKEVRAITGLGLTEAKALVEGAPKAVKEGVGKDEAEKLKKQLEEAG 120

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 121 ATVELK 126


>gi|215400736|ref|YP_002327497.1| ribosomal protein L12 [Vaucheria litorea]
 gi|194441186|gb|ACF70914.1| ribosomal protein L12 [Vaucheria litorea]
          Length = 128

 Score = 96.9 bits (240), Expect = 9e-19,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV--APVAAEAGSAASEKTEFEV 60
            I++I+E+L  L+LIEA+EL K++E+ +GV AS+  +++  +PV     +   EKT F++
Sbjct: 4   KIDNIIEELKVLSLIEASELVKQIEETFGVDASSSGAMMISSPVGNIGEAPLEEKTAFDI 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+      KKI+++K VR+IT LGLKEAK+LVE+ PK +K G+SK E+ E+KK+LE+AG
Sbjct: 64  ILETV-PADKKISILKIVRSITGLGLKEAKDLVETVPKLIKEGISKSESEELKKQLEEAG 122

Query: 121 ATVELR 126
           A V L+
Sbjct: 123 AKVILK 128


>gi|148745298|gb|AAI42006.1| MRPL12 protein [Bos taurus]
          Length = 226

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 14/134 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V   A              
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAAPAPTAPEAAEEDVP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
              E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 KQKERTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATV 123
            ++K  LE  G TV
Sbjct: 182 EKIKAALEAVGGTV 195


>gi|312115366|ref|YP_004012962.1| ribosomal protein L7/L12 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220495|gb|ADP71863.1| ribosomal protein L7/L12 [Rhodomicrobium vannielii ATCC 17100]
          Length = 127

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 85/124 (68%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
             E + ++LS LT++E +EL K LE +WGVSA+A   V A     A +AA E+ + E  +
Sbjct: 4   KFEKLYQELSGLTVLEISELVKLLEDKWGVSAAAAAPVFAGPIPGAAAAAEEEEKTEFDV 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +   +KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA E+KKK+E AGA 
Sbjct: 64  ILTEAGAQKINVIKEVRAITGLGLKEAKDLVEGAPKAIKEAVSKTEAEEIKKKIEAAGAK 123

Query: 123 VELR 126
           V+++
Sbjct: 124 VDIK 127


>gi|85706809|ref|ZP_01037900.1| ribosomal protein L7/L12 [Roseovarius sp. 217]
 gi|85668602|gb|EAQ23472.1| ribosomal protein L7/L12 [Roseovarius sp. 217]
          Length = 126

 Score = 96.5 bits (239), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A     +  + + E 
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGDAGGSDAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIKEVRAIT LGLKEAK+LV++  K++K  +SKDEA+++K KLE AG
Sbjct: 61  DVILKSAGASKINVIKEVRAITGLGLKEAKDLVDAGGKAVKEQVSKDEADDIKAKLEAAG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AEVEIK 126


>gi|149203669|ref|ZP_01880638.1| ribosomal protein L7/L12 [Roseovarius sp. TM1035]
 gi|149142786|gb|EDM30828.1| ribosomal protein L7/L12 [Roseovarius sp. TM1035]
          Length = 126

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 51/126 (40%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +++    A     +  + + E 
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAIMMAGPAGDAGGSDAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIKEVRAIT LGLKEAK+LV++  K++K  +SKDEA+++K KLE AG
Sbjct: 61  DVILKSAGASKINVIKEVRAITGLGLKEAKDLVDAGGKAVKEQVSKDEADDIKAKLEAAG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AEVEIK 126


>gi|324521317|gb|ADY47826.1| 39S ribosomal protein L12 [Ascaris suum]
          Length = 204

 Score = 96.1 bits (238), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 68/136 (50%), Gaps = 13/136 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            ++ +VE++ SL+L++ A+L+K L+K   +  +  +     VA     A           
Sbjct: 68  KVQRLVEEIVSLSLLDVADLNKALKKRLNLPDAPMMVAAPAVAGSPAPATAASTEAASEA 127

Query: 53  ---SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
               +K  F V L  FDD KK   + +   AI+ L L +AK+ V+SAP  +K  L K EA
Sbjct: 128 QDVPQKMTFSVKLTKFDDSKKIALIKEIRNAISGLNLVQAKKFVDSAPAVVKEDLGKTEA 187

Query: 110 NEMKKKLEDAGATVEL 125
            E+K  LE AG   E+
Sbjct: 188 EELKAALEKAGGICEI 203


>gi|258513631|ref|YP_003189853.1| 50S ribosomal protein L7/L12 [Desulfotomaculum acetoxidans DSM 771]
 gi|257777336|gb|ACV61230.1| ribosomal protein L7/L12 [Desulfotomaculum acetoxidans DSM 771]
          Length = 126

 Score = 96.1 bits (238), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 85/126 (67%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS I  I+E +  LT++E +EL K  E+E+GV+A+APV V+A   A   +AA  + + E 
Sbjct: 1   MSKINEILEAVKGLTVLELSELVKAFEEEFGVTAAAPVGVMAAAPAAGAAAAEVEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIK VR IT LGLKEAKE+V++APK +K  +SK+EA  MK KL +AG
Sbjct: 61  DVILTSVGDKKINVIKVVREITGLGLKEAKEVVDNAPKPIKEKVSKEEAESMKAKLVEAG 120

Query: 121 ATVELR 126
           A+VE++
Sbjct: 121 ASVEIK 126


>gi|147858132|emb|CAN83934.1| hypothetical protein VITISV_035768 [Vitis vinifera]
          Length = 615

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 53/132 (40%), Positives = 75/132 (56%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA---------GSAAS 53
            +E I ++L  LT +E  + S     + G++   P       A  A          + A+
Sbjct: 484 KLERIADELLDLTKLERYDYSILFRLKLGLNKYGPAVSGLASADSASAGSGSAPADAKAA 543

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F++ L+ FD    KI +IKEVR  TDLGLKEAK+LVE AP  LK G++K+E N + 
Sbjct: 544 EKTAFDIKLEKFDAAA-KIKIIKEVRTFTDLGLKEAKDLVEKAPVVLKKGVTKEEGNPIV 602

Query: 114 KKLEDAGATVEL 125
           +KL++ GATV L
Sbjct: 603 EKLKELGATVVL 614


>gi|48474735|sp|Q8KTP9|RL7_TREPR RecName: Full=50S ribosomal protein L7/L12
 gi|21702603|gb|AAM75999.1|AF481103_9 ribosomal protein L7/L12 [Candidatus Tremblaya princeps]
          Length = 121

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 76/126 (60%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSN + IV +++S+T +E ++L   LE+ + +S  AP    AP    + +  +E+   + 
Sbjct: 1   MSN-DDIVSRIASMTALELSDLVGLLEQRFNISRIAP----APCQPGSNAVEAEQDRRDR 55

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KIAVI+ VR +T LGLKE+K LV+SAP  +  GLS DEA +++ K+E AG
Sbjct: 56  KVFLTHSGSNKIAVIRAVRDVTKLGLKESKGLVDSAPSLVAEGLSADEAEDIRAKVEAAG 115

Query: 121 ATVELR 126
           A  E+R
Sbjct: 116 AKAEVR 121


>gi|90417771|ref|ZP_01225683.1| ribosomal protein L7/L12 [Aurantimonas manganoxydans SI85-9A1]
 gi|90337443|gb|EAS51094.1| ribosomal protein L7/L12 [Aurantimonas manganoxydans SI85-9A1]
          Length = 124

 Score = 95.7 bits (237), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 96/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A        AA E+TEF V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAGGGAPAEAAEEQTEFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       +KI VIKEVRAIT LGLKEAK+LV++APK +K G+ K EA+++K +LE AG
Sbjct: 61  ILAS--AGAQKINVIKEVRAITGLGLKEAKDLVDNAPKPVKEGVDKAEADKIKDQLEKAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|295694827|ref|YP_003588065.1| ribosomal protein L7/L12 [Bacillus tusciae DSM 2912]
 gi|295410429|gb|ADG04921.1| ribosomal protein L7/L12 [Bacillus tusciae DSM 2912]
          Length = 123

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  ++++E  +L K +E+E+GV+A+APV+V+   A  A  A  E+TEF+V+L  
Sbjct: 4   EDIIAAIKGMSVLELNDLVKAIEEEFGVTAAAPVAVMGGAAGGAAEAVEEQTEFDVILTA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAK+LV++APK +K  +SK+EA  +KKKLEDAGA+VE
Sbjct: 64  --PGGSKINVIKVVREITGLGLKEAKDLVDNAPKPVKEKVSKEEAETVKKKLEDAGASVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|242807535|ref|XP_002484976.1| 50S ribosomal protein L12 [Talaromyces stipitatus ATCC 10500]
 gi|218715601|gb|EED15023.1| 50S ribosomal protein L12 [Talaromyces stipitatus ATCC 10500]
          Length = 200

 Score = 95.4 bits (236), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 64/136 (47%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            I  IV+++S LTL+E A+L   L+    +                 +  +         
Sbjct: 65  KIVQIVDQISQLTLLETADLVASLKSRLNIPDLPVGGFAVAAGPGGAAGGAAAAEEEEAA 124

Query: 55  -----KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
                KT F + L+ F D   K  VIKE++++  L L ++K+ VES PK LK  ++KDE 
Sbjct: 125 PAAAEKTLFNLKLESF-DAASKPKVIKEIKSMLGLSLVDSKKFVESVPKVLKENVAKDEC 183

Query: 110 NEMKKKLEDAGATVEL 125
            ++ + L+  GA V +
Sbjct: 184 EKIIETLKGLGAKVVM 199


>gi|189485076|ref|YP_001956017.1| 50S ribosomal protein L7/L12 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
 gi|226734490|sp|B1GZ74|RL7_UNCTG RecName: Full=50S ribosomal protein L7/L12
 gi|170287035|dbj|BAG13556.1| 50S ribosomal protein L7/L12 [uncultured Termite group 1 bacterium
           phylotype Rs-D17]
          Length = 125

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +SS+++IE +EL K LE+++GVSA+AP   V         A  EKTEF V+L  
Sbjct: 7   DQLIESISSMSVIELSELVKALEEKFGVSAAAPAPAVV-AGTSPAVATEEKTEFNVILGS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR +T LGLKEAK+LV+ APK++K  ++K EA E+KKK  + GATVE
Sbjct: 66  V--GTSKINVIKVVREVTGLGLKEAKDLVDGAPKTVKENVAKAEAEEIKKKFTEVGATVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|153005083|ref|YP_001379408.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. Fw109-5]
 gi|166222132|sp|A7HCH8|RL7_ANADF RecName: Full=50S ribosomal protein L7/L12
 gi|152028656|gb|ABS26424.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. Fw109-5]
          Length = 125

 Score = 95.4 bits (236), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-AASEKTEFE 59
           M+++ +IV++LS LT++EAA+L K+LE++WGVSA+APV V       A +    EKTEF 
Sbjct: 1   MADLNTIVDQLSGLTVMEAADLVKKLEEKWGVSAAAPVMVAGGAGGAAAAAPVEEKTEFN 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE APK +K G+ K EA+E+KKKLE A
Sbjct: 61  VVLA--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKEVKVGIPKAEADELKKKLEAA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEIK 125


>gi|293331099|ref|NP_001168838.1| hypothetical protein LOC100382643 [Zea mays]
 gi|223973291|gb|ACN30833.1| unknown [Zea mays]
          Length = 185

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---------AS 53
            I  IV+++S LTL+E A+L   L+    +            A  A +A           
Sbjct: 54  KITQIVDQISQLTLLETADLVSTLKTRLNIPDLPVGGFAMGAAPAAPAAAEEEEAAPAQQ 113

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F + L+   D   K  VIKE++ +  L L ++K+ VES PK LK  + K+EA ++ 
Sbjct: 114 EKTLFNLKLESV-DASSKAKVIKEIKTLLGLSLVDSKKFVESVPKVLKESVPKEEAEKIV 172

Query: 114 KKLEDAGATVEL 125
           + L+  GA   +
Sbjct: 173 ETLKAVGAKATM 184


>gi|194246781|ref|YP_002004420.1| 50S ribosomal protein L7/L12 [Candidatus Phytoplasma mali]
 gi|254806389|sp|B3QZG9|RL7_PHYMT RecName: Full=50S ribosomal protein L7/L12
 gi|193807138|emb|CAP18576.1| 50S ribosomal protein L7/L12 [Candidatus Phytoplasma mali]
          Length = 127

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 71/128 (55%), Gaps = 3/128 (2%)

Query: 1   MSNIES--IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     ++ L  ++L+E  EL   L++E+G+  +A   V             EKTEF
Sbjct: 1   MAKLTKKNFIDSLREMSLLEVKELVDGLKEEFGIDPNALF-VSGSNQDNNKIQVEEKTEF 59

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V++K F D   KI +IK V+ IT  GL + ++L+ +    ++  +SK++A E+K KLE 
Sbjct: 60  SVIVKDFGDSSNKIPIIKTVKEITGFGLYDIQKLLNTPDAVIQEKISKEKAEEIKNKLEL 119

Query: 119 AGATVELR 126
            GA VE++
Sbjct: 120 IGAVVEIQ 127


>gi|114704475|ref|ZP_01437383.1| 50S ribosomal protein L7/L12 [Fulvimarina pelagi HTCC2506]
 gi|114539260|gb|EAU42380.1| 50S ribosomal protein L7/L12 [Fulvimarina pelagi HTCC2506]
          Length = 126

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 95/126 (75%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V     A  G+A +E+ + E 
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAGAAGAAGGAAEAEEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +    KI VIKEVR +T LGLKEAK+LV++APK +K G+ KDEAN++K++LE AG
Sbjct: 61  TVVLAEAGSSKINVIKEVRGLTGLGLKEAKDLVDNAPKPIKEGVDKDEANKIKEQLEKAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|302036656|ref|YP_003796978.1| fused 50S ribosomal proteins L10 and L7/L12 [Candidatus Nitrospira
           defluvii]
 gi|300604720|emb|CBK41052.1| Fused 50S ribosomal proteins L10 and L7/L12 (modular protein)
           [Candidatus Nitrospira defluvii]
          Length = 311

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 83/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + +++ +  ++++E A+L K LE  +GV+A+APV+V A     A +A +E+     V+  
Sbjct: 190 DELIKAIEGMSVLELADLVKGLETRFGVTAAAPVAVAAVGGGGAAAAPAEEKTAFDVILV 249

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR +T LGLKEAK+LVE APK +K G +K+EA+ MKKKLE++GA VE
Sbjct: 250 SAPADKKIQVIKVVRELTSLGLKEAKDLVEGAPKPIKAGATKEEADTMKKKLEESGAKVE 309

Query: 125 LR 126
           ++
Sbjct: 310 VK 311


>gi|225452430|ref|XP_002277258.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 184

 Score = 95.0 bits (235), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA----GSAASEKTEF 58
            IE I  +LS+LTL EA  L   L+ + GVSA+A       VA  A     +   EKTEF
Sbjct: 58  KIEKIGTELSNLTLEEARILVDWLQDKLGVSAAAFAPAAVAVAPGAVADAPAVVEEKTEF 117

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+++       +IA IK VRA+T L LKEAKEL+E  PK  K G+SK+EA E KK+LE+
Sbjct: 118 DVMIEDVPSNA-RIATIKAVRALTSLALKEAKELIEGLPKKFKEGVSKEEAEEAKKQLEE 176

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 177 AGAKVAI 183


>gi|152990016|ref|YP_001355738.1| 50S ribosomal protein L7/L12 [Nitratiruptor sp. SB155-2]
 gi|166222185|sp|A6Q1M2|RL7_NITSB RecName: Full=50S ribosomal protein L7/L12
 gi|151421877|dbj|BAF69381.1| 50S ribosomal protein L7/L12 [Nitratiruptor sp. SB155-2]
          Length = 127

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 52/122 (42%), Positives = 78/122 (63%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA   V   A  A  A   A+ + + E  +  
Sbjct: 6   EDVIEYISNLSVLELSELVKEFEEKFGVSAQPTVVAGAVAAGGAEGGAAAEEKTEFDVVL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI  IK +R +T LGLKEAKE  E+ P  +K G+SK+EA E+KK+ E+AGA VE
Sbjct: 66  TDAGPKKINTIKVIRQVTGLGLKEAKEAAENTPTVIKEGVSKEEAEELKKQFEEAGAKVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|330914638|ref|XP_003296718.1| hypothetical protein PTT_06896 [Pyrenophora teres f. teres 0-1]
 gi|311330993|gb|EFQ95174.1| hypothetical protein PTT_06896 [Pyrenophora teres f. teres 0-1]
          Length = 195

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------------VVAPVAAEAG 49
            I +IV+++S LTL+E A+L   L+    +                           EA 
Sbjct: 48  KIATIVDQISQLTLLETADLVSTLKTRLNIPDMPMGGFAAGPGGAGPAAAAAPVEEEEAA 107

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            AA+EKT F + L+ FD    K  VIKE++A+  L L ++K+ VESAPK +K G+ K+EA
Sbjct: 108 PAAAEKTLFNLKLEKFDAGA-KPKVIKEIKAMLGLSLVDSKKFVESAPKLMKEGVPKEEA 166

Query: 110 NEMKKKLEDAGATVEL 125
            ++ + L+  GATV +
Sbjct: 167 EKIVETLKALGATVIM 182


>gi|258542020|ref|YP_003187453.1| 50S ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-01]
 gi|256633098|dbj|BAH99073.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636155|dbj|BAI02124.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639210|dbj|BAI05172.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-07]
 gi|256642264|dbj|BAI08219.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-22]
 gi|256645319|dbj|BAI11267.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-26]
 gi|256648374|dbj|BAI14315.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-32]
 gi|256651427|dbj|BAI17361.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO
           3283-01-42C]
 gi|256654418|dbj|BAI20345.1| LSU ribosomal protein L12P [Acetobacter pasteurianus IFO 3283-12]
          Length = 124

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 75/126 (59%), Positives = 99/126 (78%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A EKTEF V
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPGAAAAPAEEKTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA+++KK LE AG
Sbjct: 61  VLAS--AGDKKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVSKDEADKIKKALEGAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|329114223|ref|ZP_08242985.1| 50S ribosomal protein L7/L12 [Acetobacter pomorum DM001]
 gi|326696299|gb|EGE47978.1| 50S ribosomal protein L7/L12 [Acetobacter pomorum DM001]
          Length = 124

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A EKTEF V
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPGAAAAPAEEKTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA+++KK LEDAG
Sbjct: 61  VLAS--AGDKKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVSKDEADKIKKALEDAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|145258557|ref|XP_001402094.1| 54S ribosomal protein L12 [Aspergillus niger CBS 513.88]
 gi|134074701|emb|CAK44733.1| unnamed protein product [Aspergillus niger]
          Length = 185

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 41/132 (31%), Positives = 64/132 (48%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---------AS 53
            I  IV+++S LTL+E A+L   L+    +            A  A +A           
Sbjct: 54  KITQIVDQISQLTLLETADLVSTLKTRLNIPDLPVGGFAVGAAPAAPAAAEEEEAAPAQQ 113

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F + L+   D   K  VIKE++ +  L L ++K+ VES PK LK  + K+EA ++ 
Sbjct: 114 EKTLFNLKLESV-DASSKAKVIKEIKTLLGLSLVDSKKFVESVPKVLKESVPKEEAEKIV 172

Query: 114 KKLEDAGATVEL 125
           + L+  GA   +
Sbjct: 173 ETLKAVGAKATM 184


>gi|154174384|ref|YP_001408642.1| 50S ribosomal protein L7/L12 [Campylobacter curvus 525.92]
 gi|166222150|sp|A7GZK0|RL7_CAMC5 RecName: Full=50S ribosomal protein L7/L12
 gi|112803920|gb|EAU01264.1| ribosomal protein L7/L12 [Campylobacter curvus 525.92]
          Length = 125

 Score = 94.6 bits (234), Expect = 4e-18,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +     VA  A  AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAVAGGAAEAAEEKTEFNLVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 64  VDSGDKKINVIKVVRALTGLGLKEAKDAVEGTPSVLKEGISKDEAEAAKKELEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|148560420|ref|YP_001259163.1| 50S ribosomal protein L7/L12 [Brucella ovis ATCC 25840]
 gi|166222141|sp|A5VR16|RL7_BRUO2 RecName: Full=50S ribosomal protein L7/L12
 gi|148371677|gb|ABQ61656.1| ribosomal protein L7/L12 [Brucella ovis ATCC 25840]
          Length = 124

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 78/126 (61%), Positives = 99/126 (78%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRA+T LGLKEAK+LVE APK++K G+SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRALTGLGLKEAKDLVEGAPKAVKEGVSKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|319899057|ref|YP_004159150.1| 50S ribosomal protein L7/L12 [Bartonella clarridgeiae 73]
 gi|319403021|emb|CBI76576.1| 50S ribosomal protein L7/L12 [Bartonella clarridgeiae 73]
          Length = 122

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 98/126 (77%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V     + A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKWGVSAAAPVAVA--AVSAAAPAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G+SKDEA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGISKDEAEKIKTQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|297815042|ref|XP_002875404.1| ribosomal protein L12-A [Arabidopsis lyrata subsp. lyrata]
 gi|297321242|gb|EFH51663.1| ribosomal protein L12-A [Arabidopsis lyrata subsp. lyrata]
          Length = 184

 Score = 94.2 bits (233), Expect = 5e-18,   Method: Composition-based stats.
 Identities = 59/121 (48%), Positives = 74/121 (61%), Gaps = 5/121 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEF 58
            IE I  ++SSLTL EA  L   L+ ++GVS  +     A VAA A   A     E+TEF
Sbjct: 65  KIEKIGSEISSLTLEEARILVDYLQDKFGVSPLSLAPAAAAVAAPADGGAAAVVEEQTEF 124

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IAVIK VRA+T L LKEAKEL+E  PK  K G++KDEA E KK LE+
Sbjct: 125 DVVINEV-PSSSRIAVIKAVRALTSLALKEAKELIEGLPKKFKEGVTKDEAEEAKKTLEE 183

Query: 119 A 119
           A
Sbjct: 184 A 184


>gi|157165629|ref|YP_001466544.1| 50S ribosomal protein L7/L12 [Campylobacter concisus 13826]
 gi|166222149|sp|A7ZCN6|RL7_CAMC1 RecName: Full=50S ribosomal protein L7/L12
 gi|112800033|gb|EAT97377.1| ribosomal protein L7/L12 [Campylobacter concisus 13826]
          Length = 125

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +     VAA   +AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAVAAGGAAAAEEKTEFNIVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 64  VDSGDKKINVIKVVRALTGLGLKEAKDAVEGTPSVLKEGVSKDEAEAAKKELEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|255585457|ref|XP_002533422.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
 gi|223526735|gb|EEF28965.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
          Length = 301

 Score = 94.2 bits (233), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 54/133 (40%), Positives = 79/133 (59%), Gaps = 14/133 (10%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV-------------VAPVAAEAGSAA 52
            +V++++ LTL+E AELS  + K+ G++    V V              AP AA      
Sbjct: 169 KLVDEVAGLTLVEVAELSSIIMKKRGMTELPTVGVLKGGAAGLAGMAMKAPAAAAKEEKK 228

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT FE+ L+ ++    KI +IKEVR+ TDLGLKEAK+LVE  P  LK G+SK+EA ++
Sbjct: 229 PEKTVFELKLESYEA-ASKIKIIKEVRSFTDLGLKEAKDLVEKTPSILKAGVSKEEAEQI 287

Query: 113 KKKLEDAGATVEL 125
            +K++  GA V +
Sbjct: 288 IEKMKAVGAKVVM 300


>gi|297798266|ref|XP_002867017.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312853|gb|EFH43276.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 179

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 83/136 (61%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE----- 57
           N+  IV +LS+LTL+E  +L++ L ++  +S    ++ + P  +  GS A + T      
Sbjct: 44  NVSKIVNELSNLTLLETMDLTEILRQKLDISELPVMAAMMPGMSFPGSGAGKSTGGEGKE 103

Query: 58  --------FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
                   F+V+L+ ++    KI VIKEVR ITDLGLKEAK+LVE AP  LK G+SK+EA
Sbjct: 104 KKKEAKTAFDVMLQAYEAVS-KIKVIKEVRTITDLGLKEAKDLVEKAPTLLKKGVSKEEA 162

Query: 110 NEMKKKLEDAGATVEL 125
            ++ +KL+  GA V +
Sbjct: 163 EKIIEKLKAVGAKVAM 178


>gi|255322045|ref|ZP_05363193.1| ribosomal protein L7/L12 [Campylobacter showae RM3277]
 gi|255300858|gb|EET80127.1| ribosomal protein L7/L12 [Campylobacter showae RM3277]
          Length = 125

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A  AA EKTEF VVL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGAADAAEEKTEFNVVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  +K G+SKDEA   KK+LE+AGA VE
Sbjct: 64  VDGGDKKINVIKVVRALTGLGLKEAKDAVEQTPSVIKEGVSKDEAEAAKKELEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|289546830|gb|ADD10123.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           solanacearum]
          Length = 127

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 90/126 (71%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 4   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATESV-AVAEKTEFDV 62

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 63  VLTGFNATS-KINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 121

Query: 121 ATVELR 126
           AT+++R
Sbjct: 122 ATIDIR 127


>gi|296315355|ref|ZP_06865296.1| ribosomal protein L7/L12 [Neisseria polysaccharea ATCC 43768]
 gi|296837684|gb|EFH21622.1| ribosomal protein L7/L12 [Neisseria polysaccharea ATCC 43768]
          Length = 122

 Score = 93.8 bits (232), Expect = 6e-18,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 87/122 (71%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++GVSA+   +V    +    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKFGVSAA---AVAVTGSVGPAAAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 63  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|83815730|ref|YP_445877.1| ribosomal protein L7/L12 [Salinibacter ruber DSM 13855]
 gi|294507787|ref|YP_003571845.1| Ribosomal protein L7/L12 [Salinibacter ruber M8]
 gi|109893799|sp|Q2S1Q4|RL7_SALRD RecName: Full=50S ribosomal protein L7/L12
 gi|83757124|gb|ABC45237.1| ribosomal protein L7/L12 [Salinibacter ruber DSM 13855]
 gi|294344115|emb|CBH24893.1| Ribosomal protein L7/L12 [Salinibacter ruber M8]
          Length = 127

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 55/129 (42%), Positives = 82/129 (63%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           M++IE + E+L  LT+ EA EL+  LE+E+ +  ++    VA          +E   +T 
Sbjct: 1   MADIEELAEQLVGLTIQEANELANHLEEEYDIQPASAGVAVAADGGGGADGDAEEEEQTA 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL G      KI VIKEVR+IT +GLKEAK LV+ AP  +  G+S++EA+++K ++E
Sbjct: 61  FDVVLTGI--GGNKIQVIKEVRSITGMGLKEAKSLVDEAPNPVSEGVSREEADDLKAQIE 118

Query: 118 DAGATVELR 126
           DAG  VEL+
Sbjct: 119 DAGGEVELQ 127


>gi|153009276|ref|YP_001370491.1| 50S ribosomal protein L7/L12 [Ochrobactrum anthropi ATCC 49188]
 gi|166222187|sp|A6X0A8|RL7_OCHA4 RecName: Full=50S ribosomal protein L7/L12
 gi|151561164|gb|ABS14662.1| ribosomal protein L7/L12 [Ochrobactrum anthropi ATCC 49188]
          Length = 124

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 78/126 (61%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IV+ LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|90994530|ref|YP_537020.1| ribosomal protein L12 [Porphyra yezoensis]
 gi|122232138|sp|Q1XDE8|RK12_PORYE RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|90819094|dbj|BAE92463.1| 50S ribosomal protein L12 [Porphyra yezoensis]
          Length = 129

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 68/128 (53%), Positives = 91/128 (71%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           + +E+I+E+L SL L+EAAEL   +E+ + V ASA    + +  P +A A +   EKTEF
Sbjct: 3   TKVENILEELKSLNLLEAAELVNTIEETFDVDASAASGGMMMATPTSAPASAEVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+    PK KI+V+K VR +T LGLKEAK+LVES PK LK G SKD+A  MKK+LED
Sbjct: 63  DVVLEEVPAPK-KISVLKVVRPLTGLGLKEAKDLVESTPKVLKEGASKDDAETMKKQLED 121

Query: 119 AGATVELR 126
           AGATV ++
Sbjct: 122 AGATVIVK 129


>gi|302344364|ref|YP_003808893.1| ribosomal protein L7/L12 [Desulfarculus baarsii DSM 2075]
 gi|301640977|gb|ADK86299.1| ribosomal protein L7/L12 [Desulfarculus baarsii DSM 2075]
          Length = 126

 Score = 93.8 bits (232), Expect = 7e-18,   Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I    ++E L ++T++E +EL K LE  +GVSA+AP++V A   A A +   EKTEF
Sbjct: 1   MADITKNDVIEFLKNMTVLELSELIKELEDVFGVSAAAPMAVAAAAPAAAEAVEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+      KKI VIK VRAIT LGLKEAK+LV+ APK +K  + KDEA  +K +LE+
Sbjct: 61  DVILE--TAGDKKIQVIKVVRAITGLGLKEAKDLVDGAPKPVKEAVPKDEAESIKAQLEE 118

Query: 119 AGATVELR 126
           AGA V+++
Sbjct: 119 AGAVVQVK 126


>gi|316933511|ref|YP_004108493.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris DX-1]
 gi|315601225|gb|ADU43760.1| ribosomal protein L7/L12 [Rhodopseudomonas palustris DX-1]
          Length = 124

 Score = 93.4 bits (231), Expect = 8e-18,   Method: Composition-based stats.
 Identities = 75/126 (59%), Positives = 97/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A  A  A + A EKT+F V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAAPAGGAAAPAEEKTDFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKEVRAIT LGLKEAK+LVE APK LK G++K+EA ++K +LE AG
Sbjct: 61  VLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVNKEEAEKIKAQLEKAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|330993837|ref|ZP_08317769.1| 50S ribosomal protein L7/L12 [Gluconacetobacter sp. SXCC-1]
 gi|329759105|gb|EGG75617.1| 50S ribosomal protein L7/L12 [Gluconacetobacter sp. SXCC-1]
          Length = 124

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A EKTEF+V
Sbjct: 1   MADLNKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPGAAAAPAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKE+RAIT LGLKEAK+LVE APK++K G SKDEA ++KK LED G
Sbjct: 61  VLA--KAGDKKINVIKEIRAITGLGLKEAKDLVEGAPKTIKEGASKDEAEKIKKTLEDNG 118

Query: 121 ATVELR 126
           A+VE++
Sbjct: 119 ASVEIK 124


>gi|159487146|ref|XP_001701596.1| mitochondrial ribosomal protein L7/L12 [Chlamydomonas reinhardtii]
 gi|158271537|gb|EDO97354.1| mitochondrial ribosomal protein L7/L12 [Chlamydomonas reinhardtii]
          Length = 192

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 57/137 (41%), Positives = 76/137 (55%), Gaps = 16/137 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP---------------VAAE 47
            ++ + E++  LT++E + LS+ L K+ GV   A      P                A E
Sbjct: 55  KVQKLAEEIMGLTVLECSMLSEILRKKLGVQQPAFSMGAMPFAAAPAAPAAAPAAAAAPE 114

Query: 48  AGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
                 EKTEF+V L+ F   + KI VIKE+RA+T LGLKEAKELVE AP  +K G+SK 
Sbjct: 115 KKEEKKEKTEFDVKLESFSA-EGKIKVIKEIRALTTLGLKEAKELVEKAPVVIKVGVSKA 173

Query: 108 EANEMKKKLEDAGATVE 124
           +A  MKK+LE AG  V 
Sbjct: 174 DAEAMKKQLETAGGKVS 190


>gi|116624534|ref|YP_826690.1| 50S ribosomal protein L7/L12 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122252856|sp|Q01VB0|RL7_SOLUE RecName: Full=50S ribosomal protein L7/L12
 gi|116227696|gb|ABJ86405.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 126

 Score = 93.4 bits (231), Expect = 9e-18,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 84/126 (66%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ +I +++  LTL+EA++L K LE++ GVSA+A V+  A     A +A + + + E 
Sbjct: 1   MADLNAIADQIQGLTLLEASQLVKMLEEKLGVSAAAAVAAPAAGGGAAAAAPAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIK VR +T LGLKEAK+LV+ APK +K G+SK+EA  + KK  DAG
Sbjct: 61  TVVLTGAGANKINVIKAVREVTSLGLKEAKDLVDGAPKPIKEGVSKEEAATIAKKFTDAG 120

Query: 121 ATVELR 126
           ATVE++
Sbjct: 121 ATVEVK 126


>gi|189345744|ref|YP_001942273.1| 50S ribosomal protein L7/L12 [Chlorobium limicola DSM 245]
 gi|226733657|sp|B3EER1|RL7_CHLL2 RecName: Full=50S ribosomal protein L7/L12
 gi|189339891|gb|ACD89294.1| ribosomal protein L7/L12 [Chlorobium limicola DSM 245]
          Length = 125

 Score = 93.4 bits (231), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 86/123 (69%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE++VE++  LTL EA+EL K LE+++GVSA+  +      AA AG A +++ + E  + 
Sbjct: 3   IETLVEEIGKLTLTEASELVKALEEKFGVSAAPAIVAGIASAAPAGDAPAQEEKTEFDVV 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                + KI VIK VRA+T LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+D GA V
Sbjct: 63  LTSAGESKINVIKVVRALTGLGLKEAKDLVDGAPKTVKEAVSKDEAEKIAKELKDVGAGV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|302406118|ref|XP_003000895.1| 54S ribosomal protein L12 [Verticillium albo-atrum VaMs.102]
 gi|261360153|gb|EEY22581.1| 54S ribosomal protein L12 [Verticillium albo-atrum VaMs.102]
          Length = 182

 Score = 93.1 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 71/133 (53%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------VVAPVAAEAGSAA 52
            IE+IV+++S LTL+E A+L   L+    +                   A  A E   AA
Sbjct: 50  KIETIVDQISKLTLLETADLVSTLKSRLNIPDLPVGGFAAGPAAAAPAAAEEADEPAPAA 109

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           +EK+ F V L  FD    K  VIKE++ +  L L ++K+ VESAPK +K  + KDEA ++
Sbjct: 110 AEKSVFNVKLMAFDAGS-KPKVIKEIKNLLGLSLVDSKKFVESAPKLMKENVPKDEAEKI 168

Query: 113 KKKLEDAGATVEL 125
              L++ GA VE+
Sbjct: 169 IATLKELGAMVEM 181


>gi|224436426|ref|ZP_03657443.1| 50S ribosomal protein L7/L12 [Helicobacter cinaedi CCUG 18818]
 gi|313142940|ref|ZP_07805133.1| 50S ribosomal protein L7/L12 [Helicobacter cinaedi CCUG 18818]
 gi|313127971|gb|EFR45588.1| 50S ribosomal protein L7/L12 [Helicobacter cinaedi CCUG 18818]
          Length = 124

 Score = 93.1 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+ P  V   VA    +AA EKT+F V+L  
Sbjct: 6   EDVLEYIGNLSVLELSELVKAFEEKFGVSAA-PTVVAGAVAGGGAAAAEEKTDFNVIL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR IT LGLKEAK+  E  P +LK G+SK++A   KKKLE+ GA VE
Sbjct: 63  VDAGANKINVIKVVREITGLGLKEAKDATEQTPSTLKEGVSKEDAENFKKKLEEVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|218960791|ref|YP_001740566.1| 50S ribosomal subunit protein L7/L12 [Candidatus Cloacamonas
           acidaminovorans]
 gi|167729448|emb|CAO80359.1| 50S ribosomal subunit protein L7/L12 [Candidatus Cloacamonas
           acidaminovorans]
          Length = 127

 Score = 93.1 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 80/124 (64%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
             + +++ +  +T++E +EL K +E+ +GVSASAPV+ V      A     ++ + E  +
Sbjct: 4   KKQQVIDLIKEMTVLELSELVKEMEEIFGVSASAPVAAVMSTQGSAAEGGEKEEQTEFDV 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KKI VIK VR IT LGLKEAK+LV+ APK +   +SK+EA  ++KKLE+AGAT
Sbjct: 64  ILTSAGDKKINVIKVVREITKLGLKEAKDLVDGAPKVVSEKVSKEEAESVRKKLEEAGAT 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEVK 127


>gi|46125759|ref|XP_387433.1| hypothetical protein FG07257.1 [Gibberella zeae PH-1]
          Length = 180

 Score = 93.1 bits (230), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---------VVAPVAAEAGSAAS 53
            IE+IV+++S LTL+E A+L   L+ +  +                     A EA  AA+
Sbjct: 49  KIEAIVDQISQLTLLETADLVSSLKNKLNIPDMPIGGFAAAPAAAPAAVEEAEEAAPAAA 108

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F + L+GFD P  K  VIKEV+ +  L L ++K+ VESAPK +K  + K++A ++ 
Sbjct: 109 EKTLFTLKLQGFDAPS-KAKVIKEVKNMLGLSLVDSKKFVESAPKMMKENVPKEDAEKII 167

Query: 114 KKLEDAGATVEL 125
             +++ GATV +
Sbjct: 168 NTMKELGATVVM 179


>gi|304391366|ref|ZP_07373308.1| ribosomal protein L7/L12 [Ahrensia sp. R2A130]
 gi|303295595|gb|EFL89953.1| ribosomal protein L7/L12 [Ahrensia sp. R2A130]
          Length = 122

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 75/126 (59%), Positives = 96/126 (76%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LS+LT++EAAELS  LE+ WGVSA+AP +    VA  A  A  EK EF+V
Sbjct: 1   MADLKKIVDDLSALTVMEAAELSTMLEEHWGVSAAAPAAAA--VAGPAAEAVEEKDEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G     KKI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA E+KK+LE AG
Sbjct: 59  ILTG--AGDKKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGISKGEAEEVKKQLEGAG 116

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 117 ASVELK 122


>gi|94495393|ref|ZP_01301973.1| ribosomal protein L7/L12 [Sphingomonas sp. SKA58]
 gi|94424781|gb|EAT09802.1| ribosomal protein L7/L12 [Sphingomonas sp. SKA58]
          Length = 125

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 77/127 (60%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I ++V++LS+LT++EAAELSK LE++WGVSA+A V+V  P A    +AA E K EF+
Sbjct: 1   MADINALVDQLSALTVLEAAELSKALEEKWGVSAAAAVAVAGPAAGAPAAAAEEVKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G++K+EA ++KK+LE+A
Sbjct: 61  VVLTG--DGGKKINVIKEVRAITGLGLTEAKALVEGAPKAVKEGVNKEEAEKLKKQLEEA 118

Query: 120 GATVELR 126
           GATVEL+
Sbjct: 119 GATVELK 125


>gi|163755835|ref|ZP_02162953.1| 50S ribosomal protein L7/L12 [Kordia algicida OT-1]
 gi|161324356|gb|EDP95687.1| 50S ribosomal protein L7/L12 [Kordia algicida OT-1]
          Length = 124

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 82/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    V P A     A  E+TEF+V
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELADILKDEYGIEPAAAAVAVGPAAPGDADAGDEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLK+AK +V+SAP  +K G+SKDEA  +K  LE+AG
Sbjct: 61  ILKA--AGGSKLAVVKLVKELTGLGLKDAKGIVDSAPAPIKEGVSKDEAEGLKASLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|223038912|ref|ZP_03609204.1| ribosomal protein L7/L12 [Campylobacter rectus RM3267]
 gi|222879885|gb|EEF14974.1| ribosomal protein L7/L12 [Campylobacter rectus RM3267]
          Length = 125

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A  AA EKTEF VVL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGAADAAEEKTEFNVVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  +K G+ KDEA   KK+LE+AGA VE
Sbjct: 64  VDGGDKKINVIKVVRALTGLGLKEAKDAVEQTPSVIKEGIGKDEAEAAKKELEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|195659273|gb|ACG49104.1| 50S ribosomal protein L12-1 [Zea mays]
          Length = 183

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 52/130 (40%), Positives = 75/130 (57%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------K 55
            I  + + ++ LTL EA  L   L++  GV+A+A        A  AG  A+        K
Sbjct: 54  KILELGDAIAGLTLEEARSLVDHLQERLGVTAAAFAPAAVVAAPGAGGGAAAEEEAPVEK 113

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+V+++       +IA IK VRA+T L LKEAK+L+E  PK +K  +SKDEA + KK+
Sbjct: 114 TEFDVMIEEV-PSSARIATIKVVRALTSLALKEAKDLIEGLPKKVKEAVSKDEAEDAKKQ 172

Query: 116 LEDAGATVEL 125
           LE+ GA V +
Sbjct: 173 LEEVGAKVSI 182


>gi|17987031|ref|NP_539665.1| 50S ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. 16M]
 gi|23502122|ref|NP_698249.1| 50S ribosomal protein L7/L12 [Brucella suis 1330]
 gi|62290155|ref|YP_221948.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 1 str. 9-941]
 gi|82700077|ref|YP_414651.1| 50S ribosomal protein L7/L12 [Brucella melitensis biovar Abortus
           2308]
 gi|161619200|ref|YP_001593087.1| 50S ribosomal protein L7/L12 [Brucella canis ATCC 23365]
 gi|163843509|ref|YP_001627913.1| 50S ribosomal protein L7/L12 [Brucella suis ATCC 23445]
 gi|189024391|ref|YP_001935159.1| Ribosomal protein L7/L12 [Brucella abortus S19]
 gi|225627713|ref|ZP_03785750.1| ribosomal protein L7/L12 [Brucella ceti str. Cudo]
 gi|225852741|ref|YP_002732974.1| 50S ribosomal protein L7/L12 [Brucella melitensis ATCC 23457]
 gi|237815663|ref|ZP_04594660.1| ribosomal protein L7/L12 [Brucella abortus str. 2308 A]
 gi|254689461|ref|ZP_05152715.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 6 str. 870]
 gi|254693946|ref|ZP_05155774.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 3 str. Tulya]
 gi|254697598|ref|ZP_05159426.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254701983|ref|ZP_05163811.1| 50S ribosomal protein L7/L12 [Brucella suis bv. 5 str. 513]
 gi|254704526|ref|ZP_05166354.1| 50S ribosomal protein L7/L12 [Brucella suis bv. 3 str. 686]
 gi|254706578|ref|ZP_05168406.1| 50S ribosomal protein L7/L12 [Brucella pinnipedialis M163/99/10]
 gi|254710312|ref|ZP_05172123.1| 50S ribosomal protein L7/L12 [Brucella pinnipedialis B2/94]
 gi|254714309|ref|ZP_05176120.1| 50S ribosomal protein L7/L12 [Brucella ceti M644/93/1]
 gi|254717746|ref|ZP_05179557.1| 50S ribosomal protein L7/L12 [Brucella ceti M13/05/1]
 gi|254730490|ref|ZP_05189068.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 4 str. 292]
 gi|256031806|ref|ZP_05445420.1| 50S ribosomal protein L7/L12 [Brucella pinnipedialis M292/94/1]
 gi|256044891|ref|ZP_05447795.1| 50S ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256061323|ref|ZP_05451471.1| 50S ribosomal protein L7/L12 [Brucella neotomae 5K33]
 gi|256113799|ref|ZP_05454599.1| 50S ribosomal protein L7/L12 [Brucella melitensis bv. 3 str. Ether]
 gi|256159979|ref|ZP_05457694.1| 50S ribosomal protein L7/L12 [Brucella ceti M490/95/1]
 gi|256255207|ref|ZP_05460743.1| 50S ribosomal protein L7/L12 [Brucella ceti B1/94]
 gi|256257707|ref|ZP_05463243.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 9 str. C68]
 gi|256263772|ref|ZP_05466304.1| ribosomal protein L7/L12 [Brucella melitensis bv. 2 str. 63/9]
 gi|256369667|ref|YP_003107177.1| 50S ribosomal protein L7/L12 [Brucella microti CCM 4915]
 gi|260168940|ref|ZP_05755751.1| 50S ribosomal protein L7/L12 [Brucella sp. F5/99]
 gi|260546700|ref|ZP_05822439.1| ribosomal protein L7/L12 [Brucella abortus NCTC 8038]
 gi|260565507|ref|ZP_05835991.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. 16M]
 gi|260566230|ref|ZP_05836700.1| ribosomal protein L7/L12 [Brucella suis bv. 4 str. 40]
 gi|260754985|ref|ZP_05867333.1| ribosomal protein L7/L12 [Brucella abortus bv. 6 str. 870]
 gi|260758201|ref|ZP_05870549.1| ribosomal protein L7/L12 [Brucella abortus bv. 4 str. 292]
 gi|260762028|ref|ZP_05874371.1| ribosomal protein L7/L12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883993|ref|ZP_05895607.1| ribosomal protein L7/L12 [Brucella abortus bv. 9 str. C68]
 gi|261214239|ref|ZP_05928520.1| ribosomal protein L7/L12 [Brucella abortus bv. 3 str. Tulya]
 gi|261219590|ref|ZP_05933871.1| ribosomal protein L7/L12 [Brucella ceti M13/05/1]
 gi|261222403|ref|ZP_05936684.1| ribosomal protein L7/L12 [Brucella ceti B1/94]
 gi|261314037|ref|ZP_05953234.1| ribosomal protein L7/L12 [Brucella pinnipedialis M163/99/10]
 gi|261317876|ref|ZP_05957073.1| ribosomal protein L7/L12 [Brucella pinnipedialis B2/94]
 gi|261322085|ref|ZP_05961282.1| ribosomal protein L7/L12 [Brucella ceti M644/93/1]
 gi|261325328|ref|ZP_05964525.1| ribosomal protein L7/L12 [Brucella neotomae 5K33]
 gi|261752551|ref|ZP_05996260.1| ribosomal protein L7/L12 [Brucella suis bv. 5 str. 513]
 gi|261755210|ref|ZP_05998919.1| ribosomal protein L7/L12 [Brucella suis bv. 3 str. 686]
 gi|261758433|ref|ZP_06002142.1| ribosomal protein L7/L12 [Brucella sp. F5/99]
 gi|265988905|ref|ZP_06101462.1| ribosomal protein L7/L12 [Brucella pinnipedialis M292/94/1]
 gi|265991319|ref|ZP_06103876.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265995156|ref|ZP_06107713.1| ribosomal protein L7/L12 [Brucella melitensis bv. 3 str. Ether]
 gi|265998369|ref|ZP_06110926.1| ribosomal protein L7/L12 [Brucella ceti M490/95/1]
 gi|294852580|ref|ZP_06793253.1| 50S ribosomal protein L7/L12 [Brucella sp. NVSL 07-0026]
 gi|297248549|ref|ZP_06932267.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 5 str. B3196]
 gi|61233341|sp|P0A468|RL7_BRUME RecName: Full=50S ribosomal protein L7/L12
 gi|61233343|sp|P0A469|RL7_BRUSU RecName: Full=50S ribosomal protein L7/L12
 gi|61233348|sp|P0A470|RL7_BRUAB RecName: Full=50S ribosomal protein L7/L12
 gi|109893749|sp|Q2YM14|RL7_BRUA2 RecName: Full=50S ribosomal protein L7/L12
 gi|189042982|sp|A9M5R1|RL7_BRUC2 RecName: Full=50S ribosomal protein L7/L12
 gi|189042983|sp|B0CH42|RL7_BRUSI RecName: Full=50S ribosomal protein L7/L12
 gi|226733649|sp|B2S688|RL7_BRUA1 RecName: Full=50S ribosomal protein L7/L12
 gi|254806266|sp|C0RJL2|RL7_BRUMB RecName: Full=50S ribosomal protein L7/L12
 gi|304271|gb|AAA19863.1| ribosomal protein L7/L12 [Brucella abortus]
 gi|450254|gb|AAA56790.1| ribosomal protein L7/L12 [Brucella melitensis]
 gi|17982685|gb|AAL51929.1| lsu ribosomal protein l12p (l7/l12) [Brucella melitensis bv. 1 str.
           16M]
 gi|23348083|gb|AAN30164.1| ribosomal protein L7/L12 [Brucella suis 1330]
 gi|62196287|gb|AAX74587.1| RplL, ribosomal protein L7/L12 [Brucella abortus bv. 1 str. 9-941]
 gi|82616178|emb|CAJ11221.1| Ribosomal protein L7/L12 [Brucella melitensis biovar Abortus 2308]
 gi|121078805|gb|ABM47417.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. M5]
 gi|161336011|gb|ABX62316.1| ribosomal protein L7/L12 [Brucella canis ATCC 23365]
 gi|163674232|gb|ABY38343.1| ribosomal protein L7/L12 [Brucella suis ATCC 23445]
 gi|189019963|gb|ACD72685.1| Ribosomal protein L7/L12 [Brucella abortus S19]
 gi|225617718|gb|EEH14763.1| ribosomal protein L7/L12 [Brucella ceti str. Cudo]
 gi|225641106|gb|ACO01020.1| ribosomal protein L7/L12 [Brucella melitensis ATCC 23457]
 gi|237788961|gb|EEP63172.1| ribosomal protein L7/L12 [Brucella abortus str. 2308 A]
 gi|255999829|gb|ACU48228.1| 50S ribosomal protein L7/L12 [Brucella microti CCM 4915]
 gi|260095750|gb|EEW79627.1| ribosomal protein L7/L12 [Brucella abortus NCTC 8038]
 gi|260151575|gb|EEW86669.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. 16M]
 gi|260155748|gb|EEW90828.1| ribosomal protein L7/L12 [Brucella suis bv. 4 str. 40]
 gi|260668519|gb|EEX55459.1| ribosomal protein L7/L12 [Brucella abortus bv. 4 str. 292]
 gi|260672460|gb|EEX59281.1| ribosomal protein L7/L12 [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675093|gb|EEX61914.1| ribosomal protein L7/L12 [Brucella abortus bv. 6 str. 870]
 gi|260873521|gb|EEX80590.1| ribosomal protein L7/L12 [Brucella abortus bv. 9 str. C68]
 gi|260915846|gb|EEX82707.1| ribosomal protein L7/L12 [Brucella abortus bv. 3 str. Tulya]
 gi|260920987|gb|EEX87640.1| ribosomal protein L7/L12 [Brucella ceti B1/94]
 gi|260924679|gb|EEX91247.1| ribosomal protein L7/L12 [Brucella ceti M13/05/1]
 gi|261294775|gb|EEX98271.1| ribosomal protein L7/L12 [Brucella ceti M644/93/1]
 gi|261297099|gb|EEY00596.1| ribosomal protein L7/L12 [Brucella pinnipedialis B2/94]
 gi|261301308|gb|EEY04805.1| ribosomal protein L7/L12 [Brucella neotomae 5K33]
 gi|261303063|gb|EEY06560.1| ribosomal protein L7/L12 [Brucella pinnipedialis M163/99/10]
 gi|261738417|gb|EEY26413.1| ribosomal protein L7/L12 [Brucella sp. F5/99]
 gi|261742304|gb|EEY30230.1| ribosomal protein L7/L12 [Brucella suis bv. 5 str. 513]
 gi|261744963|gb|EEY32889.1| ribosomal protein L7/L12 [Brucella suis bv. 3 str. 686]
 gi|262552837|gb|EEZ08827.1| ribosomal protein L7/L12 [Brucella ceti M490/95/1]
 gi|262766269|gb|EEZ12058.1| ribosomal protein L7/L12 [Brucella melitensis bv. 3 str. Ether]
 gi|263002103|gb|EEZ14678.1| ribosomal protein L7/L12 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263093883|gb|EEZ17834.1| ribosomal protein L7/L12 [Brucella melitensis bv. 2 str. 63/9]
 gi|264661102|gb|EEZ31363.1| ribosomal protein L7/L12 [Brucella pinnipedialis M292/94/1]
 gi|294821169|gb|EFG38168.1| 50S ribosomal protein L7/L12 [Brucella sp. NVSL 07-0026]
 gi|297175718|gb|EFH35065.1| 50S ribosomal protein L7/L12 [Brucella abortus bv. 5 str. B3196]
 gi|326409266|gb|ADZ66331.1| Ribosomal protein L7/L12 [Brucella melitensis M28]
 gi|326538974|gb|ADZ87189.1| ribosomal protein L7/L12 [Brucella melitensis M5-90]
          Length = 124

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 78/126 (61%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRA+T LGLKEAK+LVE APK++K G SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|319957694|ref|YP_004168957.1| LSU ribosomal protein l12p [Nitratifractor salsuginis DSM 16511]
 gi|319420098|gb|ADV47208.1| LSU ribosomal protein L12P [Nitratifractor salsuginis DSM 16511]
          Length = 124

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA A   V A   A  G A  E+TEF+VVL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAQAT-VVAAAPGAAGGEAEEEQTEFDVVLTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRA+T LGLKEAK  VE  P  +K G+SK+EA E+KK+ E+AGATVE
Sbjct: 65  --PGAKKINVIKVVRAVTGLGLKEAKAAVEETPTVIKEGVSKEEAEELKKQFEEAGATVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|89890191|ref|ZP_01201702.1| RplL, 50S ribosomal protein L7/L12 family [Flavobacteria bacterium
           BBFL7]
 gi|89518464|gb|EAS21120.1| RplL, 50S ribosomal protein L7/L12 family [Flavobacteria bacterium
           BBFL7]
          Length = 124

 Score = 92.7 bits (229), Expect = 1e-17,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    +A  A    +AA E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAMAGPAGGGDAAADEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLK+AK+LV++AP  +K G+SKDEA  +K +LE+AG
Sbjct: 61  ILKA--PGGAKLAVVKLVKELTGAGLKDAKDLVDNAPSPIKEGVSKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|239832131|ref|ZP_04680460.1| ribosomal protein L7/L12 [Ochrobactrum intermedium LMG 3301]
 gi|254719299|ref|ZP_05181110.1| 50S ribosomal protein L7/L12 [Brucella sp. 83/13]
 gi|265984300|ref|ZP_06097035.1| ribosomal protein L7/L12 [Brucella sp. 83/13]
 gi|306838944|ref|ZP_07471769.1| ribosomal protein L7/L12 [Brucella sp. NF 2653]
 gi|306840289|ref|ZP_07473062.1| ribosomal protein L7/L12 [Brucella sp. BO2]
 gi|306844149|ref|ZP_07476743.1| ribosomal protein L7/L12 [Brucella sp. BO1]
 gi|239824398|gb|EEQ95966.1| ribosomal protein L7/L12 [Ochrobactrum intermedium LMG 3301]
 gi|264662892|gb|EEZ33153.1| ribosomal protein L7/L12 [Brucella sp. 83/13]
 gi|306275592|gb|EFM57324.1| ribosomal protein L7/L12 [Brucella sp. BO1]
 gi|306289744|gb|EFM60930.1| ribosomal protein L7/L12 [Brucella sp. BO2]
 gi|306405977|gb|EFM62231.1| ribosomal protein L7/L12 [Brucella sp. NF 2653]
          Length = 124

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 79/126 (62%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G SKDEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGASKDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|5802237|gb|AAD51621.1|AF169147_2 ribosomal protein L7/L12 [Brucella abortus]
          Length = 124

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 97/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRA+T LGLKEAK+LVE APK++K G S DEA ++K +LE AG
Sbjct: 61  VLA--DGGANKINVIKEVRALTGLGLKEAKDLVEGAPKAVKEGASNDEAEKIKAQLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|213403260|ref|XP_002172402.1| ribosomal protein L12 [Schizosaccharomyces japonicus yFS275]
 gi|212000449|gb|EEB06109.1| ribosomal protein L12 [Schizosaccharomyces japonicus yFS275]
          Length = 177

 Score = 92.7 bits (229), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/133 (37%), Positives = 72/133 (54%), Gaps = 10/133 (7%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV---------VAPVAAEAGSAA 52
           + IE +VE +S LTL+E ++L  +L+ +  +   AP++                    AA
Sbjct: 45  TKIEKLVEDISKLTLLETSQLVDQLKTKLNIQDVAPIAFNPSAVSATDAGAEEPAKKEAA 104

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT + V L  FD    K  VIKEV+A+  L L EAK+ VE+APK LK  + K++A+ +
Sbjct: 105 EEKTSWTVRLDSFDAGS-KAKVIKEVKAMLGLTLVEAKKTVEAAPKVLKENVLKEDADAV 163

Query: 113 KKKLEDAGATVEL 125
           K KLE  G  V L
Sbjct: 164 KSKLEGLGCKVTL 176


>gi|172056130|ref|YP_001812590.1| ribosomal protein L7/L12 [Exiguobacterium sibiricum 255-15]
 gi|171988651|gb|ACB59573.1| ribosomal protein L7/L12 [Exiguobacterium sibiricum 255-15]
          Length = 121

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 84/124 (67%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L  +T++E  EL K +E+E+GVSA+APV+     A    +AA E+TEF+V+L
Sbjct: 4   NKEQFIEDLKGMTVLELNELVKTIEEEFGVSAAAPVA----AAGAGAAAAEEQTEFDVIL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR +T LGLKEAK LV+  P  +K G+SK++A+ +K KLE+AGA+
Sbjct: 60  TS--AGSGKINVIKAVRELTGLGLKEAKALVDGTPAPVKEGVSKEDADAIKAKLEEAGAS 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|256371207|ref|YP_003109031.1| ribosomal protein L7/L12 [Acidimicrobium ferrooxidans DSM 10331]
 gi|256007791|gb|ACU53358.1| ribosomal protein L7/L12 [Acidimicrobium ferrooxidans DSM 10331]
          Length = 128

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 89/128 (69%), Gaps = 2/128 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFE- 59
           M++I+ I++++S LT++E +EL K  E+ +GV+A+APV+V A   A  G  A+   E + 
Sbjct: 1   MADIQGILDQISELTVVELSELVKAFEERFGVTAAAPVAVAAVAGAAGGGEAAPAEEEQQ 60

Query: 60  -VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
              +       KKI VIKEVRA+T+LGLKEAK+LV++APK +   +SK++A + K +LE 
Sbjct: 61  EFDVVLVSAGDKKIQVIKEVRALTNLGLKEAKDLVDAAPKPVLEKVSKEDAEKAKAQLEG 120

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 121 AGATVELK 128


>gi|284928827|ref|YP_003421349.1| 50S ribosomal protein L12P [cyanobacterium UCYN-A]
 gi|284809286|gb|ADB94991.1| LSU ribosomal protein L12P [cyanobacterium UCYN-A]
          Length = 131

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 72/132 (54%), Positives = 96/132 (72%), Gaps = 7/132 (5%)

Query: 1   MSNI-ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----- 54
           MSNI + I+EKL SL+L+EA+EL K++E+ + VSASAPV  +   A  A +A +      
Sbjct: 1   MSNITDEIIEKLKSLSLLEASELVKQIEEVFDVSASAPVGGMMMGAPVAAAAGAGEAAEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L+ F    KKIA++K VR IT LGLKEAK+LVES PKSLK G +KD+A  +KK
Sbjct: 61  KTEFDVILEEF-PSDKKIAILKVVRTITGLGLKEAKDLVESTPKSLKEGTTKDDAESIKK 119

Query: 115 KLEDAGATVELR 126
           +LEDAGA V ++
Sbjct: 120 QLEDAGAKVTIK 131


>gi|115378456|ref|ZP_01465615.1| ribosomal protein L7/L12 [Stigmatella aurantiaca DW4/3-1]
 gi|310822261|ref|YP_003954619.1| 50S ribosomal protein L7/l12 [Stigmatella aurantiaca DW4/3-1]
 gi|115364518|gb|EAU63594.1| ribosomal protein L7/L12 [Stigmatella aurantiaca DW4/3-1]
 gi|309395333|gb|ADO72792.1| 50S ribosomal protein L7/L12 [Stigmatella aurantiaca DW4/3-1]
          Length = 125

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  I E+LS+LT++EA EL K LE +WGVSA+A      P A  A +A   EKTEF 
Sbjct: 1   MADLNKIAEELSTLTVLEAGELVKLLENKWGVSAAAVAVAAGPAAGAAAAAPVEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   +    KI VIKE+RAIT LGLKEAK+LVE APK++K G+SKD+A + K +L  A
Sbjct: 61  VVL--ANAGANKINVIKEIRAITGLGLKEAKDLVEGAPKNVKEGVSKDDAKKFKDQLTAA 118

Query: 120 GATVELR 126
           GATVE++
Sbjct: 119 GATVEVK 125


>gi|20020|emb|CAA44226.1| ribosomal protein L12-1a [Nicotiana tabacum]
          Length = 191

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 53/127 (41%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEF 58
            +  + +++S+LTL +A +L + L+ + GV+A++        A  A + A      KTEF
Sbjct: 60  KVVQLGDEISNLTLADAQKLVEYLQDKLGVTAASFAPAAVAAAPGAAAEAPAVVEEKTEF 119

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IA IK VRA+T L LKEAKEL+E  PK  K G+SKDEA + KK+LE+
Sbjct: 120 DVVIDEVPSNA-RIATIKAVRALTSLALKEAKELIEGLPKKFKEGVSKDEAEDAKKQLEE 178

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 179 AGAKVSI 185


>gi|15234393|ref|NP_195360.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|13878063|gb|AAK44109.1|AF370294_1 putative ribosomal protein [Arabidopsis thaliana]
 gi|4006919|emb|CAB16813.1| ribosomal protein [Arabidopsis thaliana]
 gi|7270590|emb|CAB80308.1| ribosomal protein [Arabidopsis thaliana]
 gi|15450415|gb|AAK96501.1| At4g36420/C7A10_940 [Arabidopsis thaliana]
 gi|17104653|gb|AAL34215.1| putative ribosomal protein [Arabidopsis thaliana]
          Length = 179

 Score = 92.3 bits (228), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 55/136 (40%), Positives = 82/136 (60%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE----- 57
           N+  IV +LS+LTL+E  +L++ L ++  +S    ++ + P  +  GS AS+        
Sbjct: 44  NVSKIVNELSNLTLLETMDLTEILRQKLNISELPVMAAMMPGMSLPGSGASKSAGGEGKE 103

Query: 58  --------FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
                   F+V+L+ +D    KI VIKEVR IT LGLKEAK+LVE AP  LK G+SK+EA
Sbjct: 104 KKKEAKTAFDVMLQAYDAVS-KIKVIKEVRTITALGLKEAKDLVEKAPTLLKKGVSKEEA 162

Query: 110 NEMKKKLEDAGATVEL 125
            ++ +KL+  GA V +
Sbjct: 163 EKIIEKLKAVGAKVAM 178


>gi|242053887|ref|XP_002456089.1| hypothetical protein SORBIDRAFT_03g030270 [Sorghum bicolor]
 gi|241928064|gb|EES01209.1| hypothetical protein SORBIDRAFT_03g030270 [Sorghum bicolor]
          Length = 181

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 74/128 (57%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTE 57
            I  + + ++ LTL EA  L   L++  GV+A+A        A     AA E     KTE
Sbjct: 54  KILELGDAIAGLTLEEARSLVDHLQERLGVTAAAFAPAAVVAAPAGAGAAEEEAPVEKTE 113

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV++       +IA IK VRA+T L LKEAK+L+E  PK LK  +SKDEA + KK+LE
Sbjct: 114 FDVVIEEV-PSSARIATIKVVRALTSLALKEAKDLIEGLPKKLKEAVSKDEAEDAKKQLE 172

Query: 118 DAGATVEL 125
           + GA + +
Sbjct: 173 EVGAKISI 180


>gi|319408382|emb|CBI82037.1| 50S ribosomal protein L7/L12 [Bartonella schoenbuchensis R1]
          Length = 123

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 94/126 (74%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W   ++A    VA V   A  AA EKT+F+V
Sbjct: 1   MADLTKIVEDLSNLTVLEAAELSKLLEEKW-GVSAAAPVAVAAVGGGAAPAAEEKTDFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D   +KI VIKEVRA+T LGLKEAK+LVE APKS+K G+SKDEA ++K +LE AG
Sbjct: 60  VL--VDGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKSIKEGVSKDEAEKIKTQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|254437630|ref|ZP_05051124.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 307]
 gi|198253076|gb|EDY77390.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 307]
          Length = 127

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 86/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+ G+A  EKTEF+V
Sbjct: 5   MADLKKMAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGGAAEEEKTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       KI VIKEVR IT LGLKEAK+LVE+  K +K G+SK+EA ++K KLE AG
Sbjct: 65  ILKS--PGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVSKEEAEDVKGKLEAAG 121

Query: 121 ATVEL 125
           A VEL
Sbjct: 122 AEVEL 126


>gi|91200659|emb|CAJ73709.1| strongly similar to 50S ribosomal protein L7/L12 [Candidatus
           Kuenenia stuttgartiensis]
          Length = 138

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 54/124 (43%), Positives = 85/124 (68%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I  +++ +S +TL+EA+EL K  EK++GVSASA  ++   +      AA E+ +    +
Sbjct: 15  KIAQVLDIVSGMTLLEASELVKAFEKKFGVSASAVAAMPVGMPMAGAGAAVEEEKTSFDV 74

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VRA T+LGLKEAK+LVE APK++K G++K++A++++K LE+AGA 
Sbjct: 75  ILKEVGANKIQVIKAVRAETNLGLKEAKDLVEGAPKAVKEGVTKEDADKIRKTLEEAGAK 134

Query: 123 VELR 126
           VE++
Sbjct: 135 VEIK 138


>gi|15616664|ref|NP_239876.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219681421|ref|YP_002467806.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|219681977|ref|YP_002468361.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|257471096|ref|ZP_05635095.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. LSR1
           (Acyrthosiphon pisum)]
 gi|11134303|sp|P57147|RL7_BUCAI RecName: Full=50S ribosomal protein L7/L12
 gi|254806267|sp|B8D8J7|RL7_BUCA5 RecName: Full=50S ribosomal protein L7/L12
 gi|254806268|sp|B8D6V1|RL7_BUCAT RecName: Full=50S ribosomal protein L7/L12
 gi|25295074|pir||B84934 50S ribosomal protein L7/L12 [imported] - Buchnera sp.  (strain
           APS)
 gi|10038727|dbj|BAB12762.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. APS
           (Acyrthosiphon pisum)]
 gi|219621710|gb|ACL29866.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. Tuc7
           (Acyrthosiphon pisum)]
 gi|219624264|gb|ACL30419.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. 5A
           (Acyrthosiphon pisum)]
 gi|311085783|gb|ADP65865.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. LL01
           (Acyrthosiphon pisum)]
 gi|311086358|gb|ADP66439.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. TLW03
           (Acyrthosiphon pisum)]
 gi|311086936|gb|ADP67016.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. JF99
           (Acyrthosiphon pisum)]
 gi|311087522|gb|ADP67601.1| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. JF98
           (Acyrthosiphon pisum)]
          Length = 122

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 76/122 (62%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S ++++   +L   +E+++GVSAS     +            EKTEF++ LK 
Sbjct: 6   EQILEAISEMSVMNVVDLITAMEEKFGVSAS---MSINSNNHNEKDLREEKTEFDIFLKV 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++VIK VR+ T LGLKEAK+LVESAP  LK  +SK++A  +KK LED GA +E
Sbjct: 63  I--GPNKVSVIKTVRSATGLGLKEAKDLVESAPTVLKENISKEDAESLKKTLEDVGAEIE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|326489420|dbj|BAK01691.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326494064|dbj|BAJ85494.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326496362|dbj|BAJ94643.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 179

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 75/127 (59%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEF 58
            +  + + ++ LTL EA  L   L++  GVSA++     A  A    +A +E    +TEF
Sbjct: 53  KVLELGDAIAGLTLEEARGLVDHLQERLGVSAASFAPAAAVAAPAGPAAEAEAPAEQTEF 112

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV++       +IA IK VRA+T+L LK+AK+L+E  PK LK  + KDEA + KK+LE 
Sbjct: 113 DVVIQEVPSSA-RIATIKVVRALTNLALKDAKDLIEGLPKKLKEAVGKDEAEDAKKQLEA 171

Query: 119 AGATVEL 125
            GA V +
Sbjct: 172 VGAKVTV 178


>gi|254454632|ref|ZP_05068069.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 238]
 gi|198269038|gb|EDY93308.1| ribosomal protein L7/L12 [Octadecabacter antarcticus 238]
          Length = 127

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 86/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+ G+A  E+TEF+V
Sbjct: 5   MADLKKMAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGGAAEEEQTEFDV 64

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       KI VIKEVR IT LGLKEAK+LVE+  K +K G+SK+EA ++K KLE AG
Sbjct: 65  ILKS--PGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVSKEEAEDVKGKLEAAG 121

Query: 121 ATVEL 125
           A VE+
Sbjct: 122 AEVEV 126


>gi|225423641|ref|XP_002275461.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|225467512|ref|XP_002268912.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 206

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 55/137 (40%), Positives = 81/137 (59%), Gaps = 14/137 (10%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA-------------AEA 48
           + +  +V++++ LTL+E AELS  L K+ G+     V+++ P A             A  
Sbjct: 70  ARVFRLVDEIAGLTLVEVAELSSILRKKLGMKEPPVVAIMKPGAVAAVSGGGMKAASAAK 129

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
                EKT FE+ L+ ++    KI +IKEVR+ TDLGLKEAK+LVE AP  LK G+SK+E
Sbjct: 130 EEKKPEKTVFELKLESYEA-ASKIKIIKEVRSFTDLGLKEAKDLVEKAPSVLKAGVSKEE 188

Query: 109 ANEMKKKLEDAGATVEL 125
             ++ +KL+  GA V L
Sbjct: 189 GEQLVEKLKALGAKVVL 205


>gi|255646953|gb|ACU23946.1| unknown [Glycine max]
          Length = 216

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 49/132 (37%), Positives = 71/132 (53%), Gaps = 13/132 (9%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV------------SVVAPVAAEAGSAAS 53
            ++++++SLT+ EA EL   L K+ GV     V                   A       
Sbjct: 85  RLIDEIASLTVAEAGELGLILMKKMGVKEMPNVGFMKAGAGNLAGMAAKAPTAAKEEQKL 144

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT FE+ L+ ++    KI +IKEVR  TDLGLKEAK+LVE  P  +K G+SK+E  ++ 
Sbjct: 145 EKTVFELKLESYEA-ASKIKIIKEVRGFTDLGLKEAKDLVEKTPSVIKKGISKEEGEQII 203

Query: 114 KKLEDAGATVEL 125
           +KL+  GA V +
Sbjct: 204 EKLKALGAKVVM 215


>gi|327265156|ref|XP_003217374.1| PREDICTED: LOW QUALITY PROTEIN: 39S ribosomal protein L12,
           mitochondrial-like [Anolis carolinensis]
          Length = 223

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 44/136 (32%), Positives = 72/136 (52%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGV------------SASAPVSVVAPVAAEAGS 50
            I+ +V+ +++LTL+E ++L++ L+K   +             ++ PV+ V     E   
Sbjct: 88  KIQQLVQDIANLTLLEISDLNQLLKKTLKIEDMGLMSMAGMMPSAQPVAPVRDSPXEDVP 147

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEA 109
              EK  F V L       +K+ +IKEV+     L L +AK+LVES P+ +K  + K+EA
Sbjct: 148 KKQEKLNFTVKLTDLKA-AEKVKLIKEVKNCMQGLNLVQAKKLVESLPQEIKANIPKEEA 206

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE AG TV L
Sbjct: 207 EKIKAALEAAGGTVVL 222


>gi|194293715|gb|ACF39953.1| 50S ribosomal subunit protein L12 [Candidatus Liberibacter
           solanacearum]
          Length = 124

 Score = 91.9 bits (227), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 91/126 (72%), Positives = 109/126 (86%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATESV-AVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFNATS-KINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVELR 126
           AT+++R
Sbjct: 119 ATIDIR 124


>gi|94987372|ref|YP_595305.1| 50S ribosomal protein L7/L12 [Lawsonia intracellularis PHE/MN1-00]
 gi|122988768|sp|Q1MPU3|RL7_LAWIP RecName: Full=50S ribosomal protein L7/L12
 gi|94731621|emb|CAJ54984.1| ribosomal protein L7/L12 [Lawsonia intracellularis PHE/MN1-00]
          Length = 128

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 53/123 (43%), Positives = 84/123 (68%), Gaps = 1/123 (0%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-VVAPVAAEAGSAASEKTEFEVVLK 63
           E ++E +S++T++E ++  K LE+++GVSA+AP   ++      A + A  + + E  + 
Sbjct: 6   EQVIEFISNMTVLELSQFIKELEEKFGVSAAAPAVGMMMAAPTAASAEAEAEEKTEFDVI 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KIAVIK VRA+T LGLKEAK+ V+ AP +LK G+SK++A E KK+L +AGATV
Sbjct: 66  LKEAGANKIAVIKVVRALTGLGLKEAKDKVDGAPSTLKEGVSKEDAEEAKKQLTEAGATV 125

Query: 124 ELR 126
           E++
Sbjct: 126 EVK 128


>gi|11467613|ref|NP_050665.1| ribosomal protein L12 [Guillardia theta]
 gi|6093978|sp|O78414|RK12_GUITH RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|3602938|gb|AAC35599.1| ribosomal protein L12 [Guillardia theta]
          Length = 129

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 61/130 (46%), Positives = 91/130 (70%), Gaps = 5/130 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----VVAPVAAEAGSAASEKT 56
           M+ +++I+++L  LTL+EAA+L K++E+ + VSA+A  +    V A   A +  A  EKT
Sbjct: 1   MNKVQNIIDQLKDLTLLEAADLVKQIEETFNVSATAAAAPINMVAATAGAGSAEAVEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+++L+      KKIAV+K VR +T LGLKEAK+LVE+APK +K G+SK +A   KK+L
Sbjct: 61  EFDLILEDV-PADKKIAVLKVVRGLTGLGLKEAKDLVEAAPKPIKEGMSKADAEAGKKQL 119

Query: 117 EDAGATVELR 126
           E+AGA   L+
Sbjct: 120 EEAGAKATLK 129


>gi|119713233|gb|ABL97299.1| ribosomal protein L7/L12 [uncultured marine bacterium HF10_12C08]
          Length = 126

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 97/126 (76%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV++LS LT+IEAAELSK LE++WGVSA+APV+V A  AA +G  A+ + + E 
Sbjct: 1   MADLQQIVDQLSDLTVIEAAELSKMLEEKWGVSAAAPVAVAAAGAAPSGDTAATEEKDEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVR IT LGLKEAK+LVE APK LKTG+SKDEAN  K+KLE AG
Sbjct: 61  TIVLAAAGDKKINVIKEVRTITGLGLKEAKDLVEGAPKELKTGVSKDEANGFKEKLEAAG 120

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 121 ATVELK 126


>gi|224055553|ref|XP_002298536.1| predicted protein [Populus trichocarpa]
 gi|118483906|gb|ABK93843.1| unknown [Populus trichocarpa]
 gi|222845794|gb|EEE83341.1| predicted protein [Populus trichocarpa]
          Length = 187

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 77/129 (59%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA------SEKT 56
            IE +  ++SSLTL EA  L   L+ + GVSA+A     A   A   +A        EKT
Sbjct: 59  KIEKLGAEISSLTLEEARTLVDYLQDKLGVSAAAFAPAAAVGVAPGAAADAGAAVVEEKT 118

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VV++       +IAVIK VRA+T L LKEAKEL+E  PK  K G+SKDEA E KK+L
Sbjct: 119 EFDVVIEEV-PSNVRIAVIKSVRALTSLALKEAKELIEGLPKKFKEGVSKDEAEEAKKQL 177

Query: 117 EDAGATVEL 125
           E AGA   +
Sbjct: 178 EAAGAKCSV 186


>gi|92117083|ref|YP_576812.1| 50S ribosomal protein L7/L12 [Nitrobacter hamburgensis X14]
 gi|123387125|sp|Q1QN45|RL7_NITHX RecName: Full=50S ribosomal protein L7/L12
 gi|91799977|gb|ABE62352.1| LSU ribosomal protein L12P [Nitrobacter hamburgensis X14]
          Length = 124

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 75/126 (59%), Positives = 98/126 (77%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V A   A A +AA E+TEF V
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGAAAAAEEQTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 61  VLAA--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKLKAQLEKAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|32265861|ref|NP_859893.1| 50S ribosomal protein L7/L12 [Helicobacter hepaticus ATCC 51449]
 gi|81666346|sp|Q7VJ81|RL7_HELHP RecName: Full=50S ribosomal protein L7/L12
 gi|32261910|gb|AAP76959.1| ribosomal protein L7/L12 [Helicobacter hepaticus ATCC 51449]
          Length = 126

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E +++ + +L+++E +EL K  E+++GVSA+  V   A      G AA  EKT+F VVL 
Sbjct: 6   EEVLDYIGNLSVLELSELVKAFEEKFGVSAAPTVVAGAVAGGAGGGAAAEEKTDFNVVL- 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR IT LGLKEAK+  E  P +LK G+SK++A   KKKLE+AGA V
Sbjct: 65  -VDAGANKINVIKAVREITGLGLKEAKDATEQTPSTLKEGVSKEDAENFKKKLEEAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|322801920|gb|EFZ22473.1| hypothetical protein SINV_07411 [Solenopsis invicta]
          Length = 183

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------KT 56
            I+ I   +++L LIE AELS  L+K   +  +  + V   VA    +   E      +T
Sbjct: 54  KIDKIANDITALNLIEVAELSDLLKKRLNLPDAPMMPVGGFVAPSQAAEEEEETHKHVQT 113

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           EF V L GF D K+K+A+IKEV+++  D  L +AK+ VESAP  +K  +SKDEA +++  
Sbjct: 114 EFTVKLTGF-DEKQKVALIKEVKSLLPDTNLVQAKKFVESAPTVVKADVSKDEAEKLRDA 172

Query: 116 LEDAGATVEL 125
           L   GAT+E+
Sbjct: 173 LTKVGATIEI 182


>gi|220935500|ref|YP_002514399.1| 50S ribosomal protein L7/L12 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254806403|sp|B8GV66|RL7_THISH RecName: Full=50S ribosomal protein L7/L12
 gi|219996810|gb|ACL73412.1| 50S ribosomal protein L7/L12 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 125

 Score = 91.9 bits (227), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  +L   +E+++GVSA+A V+     AA   +AA  K EF+VV+  
Sbjct: 6   EDILETISNMTVLEIVDLISAMEEKFGVSAAAAVAAAPVAAAGGEAAAEVKDEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK +RAIT LGLKEAK++VE AP ++K G +KDEA ++KK+LE+AGA+VE
Sbjct: 66  F--GANKVGVIKVIRAITGLGLKEAKDMVEGAPSTVKEGANKDEAEKIKKELEEAGASVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|260824235|ref|XP_002607073.1| hypothetical protein BRAFLDRAFT_68136 [Branchiostoma floridae]
 gi|229292419|gb|EEN63083.1| hypothetical protein BRAFLDRAFT_68136 [Branchiostoma floridae]
          Length = 198

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 74/135 (54%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA--------PVAAEAGSAASE 54
            I+ IV+ +++LTL+E +EL+  L+K + ++ +  + +               A     E
Sbjct: 64  KIQKIVDDIATLTLLEVSELNALLKKTFNIADTPMMPMGGFAAPAPKEEEEEAAAEVKVE 123

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVE---SAPKSLKTGLSKDEAN 110
           +TEF V L  FDD   K+ +IKE++     + L +AK+ VE   + P+ +K G++K+EA 
Sbjct: 124 QTEFTVKLVKFDD-ASKVKLIKEIKTHKEGMNLVQAKKFVEATTTGPQVVKEGIAKEEAE 182

Query: 111 EMKKKLEDAGATVEL 125
            +K  LE  GA V++
Sbjct: 183 TIKAALEPLGAVVQI 197


>gi|212538109|ref|XP_002149210.1| 50S ribosomal protein L12 [Penicillium marneffei ATCC 18224]
 gi|210068952|gb|EEA23043.1| 50S ribosomal protein L12 [Penicillium marneffei ATCC 18224]
          Length = 197

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            I  IV+++S LTL+E A+L   L+    +                  AA+         
Sbjct: 63  KIVQIVDQISQLTLLETADLVASLKSRLNIPDLPVGGFAVAAGPGGAGAAAAAEEEEAAP 122

Query: 55  ----KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
               KT F + L+ F+    K  VIKE++++  L L ++K+ VES PK LK  ++KDE  
Sbjct: 123 AAAEKTLFNLKLESFEA-ASKPKVIKEIKSMLGLSLVDSKKFVESVPKLLKENVAKDECE 181

Query: 111 EMKKKLEDAGATVEL 125
           ++ + L+  GA V +
Sbjct: 182 KIIETLKGLGAKVVM 196


>gi|77024207|gb|ABA55574.1| chloroplast 50S ribosomal protein L7 [Pavlova lutheri]
          Length = 208

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 76/109 (69%), Gaps = 3/109 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--SEKTEFEV 60
             + I+E+L +LTL+EAA+L K +E+ +GV ASA   ++      A  AA   E+TEF+V
Sbjct: 38  KTDKILEELKTLTLMEAADLVKGIEEAFGVDASAGGGMMMAAPVAAAPAAVVEEQTEFDV 97

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
           +L  F    KKIAV+K VR +T LGLKEAK+LVE+APKSLK G+SK EA
Sbjct: 98  ILDSF-PADKKIAVLKVVRTLTGLGLKEAKDLVEAAPKSLKAGISKAEA 145


>gi|222823478|ref|YP_002575052.1| 50S ribosomal protein L7/L12 [Campylobacter lari RM2100]
 gi|254806269|sp|B9KFG6|RL7_CAMLR RecName: Full=50S ribosomal protein L7/L12
 gi|222538700|gb|ACM63801.1| 50S ribosomal protein L7/L12 [Campylobacter lari RM2100]
          Length = 125

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +   A VA  AG AA EKTEF++VL+ 
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGAAVAGAAGGAAEEKTEFDIVLQ- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SK EA E KK+LE+AGA VE
Sbjct: 65  -DGGDKKINVIKVVRALTGLGLKEAKDAVEQTPSVLKEGVSKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|157777896|gb|ABV70082.1| 50S ribosomal protein L12 [Heterosigma akashiwo]
          Length = 128

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 57/129 (44%), Positives = 89/129 (68%), Gaps = 4/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS---APVSVVAPVAAEAGSAASEKTE 57
           MS +++I+E+L +LTL+EA+EL +++E+ + V  S     + V      +  +A  EKTE
Sbjct: 1   MSKVDNIIEELKTLTLLEASELVQKIEETFNVDTSIGGGMMMVAGAAGTDTSAAVEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+      KKIA++K VR IT LGLKEAKELV++APK+++ G++K+ A + K  LE
Sbjct: 61  FDVVLENV-PADKKIAILKVVRTITGLGLKEAKELVDNAPKTIQEGIAKEAAEDAKTLLE 119

Query: 118 DAGATVELR 126
           +AGA + L+
Sbjct: 120 NAGAGIALK 128


>gi|212550364|ref|YP_002308681.1| 50S ribosomal protein L7/L12 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
 gi|254806256|sp|B6YPZ8|RL7_AZOPC RecName: Full=50S ribosomal protein L7/L12
 gi|212548602|dbj|BAG83270.1| 50S ribosomal protein L7/L12 [Candidatus Azobacteroides
           pseudotrichonymphae genomovar. CFP2]
          Length = 124

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E +EL++ L+ E+G+  +   SV   V+        EKT F++
Sbjct: 1   MADLKAFAEQLVNLTIKEVSELTEILKTEYGIELATSSSVATGVSTSVVEVREEKTSFDL 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LKG      K+A++K V+ +T LGLKEAK +V++AP  LK G++++EA  +KK LE+AG
Sbjct: 61  ILKGV--GTNKLAIVKLVKELTGLGLKEAKGIVDNAPAPLKEGITRNEAETLKKSLEEAG 118

Query: 121 ATVELR 126
           A +++R
Sbjct: 119 AEIDIR 124


>gi|169621363|ref|XP_001804092.1| hypothetical protein SNOG_13891 [Phaeosphaeria nodorum SN15]
 gi|111057795|gb|EAT78915.1| hypothetical protein SNOG_13891 [Phaeosphaeria nodorum SN15]
          Length = 180

 Score = 91.5 bits (226), Expect = 3e-17,   Method: Composition-based stats.
 Identities = 48/136 (35%), Positives = 73/136 (53%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------------VVAPVAAEAG 49
            I +IV+++S LTL+E A+L   L++   +                           EA 
Sbjct: 45  KIATIVDQISQLTLLETADLVSTLKERLNIPDMPMGGFVGGGAAGGAAPAAAPVEEEEAA 104

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            AA+EKT F + L+ FD    K  VIKEV+A+  L L ++K+ VESAPK +K G+ K+EA
Sbjct: 105 PAAAEKTLFNLKLEKFDAGA-KPKVIKEVKAMLGLSLVDSKKFVESAPKMMKEGVPKEEA 163

Query: 110 NEMKKKLEDAGATVEL 125
            ++ + L+  GATV +
Sbjct: 164 EKIVETLKALGATVVM 179


>gi|37912998|gb|AAR05327.1| ribosomal protein L7/L12 [uncultured marine alpha proteobacterium
           HOT2C01]
          Length = 126

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 78/126 (61%), Positives = 97/126 (76%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV++LS LT+IEAAELSK LE +WGVSA+APV+V A  AA +G AA+ + + E 
Sbjct: 1   MADLQQIVDQLSDLTVIEAAELSKMLEDKWGVSAAAPVAVAAAGAAPSGDAAAAEEKDEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVR IT LGLKEAK+LVE APK LKTG+SKDEAN  K+KLE AG
Sbjct: 61  TIVLAAAGDKKINVIKEVRTITGLGLKEAKDLVEGAPKELKTGVSKDEANGFKEKLEAAG 120

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 121 ATVELK 126


>gi|730573|sp|P41189|RL7_LIBAF RecName: Full=50S ribosomal protein L7/L12
 gi|507768|gb|AAA19556.1| ribosomal protein L12 [Candidatus Liberibacter africanus]
          Length = 125

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 99/126 (78%), Positives = 114/126 (90%), Gaps = 1/126 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVEKLSSLTL++AAELSKRLE+EWGVSA+APV+VVA  A E+ +A +EKTEFEV
Sbjct: 1   MSNIESIVEKLSSLTLLQAAELSKRLEEEWGVSAAAPVAVVASAAGESAAAVAEKTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L+GF D KKKI+VIKEVRAIT+LGLKEAK+ VESAPKSLKTG+SKDEA E+KKKLE AG
Sbjct: 61  FLEGF-DAKKKISVIKEVRAITELGLKEAKDFVESAPKSLKTGVSKDEAEELKKKLEAAG 119

Query: 121 ATVELR 126
           AT+ LR
Sbjct: 120 ATIILR 125


>gi|237751207|ref|ZP_04581687.1| ribosomal protein L7/L12 [Helicobacter bilis ATCC 43879]
 gi|229372573|gb|EEO22964.1| ribosomal protein L7/L12 [Helicobacter bilis ATCC 43879]
          Length = 125

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+  V   A     AG+AA EKTEF+VVL  
Sbjct: 6   EDVLEYIGNLSVLELSELVKAFEEKFGVSAAPTVVAGAVAGGGAGAAAEEKTEFDVVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR IT LGLKEAKE  E  P +LK G+SK++A   KKKLE+AGA VE
Sbjct: 64  VDAGANKINVIKAVREITGLGLKEAKEATEKTPNTLKEGVSKEDAENFKKKLEEAGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|256083341|ref|XP_002577904.1| mitochondrial 60S ribosomal protein L7/L12 [Schistosoma mansoni]
 gi|238663244|emb|CAZ34142.1| mitochondrial 60S ribosomal protein L7/L12, putative [Schistosoma
           mansoni]
          Length = 181

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 7/129 (5%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------KT 56
           I  IV ++SSLTL+E A+LS+ L+K+  +  + PV  +   A                KT
Sbjct: 52  IHEIVNRISSLTLLEVADLSELLQKKLNIKNTGPVMPMMGQAPINQPVEEPEEQQAPTKT 111

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F V L  FD  KK   + +  + I ++ L +AK+ VESAP ++KT +SKDEA ++KK L
Sbjct: 112 AFSVKLVKFDAAKKIQLIKEIKQVIPEMNLVQAKKFVESAPANIKTDVSKDEAEQIKKVL 171

Query: 117 EDAGATVEL 125
           E+ GA++ +
Sbjct: 172 EEVGASIAI 180


>gi|15606948|ref|NP_214330.1| ribosomal protein L7/L12 [Aquifex aeolicus VF5]
 gi|61233325|sp|P0A466|RL7_AQUAE RecName: Full=50S ribosomal protein L7/L12
 gi|61233332|sp|P0A467|RL7_AQUPY RecName: Full=50S ribosomal protein L7/L12
 gi|2598990|gb|AAB84039.1| 50S ribosomal protein L7/L12 [Aquifex pyrophilus]
 gi|2984197|gb|AAC07728.1| ribosomal protein L7/L12 [Aquifex aeolicus VF5]
          Length = 128

 Score = 91.5 bits (226), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 87/123 (70%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ IVE + +++++E AEL KRLE+E+GVSA+A V+      A AG+ A  + + E  + 
Sbjct: 6   IDEIVEAIKNMSVLEVAELVKRLEEEFGVSAAAMVAAAPAAGAAAGAPAQAEEKTEFDVI 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                K KI VIK VR IT LGLKEAKELV++APK +K G+ K+EA ++KKKLE+AGA V
Sbjct: 66  LKSPGKNKIQVIKVVREITGLGLKEAKELVDNAPKPIKEGVPKEEAEQIKKKLEEAGAEV 125

Query: 124 ELR 126
           EL+
Sbjct: 126 ELK 128


>gi|315122746|ref|YP_004063235.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496148|gb|ADR52747.1| 50S ribosomal protein L12P [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 124

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 90/126 (71%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATESV-AVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFNATS-KINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVELR 126
           AT+++R
Sbjct: 119 ATIDIR 124


>gi|297618394|ref|YP_003703553.1| ribosomal protein L7/L12 [Syntrophothermus lipocalidus DSM 12680]
 gi|297146231|gb|ADI02988.1| ribosomal protein L7/L12 [Syntrophothermus lipocalidus DSM 12680]
          Length = 126

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 87/126 (69%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS ++ ++E + ++T++E +EL K LE+E+GVSA+APV+V A  A  A  A +E+ + E 
Sbjct: 1   MSRVQEVIEIIKNMTVLELSELVKALEEEFGVSAAAPVAVAAGPAVAAAPAEAEEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KK+ VIK VR +T LGLKE+K LV+ APK +K  +SK+EA  +K K+E+AG
Sbjct: 61  DVILTSSGDKKVNVIKVVRELTGLGLKESKALVDEAPKPIKEKVSKEEAEAIKAKIEEAG 120

Query: 121 ATVELR 126
            TVE++
Sbjct: 121 GTVEIK 126


>gi|149071971|ref|YP_001293478.1| ribosomal protein L12 [Rhodomonas salina]
 gi|134302922|gb|ABO70726.1| ribosomal protein L12 [Rhodomonas salina]
          Length = 129

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 70/130 (53%), Positives = 94/130 (72%), Gaps = 5/130 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV----APVAAEAGSAASEKT 56
           MS ++ I+E+L +LTL+EA+EL K++E+ + VSA+A  + +     P A  A  AA EKT
Sbjct: 1   MSKVDEIIEQLKTLTLLEASELVKQIEETFDVSATAAAAPMAMAMVPGAGGAQEAAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF++VL+      KKIAV+K VR IT LGLKEAK+LVESAPKS+K G SKD+A   KK+L
Sbjct: 61  EFDLVLEEV-PADKKIAVLKVVRGITGLGLKEAKDLVESAPKSIKEGASKDDAEAAKKQL 119

Query: 117 EDAGATVELR 126
           E+AGA V L+
Sbjct: 120 EEAGAKVSLK 129


>gi|49474308|ref|YP_032350.1| 50S ribosomal protein L7/L12 [Bartonella quintana str. Toulouse]
 gi|81647015|sp|Q6FZL8|RL7_BARQU RecName: Full=50S ribosomal protein L7/L12
 gi|49239812|emb|CAF26203.1| 50s ribosomal protein l7 /l12 [Bartonella quintana str. Toulouse]
          Length = 123

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LTL+EAAELSK LE++W   ++A    VA VA  A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTLLEAAELSKLLEEKW-GVSAAAPVAVATVAGAAAPAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SKDEA ++K +LE AG
Sbjct: 60  IL--VDCGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKDEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VE +
Sbjct: 118 AKVEFK 123


>gi|33520001|ref|NP_878833.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia floridanus]
 gi|81666884|sp|Q7VRP6|RL7_BLOFL RecName: Full=50S ribosomal protein L7/L12
 gi|33504347|emb|CAD83240.1| 50S ribosomal subunit protein L7/L12 [Candidatus Blochmannia
           floridanus]
          Length = 126

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 56/125 (44%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-VSVVAPVAAEAGSAASEKTEFEVV 61
             E +++ +S +++++  +L   +EK++GVSA++  +S V  V  E+ S   E+TEF V+
Sbjct: 4   KKEEVLDAISEMSVMDIMQLISMIEKKFGVSAASSHISSVENVVTESESTQVEQTEFTVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L        KI VIK VR+IT LGLKEAK+LVESAP +LK  +SKD+A+ +KK LE  GA
Sbjct: 64  LSSI--GGNKIPVIKAVRSITGLGLKEAKDLVESAPVTLKESVSKDDADNLKKTLESVGA 121

Query: 122 TVELR 126
           +VE++
Sbjct: 122 SVEIK 126


>gi|119485144|ref|ZP_01619529.1| 50S ribosomal protein L7/L12 [Lyngbya sp. PCC 8106]
 gi|119457372|gb|EAW38497.1| 50S ribosomal protein L7/L12 [Lyngbya sp. PCC 8106]
          Length = 132

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 62/131 (47%), Positives = 87/131 (66%), Gaps = 7/131 (5%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV------SVVAPVAAEAGSAASEK 55
           +  + I+E+L SL+L+EA+EL K++E  +GV ASA        +    V + A     EK
Sbjct: 3   AKTDEILEQLKSLSLLEASELVKQIEDAFGVDASAVGGGGMMMAPGVNVPSPATEEVEEK 62

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+V+L  F    KKIA++K VR IT LGLKEAK+LVESAPK +K   SK++A  +KK+
Sbjct: 63  TEFDVILDEF-PSDKKIAILKVVRTITGLGLKEAKDLVESAPKPIKEATSKEDAESVKKQ 121

Query: 116 LEDAGATVELR 126
           LE+AGA V ++
Sbjct: 122 LEEAGAKVTVK 132


>gi|302830107|ref|XP_002946620.1| mitochondrial ribosomal protein L7/L12 [Volvox carteri f.
           nagariensis]
 gi|300268366|gb|EFJ52547.1| mitochondrial ribosomal protein L7/L12 [Volvox carteri f.
           nagariensis]
          Length = 194

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 52/142 (36%), Positives = 79/142 (55%), Gaps = 19/142 (13%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA------------- 48
           + ++ + +++  LT++E + LS+ L K+ GV   A  + +A                   
Sbjct: 53  TKVQKLADEIMGLTVLECSLLSEILRKKLGVPQPAFGAPMAMPFPMPTSPAAGAGPAAAA 112

Query: 49  -----GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
                     EKTEF++ L+ F   + KI VIKE+RA+T+LGLKEAKELVE AP  +K G
Sbjct: 113 PAEKKEEPKKEKTEFDIKLESFSA-EGKIKVIKEIRALTNLGLKEAKELVEKAPVLIKAG 171

Query: 104 LSKDEANEMKKKLEDAGATVEL 125
           +SK +A  MKK++E AG  V +
Sbjct: 172 VSKADAEAMKKQIEVAGGKVAI 193


>gi|283794932|ref|YP_003359285.1| ribosomal protein L12 [Cryptomonas paramecium]
 gi|253981904|gb|ACT46821.1| ribosomal protein L12 [Cryptomonas paramecium]
          Length = 129

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 87/128 (67%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           + +  ++E+L SLTL+E AEL K++E  + VSA  P   ++ ++  A +    + EKTEF
Sbjct: 3   TKVNEVLEQLKSLTLVETAELIKQIETTFNVSACLPTNTIAAISAPATQKLQESEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            +VL+G     KKIA++K VR +T LGLKEAK+LVES PK++K  ++KDE    KK+LE+
Sbjct: 63  NLVLEGV-PADKKIAILKVVRTLTGLGLKEAKDLVESTPKNIKENVTKDEVQAAKKQLEE 121

Query: 119 AGATVELR 126
           AGA V ++
Sbjct: 122 AGAKVTIK 129


>gi|256420753|ref|YP_003121406.1| 50S ribosomal protein L7/L12 [Chitinophaga pinensis DSM 2588]
 gi|256035661|gb|ACU59205.1| ribosomal protein L7/L12 [Chitinophaga pinensis DSM 2588]
          Length = 124

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E+L  LT+ E  EL+  L+ E+G+  +A   VV+       +AA EKT F V
Sbjct: 1   MADVKALAEQLVGLTVKEVQELADFLKSEYGIEPAAAAVVVSGDNGSGAAAAEEKTAFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  +    K+ V+K V+ +T LGLKEAKELV+ APKSLK G+SK EA ++K KL +AG
Sbjct: 61  ILK--NAGASKLNVVKIVKDLTGLGLKEAKELVDGAPKSLKEGVSKAEAEDLKAKLTEAG 118

Query: 121 ATVELR 126
           A VE++
Sbjct: 119 AEVEIQ 124


>gi|296116739|ref|ZP_06835347.1| 50S ribosomal protein L7/L12 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976707|gb|EFG83477.1| 50S ribosomal protein L7/L12 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 123

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV  VA  AA   +AA EKTEF+V
Sbjct: 1   MADLNKLVDELSALTVLEAAELSKLLEEKWGVSAAAPV-AVAAAAAAPAAAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA ++KK LED G
Sbjct: 60  VLA--KAGDKKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVSKDEAEKIKKTLEDNG 117

Query: 121 ATVELR 126
           A+VE++
Sbjct: 118 ASVEIK 123


>gi|188996247|ref|YP_001930498.1| ribosomal protein L7/L12 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226734483|sp|B2V7M1|RL7_SULSY RecName: Full=50S ribosomal protein L7/L12
 gi|188931314|gb|ACD65944.1| ribosomal protein L7/L12 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 128

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 85/122 (69%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I E + S+T++E A+L K LE+E+GVSA+A V+        AG+AA  + + E  +  
Sbjct: 7   EEIKEAIKSMTVLELAQLVKDLEEEFGVSAAAMVAAAPAAGGAAGAAAPAEEKTEFDVIL 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAK+LV+ APK +K G+SKDEA ++KKKLE+AGATVE
Sbjct: 67  TNAGANKINVIKVVREITGLGLKEAKDLVDGAPKPVKEGVSKDEAEQIKKKLEEAGATVE 126

Query: 125 LR 126
           ++
Sbjct: 127 VK 128


>gi|120436716|ref|YP_862402.1| 50S ribosomal protein L7/L12 [Gramella forsetii KT0803]
 gi|166222171|sp|A0M3Z0|RL7_GRAFK RecName: Full=50S ribosomal protein L7/L12
 gi|117578866|emb|CAL67335.1| 50S ribosomal protein L7/L12 [Gramella forsetii KT0803]
          Length = 124

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G  A E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGGAAGGEEAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L        K+AV+K V+ +T LGLK+AK LV+ APK +K G++KDEA  +K +LE+AG
Sbjct: 61  ILTA--PGGSKLAVVKLVKELTGLGLKDAKALVDEAPKPVKEGVAKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|83312240|ref|YP_422504.1| 50S ribosomal protein L7/L12 [Magnetospirillum magneticum AMB-1]
 gi|109893772|sp|Q2W2I0|RL7_MAGMM RecName: Full=50S ribosomal protein L7/L12
 gi|82947081|dbj|BAE51945.1| Ribosomal protein L7/L12 [Magnetospirillum magneticum AMB-1]
          Length = 124

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 103/126 (81%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V+ LS+LT++EAAELSK LE++WGVSA+APV+V A  A  A  AA E+TEF+V
Sbjct: 1   MADLAKLVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAAGAAAPAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D  +KKI VIKEVRAIT LGLKEAK+LVE+APKS+K G+SKDEA ++KK LE+AG
Sbjct: 61  ILT--DAGEKKINVIKEVRAITGLGLKEAKDLVEAAPKSVKDGVSKDEAEKIKKVLEEAG 118

Query: 121 ATVELR 126
           A V+++
Sbjct: 119 AKVQVK 124


>gi|320352909|ref|YP_004194248.1| 50S ribosomal protein L12P [Desulfobulbus propionicus DSM 2032]
 gi|320121411|gb|ADW16957.1| LSU ribosomal protein L12P [Desulfobulbus propionicus DSM 2032]
          Length = 126

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 92/123 (74%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           + +++ +S++T++E +EL K LE+++GVSA+APV+V A  A   G AA+E KTEF+V+L 
Sbjct: 6   QDVIDFISNMTVLELSELIKELEEKFGVSAAAPVAVAAVAAPAEGGAAAEEKTEFDVILT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +   +KI VIKEVRAIT LGLKEAK+LVE  P  +K G+SKDEA  +K ++E AG TV
Sbjct: 66  --NAGDQKIKVIKEVRAITSLGLKEAKDLVEGVPAPIKEGVSKDEAAAIKTQIEGAGGTV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|158319534|ref|YP_001512041.1| ribosomal protein L7/L12 [Alkaliphilus oremlandii OhILAs]
 gi|166990980|sp|A8MLD1|RL7_ALKOO RecName: Full=50S ribosomal protein L7/L12
 gi|158139733|gb|ABW18045.1| ribosomal protein L7/L12 [Alkaliphilus oremlandii OhILAs]
          Length = 121

 Score = 91.1 bits (225), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 87/123 (70%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E + ++ ++E  EL K  E+++GVSASAPV V  PVA  A     E+TEF+VVL+
Sbjct: 3   IEQILEAIENMKVLELNELVKAAEEKFGVSASAPVVVGGPVAGAAVE--EEQTEFDVVLE 60

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KI VIK VR +T LGLKEAKE V+ APK+LK G+SK+EA ++K KLE+AGA V
Sbjct: 61  --NAGASKINVIKVVRELTGLGLKEAKEAVDGAPKTLKEGVSKEEAEQIKAKLEEAGAAV 118

Query: 124 ELR 126
            ++
Sbjct: 119 TVK 121


>gi|283954232|ref|ZP_06371756.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 414]
 gi|283794250|gb|EFC32995.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 414]
          Length = 125

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF+VVL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGAAAAAEEKTEFDVVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E+KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEVKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|305664387|ref|YP_003860674.1| putative 50S ribosomal protein L7/L12 [Maribacter sp. HTCC2170]
 gi|88708404|gb|EAR00640.1| putative 50S ribosomal protein L7/L12 [Maribacter sp. HTCC2170]
          Length = 126

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 80/126 (63%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA     A    + + + E 
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELADILKDEYGIEPAAAAVAVAAGGGAAEGGEAAEEQSEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        K+AV+K V+ +T LGLK+AK++V+SAPK++K G+SKDEA  +KK LE+AG
Sbjct: 61  DVILTAAGGSKLAVVKLVKELTGLGLKDAKDIVDSAPKAVKEGVSKDEAEGIKKSLEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|315639009|ref|ZP_07894179.1| ribosomal protein L7/L12 [Campylobacter upsaliensis JV21]
 gi|315480921|gb|EFU71555.1| ribosomal protein L7/L12 [Campylobacter upsaliensis JV21]
          Length = 125

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A    +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGGAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K +A E KK+LE+AGA VE
Sbjct: 65  -DSGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKADAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|89893204|ref|YP_516691.1| 50S ribosomal protein L7/L12 [Desulfitobacterium hafniense Y51]
 gi|219666477|ref|YP_002456912.1| 50S ribosomal protein L7/L12 [Desulfitobacterium hafniense DCB-2]
 gi|123091865|sp|Q250P5|RL7_DESHY RecName: Full=50S ribosomal protein L7/L12
 gi|254806370|sp|B8G1V3|RL7_DESHD RecName: Full=50S ribosomal protein L7/L12
 gi|89332652|dbj|BAE82247.1| 50S ribosomal protein L7/L12 [Desulfitobacterium hafniense Y51]
 gi|219536737|gb|ACL18476.1| ribosomal protein L7/L12 [Desulfitobacterium hafniense DCB-2]
          Length = 124

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 87/126 (69%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS    I+E +  LT++E AEL K  E+E+GVSA+APV+V A   A A   A E+TEF+V
Sbjct: 1   MSKTAEILEAVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAPGAAAAPVAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +    KI VIK VR IT LGLKEAKELV+ APK +K  +SKD+A  +K KL +AG
Sbjct: 61  VL--MNAGAGKINVIKVVREITGLGLKEAKELVDGAPKPVKEKVSKDDAEAIKAKLVEAG 118

Query: 121 ATVELR 126
           ATVE++
Sbjct: 119 ATVEVK 124


>gi|237756129|ref|ZP_04584702.1| ribosomal protein L7/L12 [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691714|gb|EEP60749.1| ribosomal protein L7/L12 [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 128

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 86/122 (70%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I E + S+T++E A+L K LE+E+GVSA+A V+     A  AG+AA  + + E  +  
Sbjct: 7   EEIKEAIKSMTVLELAQLVKDLEEEFGVSAAAMVAAAPAAAGAAGAAAPAEEKTEFDVIL 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAK+LV+ APK +K G+SK+EA ++KKKLE+AGATVE
Sbjct: 67  TNAGANKINVIKVVREITGLGLKEAKDLVDGAPKPVKEGVSKEEAEQIKKKLEEAGATVE 126

Query: 125 LR 126
           ++
Sbjct: 127 IK 128


>gi|163745525|ref|ZP_02152885.1| 50S ribosomal protein L7/L12 [Oceanibulbus indolifex HEL-45]
 gi|161382343|gb|EDQ06752.1| 50S ribosomal protein L7/L12 [Oceanibulbus indolifex HEL-45]
          Length = 123

 Score = 91.1 bits (225), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+ G+A  EKTEF+V
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGGAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEEIKGKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|55742214|ref|NP_001006886.1| mitochondrial ribosomal protein L12 [Xenopus (Silurana) tropicalis]
 gi|50416673|gb|AAH77682.1| mitochondrial ribosomal protein L12 [Xenopus (Silurana) tropicalis]
          Length = 189

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 43/135 (31%), Positives = 68/135 (50%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS-----------ASAPVSVVAPVAAEAGSA 51
            I ++V++++SLTL+E +E ++ L K   +            + A  +            
Sbjct: 55  KIHNLVDQIASLTLLEVSEFNELLRKTLKIQDVGMMPMGSMLSGATAAPSQAAEEAEAPG 114

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEAN 110
             EKT F V L   +    K+ +IKEV+     L L +AK+LVE+ P+ +K  +SKDEA 
Sbjct: 115 KKEKTHFTVKLTEVNATD-KVKLIKEVKNCIQGLNLVQAKKLVEALPQEIKANVSKDEAE 173

Query: 111 EMKKKLEDAGATVEL 125
           ++K  LE AG  V L
Sbjct: 174 KIKAALEAAGGKVAL 188


>gi|225017236|ref|ZP_03706428.1| hypothetical protein CLOSTMETH_01162 [Clostridium methylpentosum
           DSM 5476]
 gi|224950011|gb|EEG31220.1| hypothetical protein CLOSTMETH_01162 [Clostridium methylpentosum
           DSM 5476]
          Length = 122

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 92/126 (73%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I   +E + +LT++E  EL K +E+E+GVSA+AP  V+   AA  G AA+EKTEF+V
Sbjct: 1   MADIAKFIEDIKALTVLELNELVKAIEEEFGVSAAAP--VMMAGAAAGGEAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L        K+ VIK V+ IT LGLKEAKE+V++APK++K G+SK +A EMK KLE AG
Sbjct: 59  ILTEVGSG--KMNVIKAVKEITGLGLKEAKEIVDNAPKAVKEGVSKADAEEMKTKLEGAG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|209964029|ref|YP_002296944.1| ribosomal protein L7 [Rhodospirillum centenum SW]
 gi|226733728|sp|B6IRP5|RL7_RHOCS RecName: Full=50S ribosomal protein L7/L12
 gi|209957495|gb|ACI98131.1| ribosomal protein L7 [Rhodospirillum centenum SW]
          Length = 126

 Score = 90.7 bits (224), Expect = 5e-17,   Method: Composition-based stats.
 Identities = 74/126 (58%), Positives = 99/126 (78%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS +E +VE LS+LT++EAAELSK LE++WGVSA+APV+V A  AA A +AA  + + E 
Sbjct: 1   MSKLEKLVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAPAAAAAAAAPVEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D   KKI VIKEVRAIT+LGLKEAK+LVE APK++K G +KDEA ++KK+LE+AG
Sbjct: 61  TVILVDGGDKKINVIKEVRAITNLGLKEAKDLVEGAPKTVKEGATKDEAAKIKKQLEEAG 120

Query: 121 ATVELR 126
           A V+++
Sbjct: 121 AKVDIK 126


>gi|154303406|ref|XP_001552110.1| hypothetical protein BC1G_09274 [Botryotinia fuckeliana B05.10]
 gi|150854585|gb|EDN29777.1| hypothetical protein BC1G_09274 [Botryotinia fuckeliana B05.10]
          Length = 180

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 43/131 (32%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGV--------SASAPVSVVAPVAAEAGSAASE 54
            I  IV+++S LTL+E A+L   L+    +        SA    +       +A     E
Sbjct: 50  KISGIVDQISQLTLLETADLVASLKSRLNIPDMPMGGFSAGPVQAAAPVEEEDAAPVQQE 109

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KT F + L  FD    K  +IKE++++  L L ++K+ VESAPK +K G+ K+EA ++  
Sbjct: 110 KTLFNLKLASFDAGA-KPKIIKEIKSMLGLSLVDSKKFVESAPKMMKEGVPKEEAEKIIA 168

Query: 115 KLEDAGATVEL 125
            L++ GA V +
Sbjct: 169 TLKELGAVVNM 179


>gi|548746|sp|P36688|RK12_NICSY RecName: Full=50S ribosomal protein L12, chloroplastic; AltName:
           Full=CL12; Flags: Precursor
 gi|248303|gb|AAB21989.1| ribosomal protein L12 [Nicotiana sylvestris]
          Length = 186

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 53/127 (41%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEF 58
            +  + +++S+LTL +A +L + L+ + GV+A++        A  A + A      KTEF
Sbjct: 60  KVVQLGDEISNLTLADAQKLVEYLQDKLGVTAASFAPAAVVAAPGAAAEAPAVVEEKTEF 119

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IA IK VRA+T L LKEAKEL+E  PK  K G+SKDEA + KK+LE+
Sbjct: 120 DVVIDEVPSNA-RIATIKAVRALTSLALKEAKELIEGLPKKFKEGVSKDEAEDAKKQLEE 178

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 179 AGAKVSI 185


>gi|94971703|ref|YP_593751.1| 50S ribosomal protein L7/L12 [Candidatus Koribacter versatilis
           Ellin345]
 gi|122986008|sp|Q1IHH3|RL7_ACIBL RecName: Full=50S ribosomal protein L7/L12
 gi|94553753|gb|ABF43677.1| LSU ribosomal protein L12P [Candidatus Koribacter versatilis
           Ellin345]
          Length = 126

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 84/126 (66%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  + E++  L+L++AAEL K+LE   GVSA+A   V+      A +AA  + + E 
Sbjct: 1   MADLAQLEEQIVGLSLLDAAELVKKLESRLGVSAAAAAPVMVAGGGGAAAAAPVEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIK VR +T LGLKEAK+LV+ APK++K G+SKDEA  ++KK ++AG
Sbjct: 61  TVVLTAAGANKINVIKAVREVTSLGLKEAKDLVDGAPKTVKEGVSKDEAATIQKKFQEAG 120

Query: 121 ATVELR 126
           ATVE++
Sbjct: 121 ATVEVK 126


>gi|124506409|ref|XP_001351802.1| organelle ribosomal protein L7/L12 precursor, putative [Plasmodium
           falciparum 3D7]
 gi|23504828|emb|CAD51609.1| organelle ribosomal protein L7/L12 precursor, putative [Plasmodium
           falciparum 3D7]
          Length = 257

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 39/134 (29%), Positives = 72/134 (53%), Gaps = 9/134 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE---- 57
           S ++ I+E L +LTL+EA+EL K++E  + V     ++       E     S+  E    
Sbjct: 124 SKVDEIIESLKNLTLLEASELVKKIELTFSVDTKQNLNASNSSGQENKQNESDGKENEED 183

Query: 58  -----FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
                ++++L+  +  KK   +        DL LK+AK+LV++ P++L   ++K+ A++ 
Sbjct: 184 EENKVYDLILENIEPNKKIPIIKIVKEIKKDLNLKQAKDLVDNLPQTLFEKVNKETADKW 243

Query: 113 KKKLEDAGATVELR 126
           K KL +AG  V+L+
Sbjct: 244 KTKLTEAGGIVKLK 257


>gi|221056855|ref|XP_002259565.1| 50S ribosomal subunit protein L12 [Plasmodium knowlesi strain H]
 gi|193809637|emb|CAQ40338.1| 50S ribosomal subunit protein L12, putative [Plasmodium knowlesi
           strain H]
          Length = 246

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 9/133 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE----- 57
            +  I+E L  LTL+EA+EL K++E  + V     +           +A           
Sbjct: 114 KVNKIIESLKELTLLEASELVKQIETTFSVDTRQSIGSSNNEQDNKNNAGDANANEEEND 173

Query: 58  ----FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
               ++++L+  +  KK   +        DL LK+AK+LV++ P++L   ++K+ A++ K
Sbjct: 174 ENKVYDLILENIEPNKKIPIIKIVKEIKKDLNLKQAKDLVDNLPQTLFEKVNKETADKWK 233

Query: 114 KKLEDAGATVELR 126
            KL +AG  V+L+
Sbjct: 234 AKLTEAGGIVKLK 246


>gi|189095316|ref|YP_001936329.1| ribosomal protein L12 [Heterosigma akashiwo]
 gi|157694659|gb|ABV65935.1| 50S ribosomal protein L12 [Heterosigma akashiwo]
          Length = 128

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 58/129 (44%), Positives = 89/129 (68%), Gaps = 4/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS---APVSVVAPVAAEAGSAASEKTE 57
           MS +++I+E+L +LTL+EA+EL +++E+ + V  S     + V      E  +A  EKTE
Sbjct: 1   MSKVDNIIEELKTLTLLEASELVQKIEETFNVDTSIGGGMMMVAGAAGTETSAAVEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+      KKIA++K VR IT LGLKEAKELV++APK+++ G++K+ A + K  LE
Sbjct: 61  FDVVLENV-PADKKIAILKVVRTITGLGLKEAKELVDNAPKTIQEGIAKEAAEDAKTLLE 119

Query: 118 DAGATVELR 126
           +AGA + L+
Sbjct: 120 NAGAGIALK 128


>gi|296282027|ref|ZP_06860025.1| ribosomal protein L7/L12 [Citromicrobium bathyomarinum JL354]
          Length = 124

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 94/126 (74%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  +VE+LS LT++EAA+L+K LE+EWGVSA+A V+V  P A     AA EK EF+V
Sbjct: 1   MADIAKLVEELSKLTVLEAADLAKALEEEWGVSAAAAVAVAGPAAGGDAPAAEEKDEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGL EAK LVE APK LK G++K EA E+K K+E AG
Sbjct: 61  ILTG--DGGKKIQVIKEVRAITGLGLTEAKALVEGAPKPLKEGVNKAEAEEVKSKIEAAG 118

Query: 121 ATVELR 126
            TVEL+
Sbjct: 119 GTVELK 124


>gi|78044942|ref|YP_361129.1| 50S ribosomal protein L7/L12 [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|109893754|sp|Q3A9Q5|RL7_CARHZ RecName: Full=50S ribosomal protein L7/L12
 gi|77997057|gb|ABB15956.1| ribosomal protein L7/L12 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 127

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 91/129 (70%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           MS ++ I+E + SLT++E AEL K  E+E+GVSA+APV+V A  AA A +A     EKTE
Sbjct: 1   MSKVQEILEAVKSLTVLELAELVKAFEEEFGVSAAAPVAVAAAPAAGAAAAAPAQEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L       +K+ VIK VR IT LGLKE+K+LV+ APK +K  +SK +A  +K KLE
Sbjct: 61  FDVIL--VSPGAQKVNVIKVVREITGLGLKESKDLVDGAPKPVKEKVSKADAEAIKAKLE 118

Query: 118 DAGATVELR 126
           + GATVE++
Sbjct: 119 EVGATVEIK 127


>gi|110681146|ref|YP_684153.1| 50S ribosomal protein L7/L12 [Roseobacter denitrificans OCh 114]
 gi|123172019|sp|Q160X6|RL7_ROSDO RecName: Full=50S ribosomal protein L7/L12
 gi|109457262|gb|ABG33467.1| ribosomal protein L7/L12 [Roseobacter denitrificans OCh 114]
          Length = 123

 Score = 90.7 bits (224), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A+AG+A  EKTEF+V
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       KI VIKEVR IT LGLKEAK+LVE+  K +K G  K EA E+K KLE AG
Sbjct: 61  VLKS--PGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGCDKAEAEEIKGKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|325094757|gb|EGC48067.1| 50S ribosomal protein [Ajellomyces capsulatus H88]
          Length = 194

 Score = 90.7 bits (224), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------------VVAPVAAEAGS 50
            I  IV+++S LTL+E A+L   L+    +                     A    EA  
Sbjct: 60  KITQIVDQISQLTLLETADLVSSLKSRLNIPDLPIGGFAAGPAAGGAAPAAAVEEEEAAP 119

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKT F + L+ F D   K  VIKE++++  L L ++K+ VE APK +K  + K+EA 
Sbjct: 120 AAQEKTLFNLKLESF-DAASKPKVIKEIKSLLSLSLVDSKKFVEGAPKVMKESVPKEEAE 178

Query: 111 EMKKKLEDAGATVEL 125
           ++ K ++D GA V +
Sbjct: 179 KIVKTMKDLGAKVVM 193


>gi|52694910|gb|AAU85606.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694914|gb|AAU85608.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694928|gb|AAU85615.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694934|gb|AAU85618.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694936|gb|AAU85619.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     +E  +L   +E+++GV+A+   ++    A+   + + E+TEF+V+L  
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA-ISAIGGGAASTGATDSEEQTEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|260469683|ref|ZP_05813845.1| ribosomal protein L7/L12 [Mesorhizobium opportunistum WSM2075]
 gi|259028542|gb|EEW29856.1| ribosomal protein L7/L12 [Mesorhizobium opportunistum WSM2075]
          Length = 125

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IV+ LS LT++EAAELSK LE++WGVSA+APV+V A   A A +A   EKTEF+
Sbjct: 1   MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAAPVEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE+APK +K G+SK +A++ K +LE A
Sbjct: 61  VVLT--DAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEGVSKADADKFKAQLEAA 118

Query: 120 GATVELR 126
           GA V+L+
Sbjct: 119 GAKVDLK 125


>gi|13470541|ref|NP_102109.1| 50S ribosomal protein L7/L12 [Mesorhizobium loti MAFF303099]
 gi|20978569|sp|Q98N67|RL7_RHILO RecName: Full=50S ribosomal protein L7/L12
 gi|14021282|dbj|BAB47895.1| 50S ribosomal protein L7/L12 [Mesorhizobium loti MAFF303099]
          Length = 125

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IV+ LS LT++EAAELSK LE++WGVSA+APV+V A   A A +A   EKTEF+
Sbjct: 1   MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAAPAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE+APK +K G+SK +A++ K +LE A
Sbjct: 61  VVLT--DAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEGVSKADADKFKAQLEAA 118

Query: 120 GATVELR 126
           GA V+L+
Sbjct: 119 GAKVDLK 125


>gi|109948062|ref|YP_665290.1| 50S ribosomal protein L7/L12 [Helicobacter acinonychis str. Sheeba]
 gi|123362513|sp|Q17VN5|RL7_HELAH RecName: Full=50S ribosomal protein L7/L12
 gi|109715283|emb|CAK00291.1| 50S ribosomal protein L7/L12 [Helicobacter acinonychis str. Sheeba]
          Length = 125

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKT+F V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAVAESEEKTDFNVIL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 64  ADSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|52694892|gb|AAU85597.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694922|gb|AAU85612.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694926|gb|AAU85614.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|52694932|gb|AAU85617.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     +E  +L   +E+++GV+A+   +V    A+   + + E+TEF+V+L  
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA-ISAVGGGAASTGSTDSEEQTEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|147903617|ref|NP_001088496.1| mitochondrial ribosomal protein L12 [Xenopus laevis]
 gi|54311322|gb|AAH84828.1| LOC495364 protein [Xenopus laevis]
          Length = 190

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 68/135 (50%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS-----------APVSVVAPVAAEAGSA 51
            I  +V++++SLTL+E +EL++ L +   +              A  +           A
Sbjct: 56  KIHQLVDQIASLTLLEVSELNELLRRTLKIQDVGMMPMGSMMPGASATPSQDAEESEAPA 115

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEAN 110
             EKT F V L   +    K+ +IKEV+     L L +AK+LVE+ P+ +K  +SKDEA 
Sbjct: 116 KKEKTNFTVKLTEVNATD-KVKLIKEVKNCIQGLNLVQAKKLVEALPQEIKANVSKDEAE 174

Query: 111 EMKKKLEDAGATVEL 125
           ++K  LE AG  V L
Sbjct: 175 KIKTALEAAGGKVVL 189


>gi|103487185|ref|YP_616746.1| 50S ribosomal protein L7/L12 [Sphingopyxis alaskensis RB2256]
 gi|122984980|sp|Q1GSF9|RL7_SPHAL RecName: Full=50S ribosomal protein L7/L12
 gi|98977262|gb|ABF53413.1| LSU ribosomal protein L12P [Sphingopyxis alaskensis RB2256]
          Length = 125

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 80/127 (62%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+A V+V AP  A A + A  EK EF+
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAAVAVAAPGGAGAAAPAAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L G  D   KI VIKEVRAIT LGL EAK LVE APK++K G SK EA E+KKKLE A
Sbjct: 61  VILTG--DGGNKINVIKEVRAITGLGLGEAKALVEGAPKAVKEGASKAEAEELKKKLEAA 118

Query: 120 GATVELR 126
           GATVEL+
Sbjct: 119 GATVELK 125


>gi|114331773|ref|YP_747995.1| ribosomal protein L7/L12 [Nitrosomonas eutropha C91]
 gi|114308787|gb|ABI60030.1| LSU ribosomal protein L12P [Nitrosomonas eutropha C91]
          Length = 121

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 60/121 (49%), Positives = 89/121 (73%), Gaps = 4/121 (3%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            I+E ++++T++E +EL K LE+++GVSA+APV+V    A  A +A  E+TEF V+L   
Sbjct: 5   EILESIANMTVLELSELIKELEEKFGVSAAAPVAVA--AAPAAAAAVEEQTEFSVILTS- 61

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                K+ VIK VRA+T LGLKEAK+LV+SAPK++K G+SKD+A  +KK+L +AGA  E+
Sbjct: 62  -AGDNKVNVIKVVRAVTGLGLKEAKDLVDSAPKAVKEGISKDDAEALKKQLTEAGAGCEI 120

Query: 126 R 126
           +
Sbjct: 121 K 121


>gi|218683242|gb|ACL00660.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. CA DP-1]
 gi|247797366|gb|ACT09142.1| 50S ribosomal protein L12 [Candidatus Liberibacter solanacearum]
 gi|247797369|gb|ACT09144.1| 50S ribosomal protein L12 [Candidatus Liberibacter solanacearum]
          Length = 123

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 90/125 (72%), Positives = 108/125 (86%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATESV-AVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFNATS-KINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVEL 125
           AT+++
Sbjct: 119 ATIDI 123


>gi|288957412|ref|YP_003447753.1| large subunit ribosomal protein L7/L12 [Azospirillum sp. B510]
 gi|288909720|dbj|BAI71209.1| large subunit ribosomal protein L7/L12 [Azospirillum sp. B510]
          Length = 125

 Score = 90.4 bits (223), Expect = 7e-17,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ +V+ LS+LT++EAAELSK LE++WGVSA+APV+V A   A A +A   E+TEF 
Sbjct: 1   MADLQKLVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAGPAAAAAAPVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D   KKI VIKEVRAIT LGLKEAK+LVE APK +K G +KDEA ++KK+LE+A
Sbjct: 61  VILA--DAGDKKINVIKEVRAITGLGLKEAKDLVEGAPKPVKEGATKDEAAKIKKQLEEA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDIK 125


>gi|189207432|ref|XP_001940050.1| 54S ribosomal protein L12, mitochondrial precursor [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187976143|gb|EDU42769.1| 54S ribosomal protein L12, mitochondrial precursor [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 183

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 47/136 (34%), Positives = 72/136 (52%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------------VVAPVAAEAG 49
            I +IV+++S LTL+E A+L   L+    +                           EA 
Sbjct: 48  KIATIVDQISQLTLLETADLVSTLKTRLNIPDMPMGGFAAGPGGAGPAAAAAPVEEEEAA 107

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            AA+EKT F + L+ FD    K  VIKE++A+  L L ++K+ VESAPK +K G+ K+EA
Sbjct: 108 PAAAEKTLFNLKLEKFDAGA-KPKVIKEIKAMLGLSLVDSKKFVESAPKMMKEGVPKEEA 166

Query: 110 NEMKKKLEDAGATVEL 125
            ++ + L+  GATV +
Sbjct: 167 EKIVETLKALGATVVM 182


>gi|148702808|gb|EDL34755.1| mitochondrial ribosomal protein L12 [Mus musculus]
          Length = 214

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE--------------A 48
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V                  
Sbjct: 77  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEED 136

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKD 107
                E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K 
Sbjct: 137 VPKQKERTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKA 195

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++K  LE  G TV L
Sbjct: 196 EAEKIKAALEAVGGTVVL 213


>gi|224372231|ref|YP_002606603.1| ribosomal protein L7/L12 [Nautilia profundicola AmH]
 gi|254806386|sp|B9L7J5|RL7_NAUPA RecName: Full=50S ribosomal protein L7/L12
 gi|223588832|gb|ACM92568.1| ribosomal protein L7/L12 [Nautilia profundicola AmH]
          Length = 124

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + +LT+ E  EL K  E+++ VSA  P  V       AG A  EKTEF+V+LK 
Sbjct: 6   EQILETIENLTVKELNELVKLFEEKFDVSA-QPTVVAGAAGGAAGGAGEEKTEFDVILK- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR IT  GLKEAKE+V+ AP ++K  +SK+EA E+KK+LE+AGATVE
Sbjct: 64  -DAGAKKINVIKVVRQITGAGLKEAKEIVDGAPSTIKEAVSKEEAEEIKKQLEEAGATVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|171686864|ref|XP_001908373.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943393|emb|CAP69046.1| unnamed protein product [Podospora anserina S mat+]
          Length = 178

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 47/134 (35%), Positives = 70/134 (52%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----------VVAPVAAEAGSA 51
            I +IV+++S LTL+E A+L   L+    +                       A +A  A
Sbjct: 45  KISAIVDQISQLTLLETADLVASLKSRLNIPDLPVGGFAAAAAPAAAPAAVEEAEDAAPA 104

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           A+EKT F V L  FD    K  VIKEV+ +  L L ++K+ VESAPK +K  + KDEA +
Sbjct: 105 AAEKTLFSVKLMAFDAGA-KPKVIKEVKNLLGLSLVDSKKFVESAPKLMKESVPKDEAEK 163

Query: 112 MKKKLEDAGATVEL 125
           +   +++ GATV +
Sbjct: 164 IVATMKELGATVVM 177


>gi|11467764|ref|NP_050815.1| ribosomal protein L12 [Nephroselmis olivacea]
 gi|14195158|sp|Q9TL30|RK12_NEPOL RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|5880693|gb|AAD54786.1|AF137379_9 ribosomal protein L12 [Nephroselmis olivacea]
          Length = 128

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 67/129 (51%), Positives = 94/129 (72%), Gaps = 4/129 (3%)

Query: 1   MSNI-ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--SEKTE 57
           MS I   I+E+L S+TL+EAAEL  ++E+ +GV ASAP +    VAA A SA    E+TE
Sbjct: 1   MSTITNQIIEQLKSMTLLEAAELVSQIEETFGVDASAPAAGAVMVAAAAPSAPVVEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V++       K+IAVIK VRA+T LGLKEAK+++ES PK++K G+ KDEA ++K++LE
Sbjct: 61  FTVMINDV-PSAKRIAVIKVVRALTGLGLKEAKDMIESVPKAIKEGIGKDEAQQIKQQLE 119

Query: 118 DAGATVELR 126
           +AGATV ++
Sbjct: 120 EAGATVTVK 128


>gi|72086543|ref|XP_790377.1| PREDICTED: similar to mitochondrial ribosomal protein L12
           [Strongylocentrotus purpuratus]
 gi|115971251|ref|XP_001185158.1| PREDICTED: similar to mitochondrial ribosomal protein L12
           [Strongylocentrotus purpuratus]
          Length = 212

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 78/134 (58%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            I S+V+++++L L E ++L++ L+K   +  +  ++V A  A  A +   +        
Sbjct: 79  KISSLVDQIAALKLSEVSDLNELLKKTLNIQDAPMMAVGAAPAVAASAEQEDDEGDVVKA 138

Query: 55  --KTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANE 111
             KT+F V L  FDD   K+ +IK ++A+T  + L +AK+ VESAP+ +K  + K EA E
Sbjct: 139 PEKTQFTVKLNKFDDTS-KVKLIKAIKALTSGMNLVQAKKFVESAPQVVKADVGKTEAEE 197

Query: 112 MKKKLEDAGATVEL 125
           + K+L +AG T E+
Sbjct: 198 IMKQLTEAGGTCEI 211


>gi|89273426|emb|CAJ82102.1| mitochondrial ribosomal protein [Xenopus (Silurana) tropicalis]
          Length = 189

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 43/135 (31%), Positives = 68/135 (50%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS-----------ASAPVSVVAPVAAEAGSA 51
            I ++V++++SLTL+E +E ++ L K   +            + A  +            
Sbjct: 55  KIHNLVDQIASLTLLEVSEFNELLRKTLKIQDVGMMPMGSMLSGATAAPSQAAEEAEAPG 114

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEAN 110
             EKT F V L   +    K+ +IKEV+     L L +AK+LVE+ P+ +K  +SKDEA 
Sbjct: 115 KKEKTHFTVKLTEVNATD-KVKLIKEVKNCIQGLNLVQAKKLVEALPQEIKANVSKDEAE 173

Query: 111 EMKKKLEDAGATVEL 125
           ++K  LE AG  V L
Sbjct: 174 KIKAALEAAGGKVAL 188


>gi|332042973|gb|EGI79171.1| ribosomal protein L7/L12 [Lacinutrix algicola 5H-3-7-4]
          Length = 124

 Score = 90.4 bits (223), Expect = 8e-17,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    +A   A  G AA E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAMAGPVAGGGDAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAK LV+ AP ++K  +SKDEA  +K +LE+AG
Sbjct: 61  ILKA--PGSAKLAVVKLVKELTGLGLKEAKGLVDEAPSAIKEAVSKDEAEALKSQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|71892327|ref|YP_278061.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia pennsylvanicus
           str. BPEN]
 gi|109893747|sp|Q492B8|RL7_BLOPB RecName: Full=50S ribosomal protein L7/L12
 gi|71796433|gb|AAZ41184.1| 50S ribosomal subunit protein L7/L12 [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
          Length = 122

 Score = 90.4 bits (223), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 79/122 (64%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +S++++++   L+  +E+++GVS ++  +V       + +   E+TEF V L  
Sbjct: 6   EQILDAISNMSVMDIVRLTSMMEEKFGVSTASLTTVEP---DTSEAIVEEQTEFNVFLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR+IT LGLKEAKELVESAP  LK  ++KD+A  +KK LE  GA+VE
Sbjct: 63  I--GNNKIPVIKTVRSITGLGLKEAKELVESAPVILKESINKDDAETLKKTLETVGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|225706832|gb|ACO09262.1| 39S ribosomal protein L12, mitochondrial precursor [Osmerus mordax]
          Length = 192

 Score = 90.0 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 45/133 (33%), Positives = 71/133 (53%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE---------AGSAAS 53
            I  +V  ++SLTL+E ++L++ L+K   +     + + A   A          A     
Sbjct: 60  KIHQLVNDIASLTLLEVSDLNELLKKTLNIQDVGMMPMGAMAGAAPISQAVEEEAAPIEK 119

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           EKT F V L       +K+ +IKEV+  +  L L +AK+LVES P+ ++  +SK+EA ++
Sbjct: 120 EKTHFTVKLTELKA-AEKVKLIKEVKNSMQGLNLVQAKKLVESLPQEIRVNVSKEEAEKL 178

Query: 113 KKKLEDAGATVEL 125
           K  LE AG TV L
Sbjct: 179 KAALEAAGGTVVL 191


>gi|255948712|ref|XP_002565123.1| Pc22g11770 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592140|emb|CAP98465.1| Pc22g11770 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 192

 Score = 90.0 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 38/135 (28%), Positives = 64/135 (47%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            I  IV+++S+LTL+E A+L   L+    +                G+AA          
Sbjct: 58  KISQIVDQISTLTLLETADLVSSLKTRLNIPDLPVGGFAMAAGGGPGAAAPAAEEEEAAP 117

Query: 55  ----KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
               KT F + L+ F+    K  VIKE++ +  L L ++K+ VE+ PK LK  + K+EA 
Sbjct: 118 AAAEKTLFNLKLESFEPTS-KPKVIKEIKTMLGLSLVDSKKFVEAVPKVLKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++ +  +  GA   +
Sbjct: 177 KLIETFKALGAKATM 191


>gi|317177943|dbj|BAJ55732.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F16]
          Length = 125

 Score = 90.0 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAATESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|225555442|gb|EEH03734.1| 50S ribosomal protein L12 [Ajellomyces capsulatus G186AR]
          Length = 194

 Score = 90.0 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------------VVAPVAAEAGS 50
            I  IV+++S LTL+E A+L   L+    +                     A    EA  
Sbjct: 60  KITQIVDQISQLTLLETADLVSSLKSRLNIPDLPIGGFAAGPAAGGAAPAAAVEEEEAAP 119

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKT F + L+ F D   K  VIKE++++  L L ++K+ VE APK +K  + K+EA 
Sbjct: 120 AAQEKTLFNLKLESF-DAASKPKVIKEIKSLLSLSLVDSKKFVEGAPKVMKESVPKEEAE 178

Query: 111 EMKKKLEDAGATVEL 125
           ++ K ++D GA V +
Sbjct: 179 KIVKTMKDLGAKVVM 193


>gi|195952635|ref|YP_002120925.1| 50S ribosomal protein L7/L12 [Hydrogenobaculum sp. Y04AAS1]
 gi|226733698|sp|B4U736|RL7_HYDS0 RecName: Full=50S ribosomal protein L7/L12
 gi|195932247|gb|ACG56947.1| ribosomal protein L7/L12 [Hydrogenobaculum sp. Y04AAS1]
          Length = 127

 Score = 90.0 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 64/124 (51%), Positives = 90/124 (72%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVL 62
           I+ IV+ +S +T++E AEL K+LE+++GVSA+A V+        A S A  EKTEF+V+L
Sbjct: 6   IDEIVDAISGMTVLEVAELVKKLEEKFGVSAAAMVAASPAAGGAAASPAAEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  D    K+ VIK VR +T LGLKEAK+LV+ APK +K G+SK+EA  +KKKLE+AGA 
Sbjct: 66  Q--DAGANKLNVIKVVRELTGLGLKEAKDLVDGAPKPIKQGVSKEEAENIKKKLEEAGAK 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEVK 127


>gi|114327210|ref|YP_744367.1| 50S ribosomal protein L7/L12 [Granulibacter bethesdensis CGDNIH1]
 gi|122327809|sp|Q0BUQ8|RL7_GRABC RecName: Full=50S ribosomal protein L7/L12
 gi|114315384|gb|ABI61444.1| LSU ribosomal protein L12P (L7/L12) [Granulibacter bethesdensis
           CGDNIH1]
          Length = 125

 Score = 90.0 bits (222), Expect = 9e-17,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++ ++VE+LSSLT++EAAELSK LE++WGVSA+APV+V A  AA A +A   E+TEF 
Sbjct: 1   MADLSNLVEQLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAPAAGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L       KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++KK LE+ 
Sbjct: 61  VIL--AKAGDKKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKVLEEQ 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAAVEIK 125


>gi|291280156|ref|YP_003496991.1| 50S ribosomal protein L7/L12 [Deferribacter desulfuricans SSM1]
 gi|290754858|dbj|BAI81235.1| 50S ribosomal protein L7/L12 [Deferribacter desulfuricans SSM1]
          Length = 128

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 89/125 (71%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E ++E + +++++E AE  K LE+++GVSA+APV++VA     AG+       KTEF+V+
Sbjct: 6   EQVIEFIENMSVLELAEFVKELEEKFGVSAAAPVAMVAGAPGAAGAGEGGAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      KK+ VIK VR IT LGLKEAK LV+ AP  +K G++K+EA ++K KLE+AGA
Sbjct: 66  LQS--AGDKKVQVIKVVREITGLGLKEAKALVDGAPSPVKEGVAKEEAEQIKAKLEEAGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIK 128


>gi|261886296|ref|ZP_06010335.1| 50S ribosomal protein L7/L12 [Campylobacter fetus subsp. venerealis
           str. Azul-94]
          Length = 124

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GV A+ PV V       A  AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVGAA-PVMVAGAAGGAAVEAAEEKTEFNIVL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 63  VDAGDKKIHVIKVVRALTGLGLKEAKDAVEGTPSVLKEGVSKDEAEAAKKELEEAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|62262766|gb|AAX78101.1| unknown protein [synthetic construct]
          Length = 160

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  +L K +E ++GVSA+A V+V A   A    AA EKTEF+VVL  
Sbjct: 32  EDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAAVAVAAGPVAGPAEAAEEKTEFDVVL-- 89

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KIA IK VR  T LGLKEAK+ VE  P ++K   SK+EA  +KK+LE+AGA VE
Sbjct: 90  VDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKEEAEVLKKQLEEAGAKVE 149

Query: 125 LR 126
           L+
Sbjct: 150 LK 151


>gi|219685444|ref|ZP_03540262.1| ribosomal protein L7/L12 [Borrelia garinii Far04]
 gi|52694930|gb|AAU85616.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
 gi|219673000|gb|EED30021.1| ribosomal protein L7/L12 [Borrelia garinii Far04]
          Length = 124

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     +E  +L   +E+++GV+A+   +V    A+   + + E+TEF+V+L  
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA-ISAVGGGAASIGSTDSEEQTEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|110634170|ref|YP_674378.1| 50S ribosomal protein L7/L12 [Mesorhizobium sp. BNC1]
 gi|123353587|sp|Q11HB2|RL7_MESSB RecName: Full=50S ribosomal protein L7/L12
 gi|110285154|gb|ABG63213.1| LSU ribosomal protein L12P [Chelativorans sp. BNC1]
          Length = 125

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 80/127 (62%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A A +AA  EKTEF+
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKMLEEKWGVSAAAPVAVAAAGGAAAPAAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLA--DAGAQKINVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKIKAQLEGA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|118474733|ref|YP_892469.1| 50S ribosomal protein L7/L12 [Campylobacter fetus subsp. fetus
           82-40]
 gi|166222151|sp|A0RQI6|RL7_CAMFF RecName: Full=50S ribosomal protein L7/L12
 gi|118413959|gb|ABK82379.1| ribosomal protein L7/L12 [Campylobacter fetus subsp. fetus 82-40]
          Length = 124

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+ PV V       A  AA EKTEF +VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAA-PVMVAGAAGGAAVEAAEEKTEFNIVL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P  LK G+SKDEA   KK+LE+AGA VE
Sbjct: 63  VDAGDKKINVIKVVRALTGLGLKEAKDAVEGTPSVLKEGVSKDEAEAAKKELEEAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|85858137|ref|YP_460339.1| 50S ribosomal protein L7/L12 [Syntrophus aciditrophicus SB]
 gi|85721228|gb|ABC76171.1| LSU ribosomal protein L7/L12 [Syntrophus aciditrophicus SB]
          Length = 140

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 83/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +V+ +  +T++E +EL K LE+ +GVSA+APV+V A   A   +AA  + + E     
Sbjct: 19  EDVVKFIEGMTVLELSELVKELEERFGVSAAAPVAVAAVAGAAGEAAAPAEEKTEFDAIL 78

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VRAIT LGLKEAK+LVE APK +K  +SKDEA ++KKK+E+ G TVE
Sbjct: 79  TGFGDQKIQVIKVVRAITGLGLKEAKDLVEGAPKPIKEAVSKDEAADIKKKIEEVGGTVE 138

Query: 125 LR 126
           ++
Sbjct: 139 VK 140


>gi|148260946|ref|YP_001235073.1| 50S ribosomal protein L7/L12 [Acidiphilium cryptum JF-5]
 gi|326404344|ref|YP_004284426.1| 50S ribosomal protein L7/L12 [Acidiphilium multivorum AIU301]
 gi|166222127|sp|A5FZX2|RL7_ACICJ RecName: Full=50S ribosomal protein L7/L12
 gi|146402627|gb|ABQ31154.1| LSU ribosomal protein L12P [Acidiphilium cryptum JF-5]
 gi|325051206|dbj|BAJ81544.1| 50S ribosomal protein L7/L12 [Acidiphilium multivorum AIU301]
          Length = 127

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 75/128 (58%), Positives = 100/128 (78%), Gaps = 5/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTE 57
           M+++ ++VE+LSSLT++EAAELSK LE++WGVSA+APV+V A   A  G+AA    EKTE
Sbjct: 1   MADLANLVEQLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAPAGGGAAAAPVEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LK      KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++KK LE
Sbjct: 61  FNVILKS--SGDKKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKVLE 118

Query: 118 DAGATVEL 125
           + GA+V +
Sbjct: 119 EQGASVGI 126


>gi|57504728|ref|ZP_00370782.1| ribosomal protein L7/L12 [Campylobacter coli RM2228]
 gi|305433032|ref|ZP_07402188.1| ribosomal protein L7/L12 [Campylobacter coli JV20]
 gi|57019384|gb|EAL56082.1| ribosomal protein L7/L12 [Campylobacter coli RM2228]
 gi|304443733|gb|EFM36390.1| ribosomal protein L7/L12 [Campylobacter coli JV20]
          Length = 125

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGAAAAAEEKTEFDIVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K +A E KK+LE+AGA VE
Sbjct: 64  VDGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKADAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|319760674|ref|YP_004124612.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia vafer str.
           BVAF]
 gi|318039388|gb|ADV33938.1| 50S ribosomal protein L7/L12 [Candidatus Blochmannia vafer str.
           BVAF]
          Length = 126

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 48/125 (38%), Positives = 79/125 (63%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFEVV 61
             E I++ +S +++++  +L   +EK++GV +   ++     +   +     E+TEF V+
Sbjct: 4   KKEEILDGISEMSVMDIMQLVSMIEKKFGVVSGPFITNNETKITESSQPTEPEQTEFTVI 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L        KI VIK VR+IT LGLKE+KELVESAP +LK  +SK +A ++KK+LE+ GA
Sbjct: 64  LSVV--GNNKIPVIKMVRSITGLGLKESKELVESAPVTLKESMSKTDAEDLKKQLEEIGA 121

Query: 122 TVELR 126
            +E++
Sbjct: 122 KIEIK 126


>gi|42475536|ref|NP_963900.1| 39S ribosomal protein L12, mitochondrial precursor [Bos taurus]
 gi|75058087|sp|Q7YR75|RM12_BOVIN RecName: Full=39S ribosomal protein L12, mitochondrial;
           Short=L12mt; Short=MRP-L12; Flags: Precursor
 gi|33468812|dbj|BAC81567.1| mitochondrial ribosomal protein L7/12 [Bos taurus]
 gi|59857835|gb|AAX08752.1| mitochondrial ribosomal protein L12 [Bos taurus]
 gi|59857875|gb|AAX08772.1| mitochondrial ribosomal protein L12 [Bos taurus]
 gi|59858329|gb|AAX08999.1| mitochondrial ribosomal protein L12 [Bos taurus]
 gi|146231924|gb|ABQ13037.1| mitochondrial ribosomal protein L12 [Bos taurus]
 gi|157279096|gb|AAI34768.1| Mitochondrial ribosomal protein L12 [Bos taurus]
 gi|296476116|gb|DAA18231.1| 39S ribosomal protein L12, mitochondrial precursor [Bos taurus]
          Length = 198

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 67/136 (49%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE------------AGS 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V                  
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAAPAPTAPEAAEEDVP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
              E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 KQKERTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE  G TV L
Sbjct: 182 EKIKAALEAVGGTVVL 197


>gi|261193054|ref|XP_002622933.1| 50S ribosomal protein L12 [Ajellomyces dermatitidis SLH14081]
 gi|239589068|gb|EEQ71711.1| 50S ribosomal protein L12 [Ajellomyces dermatitidis SLH14081]
 gi|239613650|gb|EEQ90637.1| 50S ribosomal protein L12 [Ajellomyces dermatitidis ER-3]
 gi|327352593|gb|EGE81450.1| 50S ribosomal protein L12 [Ajellomyces dermatitidis ATCC 18188]
          Length = 192

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 45/133 (33%), Positives = 70/133 (52%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA----------PVSVVAPVAAEAGSAA 52
            I  IV+++S LTL+E A+L   L+    +                +  A    E   AA
Sbjct: 60  KITQIVDQISQLTLLETADLVSSLKSRLNIPDLPIGGFAAGPAGGAAPAAVEEEEPAPAA 119

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F + L+ FD    K  VIKE++++  L L ++K+ VESAPK +K  + K+EA ++
Sbjct: 120 QEKTLFNLKLESFDAGS-KPKVIKEIKSLLSLSLVDSKKFVESAPKVMKESVPKEEAEKI 178

Query: 113 KKKLEDAGATVEL 125
            K ++D GA V +
Sbjct: 179 VKAMKDLGAKVVM 191


>gi|254516897|ref|ZP_05128955.1| ribosomal protein L7/L12 [gamma proteobacterium NOR5-3]
 gi|219674402|gb|EED30770.1| ribosomal protein L7/L12 [gamma proteobacterium NOR5-3]
          Length = 125

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++E  EL   +E+++GV+A+A V+     A +AG+AA E+TEF+V+L  
Sbjct: 6   DDILTAIAEMSVMEVVELIDAMEEKFGVTAAAAVAAAPAAAGDAGAAAEEQTEFDVMLTA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KK+ VIK VRA+T LGLKEAK LV+ AP ++K G SKDEA ++KK+LE+AG + E
Sbjct: 66  --AGDKKVNVIKVVRAVTGLGLKEAKGLVDGAPSAIKEGASKDEAEDIKKQLEEAGGSAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|62955369|ref|NP_001017696.1| 39S ribosomal protein L12, mitochondrial [Danio rerio]
 gi|62205434|gb|AAH93312.1| Mitochondrial ribosomal protein L12 [Danio rerio]
          Length = 194

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 72/134 (53%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA----------A 52
            I+ +V  ++SLTLIE ++L++ L+K   +     +S+ +  A                 
Sbjct: 61  KIQQLVNDIASLTLIEVSDLNELLKKTLNIQDVGMMSMGSMAAVPVAPPAEAEEEVAPAK 120

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANE 111
            EKT F + L  F     K+ +IKEV+     + L +AK+LVES P+ ++T +SKDEA +
Sbjct: 121 KEKTHFTIKLTEFKAAD-KVKLIKEVKNCMEGINLVQAKKLVESLPQEIRTNISKDEAEK 179

Query: 112 MKKKLEDAGATVEL 125
           +K  LE AG TV L
Sbjct: 180 LKSALEAAGGTVVL 193


>gi|319405857|emb|CBI79489.1| 50S ribosomal protein L7/L12 [Bartonella sp. AR 15-3]
          Length = 122

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 69/126 (54%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W    SA   V       A  A  EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW--GVSAAAPVAVAAVGTAAPAVEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE  PK +K G SKDEA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGVPKPIKEGASKDEAEKIKAQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|110639543|ref|YP_679752.1| 50S ribosomal protein L7/L12 [Cytophaga hutchinsonii ATCC 33406]
 gi|122966546|sp|Q11QA4|RL7_CYTH3 RecName: Full=50S ribosomal protein L7/L12
 gi|110282224|gb|ABG60410.1| LSU ribosomal protein L12P [Cytophaga hutchinsonii ATCC 33406]
          Length = 123

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L+ E+G+  +A  +VV     +A +A  EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELASILKDEYGIEPAA-AAVVVSGGGDAAAAVEEKTAFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAK+LV+ APK +K G SKDEA  +KK+LE+AG
Sbjct: 60  ILKS--AGASKLAVVKLVKDLTGLGLKEAKDLVDGAPKPVKEGASKDEAEAIKKQLEEAG 117

Query: 121 ATVELR 126
           A VE++
Sbjct: 118 AEVEIK 123


>gi|88812765|ref|ZP_01128011.1| ribosomal protein L7/L12 [Nitrococcus mobilis Nb-231]
 gi|88790003|gb|EAR21124.1| ribosomal protein L7/L12 [Nitrococcus mobilis Nb-231]
          Length = 126

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL   +E+++GV+A+A V+      A A  AA E+TEF+V+L  
Sbjct: 7   EDILETIGNMTVMEVVELIDAMEEKFGVTAAAAVAAAPAAGAGAAEAAEEQTEFDVILSS 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK  RA+T LGLKEAKELVESAP  +K G+ K+EANE+K KLE+AGA+VE
Sbjct: 67  F--GANKVAVIKAARAVTGLGLKEAKELVESAPVPIKEGIPKEEANEIKGKLEEAGASVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|307168916|gb|EFN61816.1| 39S ribosomal protein L12, mitochondrial [Camponotus floridanus]
          Length = 184

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 47/130 (36%), Positives = 71/130 (54%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA------ASEKT 56
            I+ I   +S+L LIE A+LS  L+K   +  +  + +   VAA              +T
Sbjct: 55  KIDKIANDISALNLIEVAQLSDLLKKRLNLPDAPVMPMGGFVAAPQVEEEEEQVQKRVQT 114

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            F V L G+ D K+KI +IKE++ +  D  L +AK+ VES P  +K  L+KDEA ++K+ 
Sbjct: 115 SFTVKLTGY-DEKQKIPLIKEIKNLLPDTNLVQAKKFVESVPTIVKADLAKDEAEKLKES 173

Query: 116 LEDAGATVEL 125
           L   G TVE+
Sbjct: 174 LLKVGGTVEI 183


>gi|320593170|gb|EFX05579.1| 50S ribosomal protein l12 [Grosmannia clavigera kw1407]
          Length = 194

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--------VVAPVAAEAGSAASE 54
            I +IV+++S LTL+E A L   L+    +                 A    EA +A +E
Sbjct: 64  KIAAIVDQISQLTLLETASLVSSLKTRLNIPDLPVGGFAAAPAAAPAAAEEEEAPAAPAE 123

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           K+ F V L GF+    K  VIKE++ +  L L ++K+ VESAPK++K  + KDEA +M  
Sbjct: 124 KSLFTVKLVGFEAGS-KPKVIKEIKNLLGLSLVDSKKFVESAPKTMKESVPKDEAEKMIA 182

Query: 115 KLEDAGATVEL 125
            L++ GA V +
Sbjct: 183 ALKELGANVTM 193


>gi|86158016|ref|YP_464801.1| 50S ribosomal protein L12P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|109893745|sp|Q2II87|RL7_ANADE RecName: Full=50S ribosomal protein L7/L12
 gi|85774527|gb|ABC81364.1| LSU ribosomal protein L12P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 124

 Score = 90.0 bits (222), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 74/126 (58%), Positives = 95/126 (75%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ +IVE+LS LT++EAAEL K+LE++WGVSA+A   ++A   A A +   EKTEF V
Sbjct: 1   MADLNAIVEQLSGLTIMEAAELVKQLEEKWGVSAAAAPVMMAGGPAAAAAPVEEKTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KI VIKEVRAIT LGLKEAK+LVE APK +K G++K EA E+KKKLE AG
Sbjct: 61  VL--ADAGANKINVIKEVRAITGLGLKEAKDLVEGAPKEVKAGVAKAEAEELKKKLEAAG 118

Query: 121 ATVELR 126
           A VE++
Sbjct: 119 AKVEVK 124


>gi|260425427|ref|ZP_05779407.1| ribosomal protein L7/L12 [Citreicella sp. SE45]
 gi|260423367|gb|EEX16617.1| ribosomal protein L7/L12 [Citreicella sp. SE45]
          Length = 126

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 87/126 (69%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E++  LTL+EA EL   L+ E+G+  +A  +V+    A  G AA+E+ + E 
Sbjct: 1   MADLKALAEQIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAAGGEAAAEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA  +KK+LE+AG
Sbjct: 61  DVILKSAGDKKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEAIKKQLEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|313892109|ref|ZP_07825704.1| ribosomal protein L7/L12 [Dialister microaerophilus UPII 345-E]
 gi|329121901|ref|ZP_08250515.1| 50S ribosomal protein L7/L12 [Dialister micraerophilus DSM 19965]
 gi|313119464|gb|EFR42661.1| ribosomal protein L7/L12 [Dialister microaerophilus UPII 345-E]
 gi|327467698|gb|EGF13194.1| 50S ribosomal protein L7/L12 [Dialister micraerophilus DSM 19965]
          Length = 123

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 93/122 (76%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +SS++++E +EL K +E+++GVSA+APV+V A  A  AG AA EK+EF+V+LK 
Sbjct: 4   EEILEAISSMSVLELSELVKAIEEKFGVSAAAPVAVAAAAAPAAGEAAEEKSEFDVILK- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLK+AK LV+ APK +KTG++K EA EMKKK E  GATVE
Sbjct: 63  -DAGSQKIQVIKVVREITGLGLKDAKGLVDGAPKEVKTGVAKAEAEEMKKKFEAVGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|218683246|gb|ACL00662.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. Burns]
 gi|218683250|gb|ACL00664.1| 50S ribosomal protein L12 [Candidatus Liberibacter sp. Saltillo
           9-08]
 gi|269838641|gb|ACZ48686.1| 50S ribosomal protein L12 [Candidatus Liberibacter solanacearum]
          Length = 123

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 89/125 (71%), Positives = 106/125 (84%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAP +V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPAAVSASAATESV-AVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFNATS-KINVIKEVRAITSLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 ATVEL 125
           AT+++
Sbjct: 119 ATIDI 123


>gi|307201071|gb|EFN81003.1| 39S ribosomal protein L12, mitochondrial [Harpegnathos saltator]
          Length = 176

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 48/127 (37%), Positives = 74/127 (58%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV---VAPVAAEAGSAASEKTEFE 59
            I+ I   +++L LIE AELS  L+K   +S +  + +    A    E+      +T F 
Sbjct: 50  KIDKIANDITALNLIEVAELSDLLKKRLNLSDAPVMPMGGYAAMPVEESEEPTKVQTSFT 109

Query: 60  VVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           V L  FDD K+KIA+IKEV+ +  D  L +AK+ +E+ P  ++  +SKDEA ++K+ L  
Sbjct: 110 VKLLSFDD-KQKIALIKEVKNLLPDTNLVQAKKFIENVPAIVQADISKDEAEKLKESLMK 168

Query: 119 AGATVEL 125
            GATVE+
Sbjct: 169 VGATVEI 175


>gi|315045023|ref|XP_003171887.1| 54S ribosomal protein L12 [Arthroderma gypseum CBS 118893]
 gi|311344230|gb|EFR03433.1| 54S ribosomal protein L12 [Arthroderma gypseum CBS 118893]
          Length = 192

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------------VVAPVAAEAGS 50
            I  IV+++S LTL+E A+L   L+    +                     A    EA  
Sbjct: 58  KITKIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAAAAPGGAAAPAAAAEEEEAAP 117

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKT F + L+ F D   K  +IKEV+++  L L E+K+ VES PK +K  + K+EA 
Sbjct: 118 AAQEKTLFNLKLESF-DAASKAKIIKEVKSMLGLSLVESKKFVESVPKVIKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++   L+  GA   +
Sbjct: 177 KIVASLKALGAVATM 191


>gi|195610950|gb|ACG27305.1| 50S ribosomal protein L12-1 [Zea mays]
 gi|224031431|gb|ACN34791.1| unknown [Zea mays]
          Length = 183

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 52/130 (40%), Positives = 74/130 (56%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------K 55
            +  + + ++ LTL EA  L   L++  GV+A+A        A  AG  A+        K
Sbjct: 54  KVLELGDTIAGLTLEEARNLVDHLQERLGVTAAAFAPAAVVAAPGAGGGAAAEEEAPVEK 113

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+VV++       +IA IK VR +T L LKEAK+L+E  PK LK  +SKDEA + KK+
Sbjct: 114 TEFDVVIEEV-PSSARIATIKVVRVLTSLALKEAKDLIEGLPKKLKEAVSKDEAEDAKKQ 172

Query: 116 LEDAGATVEL 125
           LE+ GA V +
Sbjct: 173 LEEVGAKVSI 182


>gi|121601836|ref|YP_988880.1| 50S ribosomal protein L7/L12 [Bartonella bacilliformis KC583]
 gi|166222137|sp|A1USC7|RL7_BARBK RecName: Full=50S ribosomal protein L7/L12
 gi|120614013|gb|ABM44614.1| ribosomal protein L7/L12 [Bartonella bacilliformis KC583]
          Length = 123

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 94/126 (74%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W   ++A    VA V + A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW-GVSAAAPVAVAAVGSAAAPAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G+SKDEA ++K +LE AG
Sbjct: 60  VL--VDGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGVSKDEAEKIKAQLEAAG 117

Query: 121 ATVELR 126
           A +EL+
Sbjct: 118 AKIELK 123


>gi|162149181|ref|YP_001603642.1| 50S ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209545075|ref|YP_002277304.1| 50S ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|189042997|sp|A9H3S4|RL7_GLUDA RecName: Full=50S ribosomal protein L7/L12
 gi|161787758|emb|CAP57354.1| 50S ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|209532752|gb|ACI52689.1| ribosomal protein L7/L12 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 125

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 100/127 (78%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  AA A +A   E+TEF 
Sbjct: 1   MADLTKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAAPAAGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++KK LED 
Sbjct: 61  VVL--AKAGDKKINVIKEIRGITGLGLKEAKDLVEGAPKTVKEGVNKDEAEKIKKLLEDN 118

Query: 120 GATVELR 126
           GA+VE++
Sbjct: 119 GASVEVK 125


>gi|91977664|ref|YP_570323.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris BisB5]
 gi|123735286|sp|Q134R7|RL7_RHOPS RecName: Full=50S ribosomal protein L7/L12
 gi|91684120|gb|ABE40422.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris BisB5]
          Length = 123

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 75/126 (59%), Positives = 96/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A     A +A  EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAA-APGAAAAAVEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 60  VLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPIKEGVNKDEAEKLKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|156088113|ref|XP_001611463.1| hypothetical protein [Babesia bovis T2Bo]
 gi|154798717|gb|EDO07895.1| hypothetical protein BBOV_III003310 [Babesia bovis]
          Length = 236

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 48/138 (34%), Positives = 78/138 (56%), Gaps = 13/138 (9%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------- 53
           S ++ I+E L +LTL+E +EL K++E+ +GVSAS  VS    V++    AA         
Sbjct: 99  SKVDDILEDLKTLTLLETSELVKKIEETFGVSASMAVSAAPAVSSGPAVAAPAEEDDDED 158

Query: 54  ---EKTEFEVV-LKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDE 108
              +KT FEVV L+  ++   ++A+ + +R +  D  L E K  +++AP +LK    ++E
Sbjct: 159 ERKKKTSFEVVLLERPEEQSVRMALFRMLRKVMPDKPLTEVKAAIDNAPSTLKVCGREEE 218

Query: 109 ANEMKKKLEDAGATVELR 126
           A E  K +E AG   E+R
Sbjct: 219 AKEALKIIEGAGGKAEIR 236


>gi|167465652|ref|ZP_02330741.1| 50S ribosomal protein L7/L12 [Paenibacillus larvae subsp. larvae
           BRL-230010]
 gi|322381136|ref|ZP_08055139.1| 50S ribosomal protein L7/L12-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321154712|gb|EFX46983.1| 50S ribosomal protein L7/L12-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 122

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T++E  +L K +E+E+GV+A+APV+V+   A  A +AA  ++EF+VVL  
Sbjct: 4   EQILEAIKGMTVLELNDLVKAIEEEFGVTAAAPVAVMGGAAGGADAAAE-QSEFDVVLT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAKELV++APK++K  + K+EA  ++ KL DAGA VE
Sbjct: 62  -NPGASKINVIKVVREITGLGLKEAKELVDNAPKAIKEKVRKEEAEAIQAKLSDAGANVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|39976951|ref|XP_369863.1| hypothetical protein MGG_06378 [Magnaporthe oryzae 70-15]
 gi|145016214|gb|EDK00704.1| hypothetical protein MGG_06378 [Magnaporthe oryzae 70-15]
          Length = 177

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------VVAPVAAEAGSAA 52
            I +IV+++S LTL+E AEL   L+    +                   A  A E   AA
Sbjct: 45  KITTIVDQISQLTLLETAELVSSLKSRLNIPDLPVGGFAAAAPAAAPAAAEEADEPAPAA 104

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           + KT F + L  FD    K  +IKEV+ +  L L ++K+ VESAPK +K  + K++A ++
Sbjct: 105 AAKTVFTLKLMSFDAGA-KAKIIKEVKGLLGLSLVDSKKFVESAPKVMKESVPKEDAEKI 163

Query: 113 KKKLEDAGATVEL 125
              +++ GA V +
Sbjct: 164 IATMKELGAVVTM 176


>gi|224014403|ref|XP_002296864.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220968501|gb|EED86848.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 182

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 50/127 (39%), Positives = 72/127 (56%), Gaps = 6/127 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-----VSVVAPVAAEAGSAASEKTEF 58
           + S+ +++  L ++E  +L  R+   +G +          +  A    E      EKT F
Sbjct: 56  LHSLADQIVHLNMMEVKQLMDRIGGHFGFADDDGGYDDDNTGAAAGEGEEAEVVEEKTIF 115

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           ++ L  F D K KI VIKE+R +T LGLKEAKELVE AP ++K G+  +EA E+K KLE 
Sbjct: 116 DLKLVAF-DAKAKIKVIKEIRGVTSLGLKEAKELVEGAPTTVKKGIKMEEAEELKAKLEA 174

Query: 119 AGATVEL 125
            GA VE+
Sbjct: 175 VGAQVEI 181


>gi|108762798|ref|YP_631279.1| 50S ribosomal protein L7/L12 [Myxococcus xanthus DK 1622]
 gi|123247806|sp|Q1D7U4|RL7_MYXXD RecName: Full=50S ribosomal protein L7/L12
 gi|108466678|gb|ABF91863.1| ribosomal protein L7/L12 [Myxococcus xanthus DK 1622]
          Length = 122

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 66/126 (52%), Positives = 91/126 (72%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++ +IV++LSSLT++EAAEL K+LE +W    SA    VA   A A +   EKTEF V
Sbjct: 1   MADLNAIVDQLSSLTVLEAAELVKQLESKW--GVSAAAVAVAAGPAAAAAPVEEKTEFTV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +    KI VIKE+RAIT LGLKEAK+LVE APK++K G++KD+A ++K +L  AG
Sbjct: 59  VLA--NAGANKINVIKEIRAITGLGLKEAKDLVEGAPKNVKEGVNKDDAKKIKDQLTAAG 116

Query: 121 ATVELR 126
           ATV+++
Sbjct: 117 ATVDIK 122


>gi|242309993|ref|ZP_04809148.1| 50S ribosomal protein L7/L12 [Helicobacter pullorum MIT 98-5489]
 gi|239523290|gb|EEQ63156.1| 50S ribosomal protein L7/L12 [Helicobacter pullorum MIT 98-5489]
          Length = 125

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+  V     VA  A     EKTEF+++L  
Sbjct: 6   EEVLEYIGNLSVMELSELVKAFEEKFGVSAAPTVVAGGAVAGGAAGGGEEKTEFDIILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR +T LGLKEAK+ VE  P ++K G+ K++A  +K K E+AGA VE
Sbjct: 65  -DSGDKKINVIKVVREVTGLGLKEAKDAVEKTPFTVKEGVKKEDAEAIKAKFEEAGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|218462359|ref|ZP_03502450.1| 50S ribosomal protein L7/L12 [Rhizobium etli Kim 5]
          Length = 126

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 70/126 (55%), Positives = 93/126 (73%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +A  E+ + E 
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAGGAGAAAPVEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLEDAG
Sbjct: 61  DVILTDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLEDAG 120

Query: 121 ATVELR 126
           A  +++
Sbjct: 121 AKADVK 126


>gi|261839920|gb|ACX99685.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 52]
 gi|317182450|dbj|BAJ60234.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F57]
          Length = 125

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAATESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|163732879|ref|ZP_02140324.1| 50S ribosomal protein L7/L12 [Roseobacter litoralis Och 149]
 gi|161394239|gb|EDQ18563.1| 50S ribosomal protein L7/L12 [Roseobacter litoralis Och 149]
          Length = 123

 Score = 89.6 bits (221), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A+AG+A  EKTEF+V
Sbjct: 1   MADLKKMAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       KI VIKEVR IT LGLKEAK+LVE+  K +K G  K EA E+K KLE AG
Sbjct: 61  VLKS--PGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGCDKAEAEEIKGKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|313683393|ref|YP_004061131.1| LSU ribosomal protein l12p [Sulfuricurvum kujiense DSM 16994]
 gi|313156253|gb|ADR34931.1| LSU ribosomal protein L12P [Sulfuricurvum kujiense DSM 16994]
          Length = 124

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +S+L+++E +EL K  E+++GVSA  PV+V     A AG+A  EKTEF+V+LK 
Sbjct: 6   QDVLEFISNLSVLELSELVKEFEEKFGVSA-QPVAVAGGAVAAAGAAEEEKTEFDVILK- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE AP +LK G+SK +A   KK+LE+AGA VE
Sbjct: 64  -DGGDKKINVIKVVRAMTGLGLKEAKDAVEGAPTTLKEGISKQDAEAAKKELEEAGAVVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|258569893|ref|XP_002543750.1| hypothetical protein UREG_03267 [Uncinocarpus reesii 1704]
 gi|237904020|gb|EEP78421.1| hypothetical protein UREG_03267 [Uncinocarpus reesii 1704]
          Length = 183

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 66/134 (49%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----------VVAPVAAEAGSA 51
            I  IV+++S LTL+E A+L   L+    +                    A    E   A
Sbjct: 50  KITQIVDQISQLTLLETADLVSSLKSRLNIPDLPVGGFAMPAGGAAPGAAAAEEDEPAPA 109

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           A EKT F + L+ F D   K  VIKEV+++  L L E+K+ VES PK +K  + K+EA +
Sbjct: 110 AQEKTLFNLKLESF-DAASKAKVIKEVKSMLGLSLVESKKFVESVPKVMKESVPKEEAEK 168

Query: 112 MKKKLEDAGATVEL 125
           + + L+  GA   L
Sbjct: 169 IVETLKALGAKAVL 182


>gi|146340045|ref|YP_001205093.1| 50S ribosomal protein L7/L12 [Bradyrhizobium sp. ORS278]
 gi|166222140|sp|A4YSI0|RL7_BRASO RecName: Full=50S ribosomal protein L7/L12
 gi|146192851|emb|CAL76856.1| 50S ribosomal subunit protein L7/L12 [Bradyrhizobium sp. ORS278]
          Length = 125

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V AP    A +A   EKTEF 
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAPGGGGAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++K+EA ++K +LE A
Sbjct: 61  VVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKEEAEKIKGQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|18409467|ref|NP_564986.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|13430422|gb|AAK25833.1|AF360123_1 unknown protein [Arabidopsis thaliana]
 gi|2194123|gb|AAB61098.1| Similar to Secale chloroplast ribosomal protein L12 (gb|SCL121A).
           EST gb|H36579 comes from this gene [Arabidopsis
           thaliana]
 gi|15293181|gb|AAK93701.1| unknown protein [Arabidopsis thaliana]
 gi|332196909|gb|AEE35030.1| ribosomal protein L7/L12 domain-containing protein [Arabidopsis
           thaliana]
 gi|332196910|gb|AEE35031.1| ribosomal protein L7/L12 domain-containing protein [Arabidopsis
           thaliana]
          Length = 208

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 54/136 (39%), Positives = 79/136 (58%), Gaps = 17/136 (12%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP----------------VAAEAG 49
            +V+++SSLTL+E +EL   + K+ G++    V+V+ P                 +  + 
Sbjct: 73  RLVDEISSLTLLEISELGSIIMKKKGMTELPTVAVMKPGAGGGVGVGGGGGMVSQSGVSE 132

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A  EKT FE+ L+ F+    KI +IKE+R+ TDLGLKEAK LVE  P  LK GLSK+E 
Sbjct: 133 EAKVEKTVFEIKLESFEASA-KIKIIKELRSFTDLGLKEAKALVEKTPAILKAGLSKEEG 191

Query: 110 NEMKKKLEDAGATVEL 125
            ++ +KL+  GA V L
Sbjct: 192 EKILEKLKALGAKVVL 207


>gi|308497434|ref|XP_003110904.1| hypothetical protein CRE_04620 [Caenorhabditis remanei]
 gi|308242784|gb|EFO86736.1| hypothetical protein CRE_04620 [Caenorhabditis remanei]
          Length = 202

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 51/136 (37%), Positives = 79/136 (58%), Gaps = 13/136 (9%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--------- 52
           S + S+VE++++L+L++ ++L+  L+K   +     ++  A   A A + A         
Sbjct: 67  SKVSSLVEEIANLSLLDVSDLNWALKKRLNIPDQPLMAASAFAPAAAAAPAAQAEAEATS 126

Query: 53  --SEKTEFEVVLKGFDDPKKKIAVIKEVR-AITDLGLKEAKELVESAPKSLKTGLSKDEA 109
              +K  F V L  FDD K KIA+IKE+R AI  L L +AK+ VE+AP ++K  L K EA
Sbjct: 127 DVPQKMTFTVKLTKFDDTK-KIAIIKEIRNAIPGLNLVQAKKFVETAPVNVKEDLGKAEA 185

Query: 110 NEMKKKLEDAGATVEL 125
            E+K  LE AGA +E+
Sbjct: 186 EELKGILEKAGAVIEI 201


>gi|111115219|ref|YP_709837.1| 50S ribosomal protein L7/L12 [Borrelia afzelii PKo]
 gi|216263895|ref|ZP_03435889.1| ribosomal protein L7/L12 [Borrelia afzelii ACA-1]
 gi|123046997|sp|Q0SNB7|RL7_BORAP RecName: Full=50S ribosomal protein L7/L12
 gi|52694900|gb|AAU85601.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
 gi|52694902|gb|AAU85602.1| 50S ribosomal protein L7/L12 [Borrelia afzelii ACA-1]
 gi|52694904|gb|AAU85603.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
 gi|52694924|gb|AAU85613.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
 gi|110890493|gb|ABH01661.1| ribosomal protein L7/L12 [Borrelia afzelii PKo]
 gi|215979939|gb|EEC20761.1| ribosomal protein L7/L12 [Borrelia afzelii ACA-1]
          Length = 124

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 80/124 (64%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  L     +E  EL   +E+++GV+A+   SV    +  +   + E+TEF+V+L
Sbjct: 4   NKEDILTWLEGAKTMEVVELVTAIEEKFGVTAAVATSVGGAASTGSTD-SEEQTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA 
Sbjct: 63  MSF--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAK 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|297838809|ref|XP_002887286.1| hypothetical protein ARALYDRAFT_476144 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297333127|gb|EFH63545.1| hypothetical protein ARALYDRAFT_476144 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 204

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 55/131 (41%), Positives = 79/131 (60%), Gaps = 12/131 (9%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAP-----------VAAEAGSAASE 54
            +V+++SSLTL E +EL K + K+ G++    V+V+ P            +  +  A  E
Sbjct: 74  RLVDEISSLTLSEISELGKIIMKKKGMTELPTVAVMKPGAGGGGGGMVSQSGVSEEAKVE 133

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KT FE+ L+ F+    KI +IKE+R+ TDLGLKEAK LVE  P  LK GLSK+E  ++ +
Sbjct: 134 KTVFEIKLESFEASA-KIKIIKELRSFTDLGLKEAKALVEKTPAILKAGLSKEEGEKILE 192

Query: 115 KLEDAGATVEL 125
           KL+  GA V L
Sbjct: 193 KLKALGAKVVL 203


>gi|294789167|ref|ZP_06754406.1| ribosomal protein L7/L12 [Simonsiella muelleri ATCC 29453]
 gi|294482908|gb|EFG30596.1| ribosomal protein L7/L12 [Simonsiella muelleri ATCC 29453]
          Length = 122

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 82/122 (67%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  LT++E  EL K  E+++GVSA+A           A  A   KTEF+V+L  
Sbjct: 6   EDILNAVEQLTVMELNELVKAFEEKFGVSAAAVAVAGPATVGAAAEA---KTEFDVILAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VR+IT LGLKEAK+LV+ APK+LK G+S+ EA+++KK+LE+AGA VE
Sbjct: 63  --AGDQKVGVIKVVRSITGLGLKEAKDLVDGAPKTLKEGVSQAEADDIKKQLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|218290025|ref|ZP_03494192.1| ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius LAA1]
 gi|218239859|gb|EED07047.1| ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius LAA1]
          Length = 123

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 57/121 (47%), Positives = 84/121 (69%), Gaps = 2/121 (1%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            I+E + ++T++E  EL K +E+E+GV+A+APV+          +A +E+TEF+V+L   
Sbjct: 5   EILEAVKNMTVLELNELVKAIEEEFGVTAAAPVAFAGAAPGAGEAAQAEQTEFDVILAS- 63

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                KI VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +K KLE+AGA+VE+
Sbjct: 64  -AGASKINVIKVVREITGLGLKEAKDLVDGAPKPIKEKVSKEEAESIKAKLEEAGASVEI 122

Query: 126 R 126
           +
Sbjct: 123 K 123


>gi|302382917|ref|YP_003818740.1| ribosomal protein L7/L12 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193545|gb|ADL01117.1| ribosomal protein L7/L12 [Brevundimonas subvibrioides ATCC 15264]
          Length = 128

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 68/130 (52%), Positives = 94/130 (72%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV++  P    A + A     +TE
Sbjct: 1   MADLSKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAMAMPAGGGAAAPAEAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F VVL       KKI VIKEVR + +DLGLKEAK+LVE AP+++   +SK  A+E+ KKL
Sbjct: 61  FTVVL--VSGGDKKINVIKEVRGVRSDLGLKEAKDLVEGAPQNVVENVSKQNADEIAKKL 118

Query: 117 EDAGATVELR 126
            +AGATV+++
Sbjct: 119 TEAGATVQIK 128


>gi|302656366|ref|XP_003019937.1| hypothetical protein TRV_06039 [Trichophyton verrucosum HKI 0517]
 gi|291183713|gb|EFE39313.1| hypothetical protein TRV_06039 [Trichophyton verrucosum HKI 0517]
          Length = 192

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------------VVAPVAAEAGS 50
            I  IV+++S LTL+E A+L   L+    +                     A    EA  
Sbjct: 58  KITKIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAAAAPGGAAAPAAAAEEEEAAP 117

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKT F + L+ F D   K  +IKEV+++  L L E+K+ VES PK +K  + K+EA 
Sbjct: 118 AAQEKTLFNLKLESF-DAASKAKIIKEVKSMLGLSLVESKKFVESVPKVIKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++   L+  GA   +
Sbjct: 177 KIVASLKALGAVASM 191


>gi|296533979|ref|ZP_06896496.1| ribosomal protein L7/L12 [Roseomonas cervicalis ATCC 49957]
 gi|296265692|gb|EFH11800.1| ribosomal protein L7/L12 [Roseomonas cervicalis ATCC 49957]
          Length = 126

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 96/126 (76%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LSSLT++EAAELSK LE++WGVSA+APV+V A  AA   +A + + + E 
Sbjct: 1   MADLAKLVDELSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAPAAGGAAAPAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +   KKI VIKE+R IT LGLKEAK+LVE APK++K G+SKDEA ++KK LE+ G
Sbjct: 61  TVILANSGDKKINVIKEIRTITGLGLKEAKDLVEGAPKTVKEGVSKDEAEKIKKVLEENG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AKVEVK 126


>gi|126732288|ref|ZP_01748088.1| ribosomal protein L7/L12 [Sagittula stellata E-37]
 gi|126707157|gb|EBA06223.1| ribosomal protein L7/L12 [Sagittula stellata E-37]
          Length = 126

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 87/126 (69%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E++ +LTL+EA EL   L+ E+G+  +A  +V+    A     A+E+ + E 
Sbjct: 1   MADLKALAEQIVNLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGDAGGAAEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA E+KKKLE+AG
Sbjct: 61  DVILKSAGDKKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEELKKKLEEAG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AEVEIK 126


>gi|85709555|ref|ZP_01040620.1| 50S ribosomal protein L7/L12 [Erythrobacter sp. NAP1]
 gi|85688265|gb|EAQ28269.1| 50S ribosomal protein L7/L12 [Erythrobacter sp. NAP1]
          Length = 125

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I  +VE+LS LT++EAAEL+  LE+EWGVSA+A V+V  P       A   EK EF+
Sbjct: 1   MADIAKLVEELSKLTVLEAAELATALEEEWGVSAAAAVAVAGPAGGGDAGAPAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L G  D  KKI VIKEVRAIT LGL EAK LVE APK LK G++K EA E+K K+E A
Sbjct: 61  VILTG--DGGKKIQVIKEVRAITGLGLTEAKGLVEGAPKPLKEGVNKAEAEEIKGKIEAA 118

Query: 120 GATVELR 126
           G TVEL+
Sbjct: 119 GGTVELK 125


>gi|326386253|ref|ZP_08207877.1| 50S ribosomal protein L7/L12 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209478|gb|EGD60271.1| 50S ribosomal protein L7/L12 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 124

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 100/126 (79%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I ++VE+LS LT++EAA+L+K LE+ WGVSA+A V+V A  A EA  AA EKTEF+V
Sbjct: 1   MADIAALVEELSKLTVLEAADLAKALEEAWGVSAAAAVAVAAAPAGEAAPAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G+SK EA ++KKK+E+AG
Sbjct: 61  ILTG--DGGKKIQVIKEVRAITSLGLTEAKALVEGAPKAIKEGVSKAEAEDIKKKIEEAG 118

Query: 121 ATVELR 126
            TVE++
Sbjct: 119 GTVEIK 124


>gi|221127877|ref|XP_002161467.1| PREDICTED: similar to mitochondrial ribosomal protein L12 [Hydra
           magnipapillata]
          Length = 177

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/128 (36%), Positives = 72/128 (56%), Gaps = 7/128 (5%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-----VSVVAPVAAEAGSAASEKTEF 58
           I +IV+ +S LTL+E + L+  L+KE  +  +       + V  P   E+     E+TEF
Sbjct: 50  IVNIVQSISKLTLLEVSHLNALLKKELNIQDAPMLPMTGMPVATPAVVESEPPKEEQTEF 109

Query: 59  EVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
            V L  F D   K+ +IKE++ I  ++ L  AK+ VE  P+ +K  LSK +A +MK +LE
Sbjct: 110 SVKLLKF-DEASKVKLIKEIKNIIPEMNLVMAKKYVEGVPQLVKEKLSKADAEKMKAQLE 168

Query: 118 DAGATVEL 125
             GA VE+
Sbjct: 169 AVGAVVEI 176


>gi|312892226|ref|ZP_07751723.1| LSU ribosomal protein L12P [Mucilaginibacter paludis DSM 18603]
 gi|311295356|gb|EFQ72528.1| LSU ribosomal protein L12P [Mucilaginibacter paludis DSM 18603]
          Length = 126

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 84/126 (66%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  +A   + A E  +   
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAPSAGGDAPAEEAVQTAF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +    K+AV+K V+ +T LGLKEAK+LV+ APK +KTG++K+EA  +KK+LE+AG
Sbjct: 61  DVILKEAGGAKLAVVKLVKDLTGLGLKEAKDLVDGAPKEVKTGVTKEEAESLKKQLEEAG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AVVEVK 126


>gi|317180926|dbj|BAJ58712.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F32]
          Length = 125

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA    + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGVAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|261838521|gb|ACX98287.1| ribosomal protein L7/L12 [Helicobacter pylori 51]
 gi|315587087|gb|ADU41468.1| ribosomal protein L7/L12 [Helicobacter pylori 35A]
          Length = 125

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGSAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|15612187|ref|NP_223839.1| 50S ribosomal protein L7/L12 [Helicobacter pylori J99]
 gi|108563563|ref|YP_627879.1| 50S ribosomal protein L7/L12 [Helicobacter pylori HPAG1]
 gi|188527986|ref|YP_001910673.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Shi470]
 gi|217034096|ref|ZP_03439517.1| hypothetical protein HP9810_893g43 [Helicobacter pylori 98-10]
 gi|308183304|ref|YP_003927431.1| 50S ribosomal protein L7/L12 [Helicobacter pylori PeCan4]
 gi|7388074|sp|P56875|RL7_HELPJ RecName: Full=50S ribosomal protein L7/L12
 gi|123373707|sp|Q1CS67|RL7_HELPH RecName: Full=50S ribosomal protein L7/L12
 gi|226733696|sp|B2UUW1|RL7_HELPS RecName: Full=50S ribosomal protein L7/L12
 gi|1840151|gb|AAB47278.1| 50S ribosomal protein L7/L12 [Helicobacter pylori]
 gi|4155719|gb|AAD06700.1| 50S RIBOSOMAL PROTEIN L7/L12 [Helicobacter pylori J99]
 gi|107837336|gb|ABF85205.1| ribosomal protein L7/L12 [Helicobacter pylori HPAG1]
 gi|188144226|gb|ACD48643.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Shi470]
 gi|216943491|gb|EEC22945.1| hypothetical protein HP9810_893g43 [Helicobacter pylori 98-10]
 gi|297380381|gb|ADI35268.1| ribosomal protein L7/L12 [Helicobacter pylori v225d]
 gi|308062480|gb|ADO04368.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Cuz20]
 gi|308063980|gb|ADO05867.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Sat464]
 gi|308065489|gb|ADO07381.1| 50S ribosomal protein L7/L12 [Helicobacter pylori PeCan4]
 gi|317009877|gb|ADU80457.1| 50S ribosomal protein L7/L12 [Helicobacter pylori India7]
 gi|317011401|gb|ADU85148.1| 50S ribosomal protein L7/L12 [Helicobacter pylori SouthAfrica7]
 gi|317178504|dbj|BAJ56292.1| 50S ribosomal protein L7/L12 [Helicobacter pylori F30]
          Length = 125

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|300022533|ref|YP_003755144.1| ribosomal protein L7/L12 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299524354|gb|ADJ22823.1| ribosomal protein L7/L12 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 125

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 77/127 (60%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           MS IE IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A A +A   E+TEF 
Sbjct: 1   MSKIEKIVDDLSSLTVLEAAELAKALEEKWGVSAAAAVAVAAAPGAGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK      KKI VIKEVRAIT LGLKEAK+LVE+  K++K G+SKDEA ++KK+LED 
Sbjct: 61  VILKS--GGDKKINVIKEVRAITGLGLKEAKDLVEAGGKTVKEGVSKDEAQKLKKQLEDQ 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEVK 125


>gi|288818172|ref|YP_003432520.1| ribosomal protein L7/L12 [Hydrogenobacter thermophilus TK-6]
 gi|288787572|dbj|BAI69319.1| ribosomal protein L7/L12 [Hydrogenobacter thermophilus TK-6]
 gi|308751773|gb|ADO45256.1| ribosomal protein L7/L12 [Hydrogenobacter thermophilus TK-6]
          Length = 127

 Score = 89.2 bits (220), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 89/124 (71%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVL 62
           I+ IVE + ++TL+E AEL K+LE+++GVSA+   +  A   A   + A  EKTEF+V+L
Sbjct: 6   IDEIVEAIGNMTLLEVAELVKKLEEKFGVSAAMVAAAPAAAPAGPAAPAVEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K       KI VIK VR IT LGLKEAK+LVESAPK +K G+SK+EA  +KKKLE+AGA 
Sbjct: 66  KS--AGANKINVIKVVREITGLGLKEAKDLVESAPKPVKEGVSKEEAENIKKKLEEAGAE 123

Query: 123 VELR 126
           VE++
Sbjct: 124 VEIK 127


>gi|94266151|ref|ZP_01289863.1| Ribosomal protein L7/L12 [delta proteobacterium MLMS-1]
 gi|93453266|gb|EAT03715.1| Ribosomal protein L7/L12 [delta proteobacterium MLMS-1]
          Length = 127

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 88/122 (72%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +S+++++E +EL K LE ++GVSA+APV+ VA  AA   +  + + + E  +  
Sbjct: 6   DDVIEFISNMSVLELSELIKELEDKFGVSAAAPVAAVAAPAAGGEAGEAAEEKTEFDVIL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIKEVRAIT LGLKEAKE+VE AP  +K G+SKDEA E+KKK+E+AG TVE
Sbjct: 66  ASAGDKKIGVIKEVRAITSLGLKEAKEMVEGAPNPIKEGVSKDEAEEIKKKIEEAGGTVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|30410810|ref|NP_660396.2| 50S ribosomal protein L7/L12 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 129

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S ++++   EL   +EK++GVSA      V        S   EKTEF++ LK 
Sbjct: 13  EQILEAVSEMSVMNVVELISAMEKKFGVSA---NMSVNTNNNSEKSTIEEKTEFDIFLKS 69

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++VIK VR+ T LGLKEAK+LVESAP  LK  +SK++A  +KK LEDAGA +E
Sbjct: 70  I--GPNKVSVIKSVRSATGLGLKEAKDLVESAPTVLKENMSKNDAESLKKTLEDAGAEIE 127

Query: 125 LR 126
           ++
Sbjct: 128 IK 129


>gi|219684536|ref|ZP_03539479.1| ribosomal protein L7/L12 [Borrelia garinii PBr]
 gi|219671898|gb|EED28952.1| ribosomal protein L7/L12 [Borrelia garinii PBr]
          Length = 124

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     +E  +L   +E+++GV+A+   +V    A+   + + E+TEF+V+L  
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA-ISAVGGVAASTGSTDSEEQTEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|56551624|ref|YP_162464.1| 50S ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241761251|ref|ZP_04759339.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|260752784|ref|YP_003225677.1| 50S ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|81598288|sp|Q5NPK7|RL7_ZYMMO RecName: Full=50S ribosomal protein L7/L12
 gi|56543198|gb|AAV89352.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241374158|gb|EER63655.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|258552147|gb|ACV75093.1| ribosomal protein L7/L12 [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 123

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 95/126 (75%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W   +++    VA   A  G+AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKW-GVSASAAVAVAAAPAAGGAAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKE+RAIT LGL +AK LVE APK +K G++KDEA ++KK+LE AG
Sbjct: 60  ILTG--DGGKKINVIKEIRAITGLGLTDAKALVEGAPKPVKEGVAKDEAEKLKKQLEAAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|52694906|gb|AAU85604.1| 50S ribosomal protein L7/L12 [Borrelia afzelii]
          Length = 124

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 80/124 (64%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  L     +E  EL   +E+++GV+A+   SV    +  +   + E+TEF+V+L
Sbjct: 4   NKEDILTWLEGAKTMEVVELVTAIEEKFGVTAAVATSVGGAASTGSID-SEEQTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA 
Sbjct: 63  MSF--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAK 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|86140282|ref|ZP_01058841.1| 50S ribosomal protein L7/L12 [Leeuwenhoekiella blandensis MED217]
 gi|85832224|gb|EAQ50673.1| 50S ribosomal protein L7/L12 [Leeuwenhoekiella blandensis MED217]
          Length = 124

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 85/126 (67%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    +A  AA    AA E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAMAGPAAGGDDAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLK+AKELV++AP  +K G++KDEA  +K +LE+AG
Sbjct: 61  ILKA--AGGSKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGIAKDEAEAIKSQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|310793146|gb|EFQ28607.1| hypothetical protein GLRG_03751 [Glomerella graminicola M1.001]
          Length = 183

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---------VVAPVAAEAGSAAS 53
            I +IV+++S+LTL+E A+L   L+ +  +                  A    EA  AA+
Sbjct: 52  KIAAIVDQISTLTLLETADLVSSLKSKLNIPDLPVGGFAAAPAAAPAAAAEVEEAAPAAA 111

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EK+ F + L  FD    K  VIKEV+ +  L L ++K+ VESAPK +K  ++KDEA ++ 
Sbjct: 112 EKSVFNIKLTAFDAAA-KAKVIKEVKNLLGLSLVDSKKFVESAPKLMKENVAKDEAEKII 170

Query: 114 KKLEDAGATVEL 125
             +++ GATV +
Sbjct: 171 ATMKELGATVTM 182


>gi|170738711|ref|YP_001767366.1| 50S ribosomal protein L7/L12 [Methylobacterium sp. 4-46]
 gi|226733709|sp|B0UHX7|RL7_METS4 RecName: Full=50S ribosomal protein L7/L12
 gi|168192985|gb|ACA14932.1| ribosomal protein L7/L12 [Methylobacterium sp. 4-46]
          Length = 126

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 93/126 (73%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V+ LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +A + + + E 
Sbjct: 1   MADLAKLVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAGPAAGGAAAPAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK +K G+SKD+A ++K +LE AG
Sbjct: 61  TVVLAAAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVSKDDAAKLKAQLEKAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|148256403|ref|YP_001240988.1| 50S ribosomal protein L7/L12 [Bradyrhizobium sp. BTAi1]
 gi|166222139|sp|A5ELN8|RL7_BRASB RecName: Full=50S ribosomal protein L7/L12
 gi|146408576|gb|ABQ37082.1| LSU ribosomal protein L12P [Bradyrhizobium sp. BTAi1]
          Length = 125

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V AP A  A +A   EKTEF 
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAPGAGGAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKIKGQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|240850291|ref|YP_002971684.1| 50S ribosomal protein L7/L12 [Bartonella grahamii as4aup]
 gi|240267414|gb|ACS51002.1| 50S ribosomal protein L7/L12 [Bartonella grahamii as4aup]
          Length = 123

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 94/126 (74%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++E IVE LS+LTL+EAAELSK LE++W   ++A    VA VA  A  AA EKTEF+V
Sbjct: 1   MADLEKIVEDLSNLTLLEAAELSKLLEEKW-GVSAAAPVAVAAVAGAAAPAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 60  IL--VEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|225849556|ref|YP_002729721.1| 50S ribosomal protein L7/L12 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644121|gb|ACN99171.1| ribosomal protein L7/L12 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 127

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I E + S+T++E A+L K LE+E+GVSA+A V+     A  A + A  EKTEF+V+L 
Sbjct: 7   EEIKEAIKSMTVLELAQLVKDLEEEFGVSAAAMVAAAPAAAGGAAAPAAEEKTEFDVILA 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KI VIK VR IT LGLKEAK+LVE APK +K G+SK+EA ++KKKLE+AGATV
Sbjct: 67  --NPGANKINVIKVVREITGLGLKEAKDLVEGAPKPIKEGVSKEEAEQIKKKLEEAGATV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EIK 127


>gi|114764155|ref|ZP_01443393.1| ribosomal protein L7/L12 [Pelagibaca bermudensis HTCC2601]
 gi|114543307|gb|EAU46323.1| ribosomal protein L7/L12 [Roseovarius sp. HTCC2601]
          Length = 126

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 88/126 (69%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E++  LTL+EA EL   L+ E+G+  +A  +V+    A  G AA+E+ + E 
Sbjct: 1   MADLKALAEQIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGGEAAAEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA E+KKKLE+AG
Sbjct: 61  DVILKSAGDKKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEEIKKKLEEAG 120

Query: 121 ATVELR 126
           A +EL+
Sbjct: 121 AEIELK 126


>gi|298490345|ref|YP_003720522.1| 50S ribosomal protein L7/L12 ['Nostoc azollae' 0708]
 gi|298232263|gb|ADI63399.1| ribosomal protein L7/L12 ['Nostoc azollae' 0708]
          Length = 129

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 93/128 (72%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           +  + I+E+L SLTL+EA+EL K++E+ +GVSA+AP   + ++AP  A A     EKTEF
Sbjct: 3   AATDQILEQLKSLTLLEASELVKQIEEAFGVSAAAPAGGMMMMAPPGAPAAEVVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           + +L+      KKIAV+K VR IT LGLKEAK+LVE+APK +K G++KD A ++KK++ +
Sbjct: 63  DAILEAV-PADKKIAVLKIVREITGLGLKEAKDLVEAAPKPVKEGIAKDAAEDIKKRIAE 121

Query: 119 AGATVELR 126
           AG TV ++
Sbjct: 122 AGGTVVIK 129


>gi|133088|sp|P24929|RK12_TOBAC RecName: Full=50S ribosomal protein L12, chloroplastic; AltName:
           Full=CL12; Flags: Precursor
 gi|20018|emb|CAA44214.1| ribosomal protein L12-1 [Nicotiana tabacum]
          Length = 186

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 53/127 (41%), Positives = 78/127 (61%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEF 58
            +  + +++S+LTL +A +L + L+ + GV+A++        A  A + A      KTEF
Sbjct: 60  KVVQLGDEISNLTLADAQKLVEYLQDKLGVTAASFAPAAVAAAPGAAAEAPAVVEEKTEF 119

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VV+        +IA IK VRA+T L LKEAKEL+E  PK  K G+SKDEA + KK+LE+
Sbjct: 120 DVVIDEVPSNA-RIATIKAVRALTSLALKEAKELIEGLPKKFKEGVSKDEAEDAKKQLEE 178

Query: 119 AGATVEL 125
           AGA V +
Sbjct: 179 AGAKVSI 185


>gi|319407384|emb|CBI81035.1| 50S ribosomal protein L7/L12 [Bartonella sp. 1-1C]
          Length = 122

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 69/126 (54%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W    SA   V          AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW--GVSAAAPVAVAAVGAVAPAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKAQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|319404383|emb|CBI77986.1| 50S ribosomal protein L7/L12 [Bartonella rochalimae ATCC BAA-1498]
          Length = 122

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 70/126 (55%), Positives = 89/126 (70%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W    SA   V       A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW--GVSAAAPVAVAAVGAAAPAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 59  ILT--DGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKAQLEAAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AKVELK 122


>gi|47215412|emb|CAG01109.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 192

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 47/131 (35%), Positives = 73/131 (55%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-------ASEK 55
            I+ +V  ++SLTL+E ++L++ L+K   +     + + A  A  A +A         EK
Sbjct: 62  KIQQLVNDIASLTLLEVSDLNELLKKTLNIQDVGMMPMAAAAAPVAQAAEEEAVPAKKEK 121

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V L       +K+ +IKEV+     L L +AK+LVES P+ ++  +SKDEA ++K 
Sbjct: 122 THFTVKLTELKA-AEKVKLIKEVKNCIQGLNLVQAKKLVESLPQEIRANVSKDEAEKLKA 180

Query: 115 KLEDAGATVEL 125
            LE AG TV L
Sbjct: 181 ALEAAGGTVVL 191


>gi|150020401|ref|YP_001305755.1| 50S ribosomal protein L7/L12 [Thermosipho melanesiensis BI429]
 gi|166990991|sp|A6LKB9|RL7_THEM4 RecName: Full=50S ribosomal protein L7/L12
 gi|149792922|gb|ABR30370.1| ribosomal protein L7/L12 [Thermosipho melanesiensis BI429]
          Length = 129

 Score = 88.8 bits (219), Expect = 2e-16,   Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 83/129 (64%), Gaps = 3/129 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M  +E IV ++  LT+ E AEL K LE ++GVSASAPV  +    A AG  A+ + + E 
Sbjct: 1   MEKLEQIVNEIEQLTVAELAELVKMLEDKFGVSASAPVMAMPVAGAAAGGGAAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESA---PKSLKTGLSKDEANEMKKKLE 117
            +       KKI VIK VR IT LGLKEAK+LVE A      +K G++KDEA E+KKKLE
Sbjct: 61  DVVLKSFGAKKINVIKVVREITGLGLKEAKDLVEKAGTPDAVIKQGVNKDEAEEIKKKLE 120

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 121 EAGAEVELK 129


>gi|108796926|ref|YP_636226.1| ribosomal protein L12 [Pseudendoclonium akinetum]
 gi|122245932|sp|Q3ZJ41|RK12_PSEAK RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|56159624|gb|AAV80648.1| ribosomal protein L12 [Pseudendoclonium akinetum]
          Length = 129

 Score = 88.8 bits (219), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 57/129 (44%), Positives = 85/129 (65%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV----SVVAPVAAEAGSAASEKT 56
           M+ +E I+++L +LTLIE++EL K++E+ +GV ASAPV     +     +       EKT
Sbjct: 1   MTTVEQIIDQLKTLTLIESSELVKQIEETFGVDASAPVGGAIMMAPGQESAGQEVVEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+V++K      K+++V+K +R +T LGL EAKE   S PK+LK G+SK+EA E KK L
Sbjct: 61  TFDVIVKDI-ASDKRVSVLKVIRKLTSLGLAEAKEFTVSLPKALKEGISKEEAAEAKKDL 119

Query: 117 EDAGATVEL 125
           E AGA V++
Sbjct: 120 ELAGAVVDI 128


>gi|15639232|ref|NP_218680.1| 50S ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025473|ref|YP_001933245.1| 50S ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum
           SS14]
 gi|6094098|sp|O83268|RL7_TREPA RecName: Full=50S ribosomal protein L7/L12
 gi|226734489|sp|B2S2I7|RL7_TREPS RecName: Full=50S ribosomal protein L7/L12
 gi|3322510|gb|AAC65228.1| ribosomal protein L7/L12 (rplL) [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018048|gb|ACD70666.1| ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum SS14]
 gi|291059643|gb|ADD72378.1| ribosomal protein L7/L12 [Treponema pallidum subsp. pallidum str.
           Chicago]
          Length = 129

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 1/122 (0%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +   T++E +EL K +E+E+GV+A+ PV+ VA        AA E+TEF VVLKG
Sbjct: 7   EQIIEAIRGKTILELSELIKAVEEEFGVTAAVPVAPVAEGGGAGSVAAEEQTEFTVVLKG 66

Query: 65  FDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +P KKIAVIKEVR  I+ LGLKEAK+LVE APK+LK  +SK+EA ++K+ +  AGA +
Sbjct: 67  LAEPGKKIAVIKEVRNVISGLGLKEAKDLVEGAPKTLKENVSKEEAAKIKESMTAAGALI 126

Query: 124 EL 125
           E+
Sbjct: 127 EI 128


>gi|115492445|ref|XP_001210850.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114197710|gb|EAU39410.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 184

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------VVAPVAAEAGSAA 52
            I  IV+++S LTL+E A+L   L++   +                        EA  A 
Sbjct: 52  KITQIVDQISQLTLLETADLVATLKERLNIPDLPVGGFAMAPGAAPAAAPAEEEEAAPAP 111

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F + L+   D   K  VIKE++ +  L L ++K+ VES PK LK  + K++A ++
Sbjct: 112 QEKTLFNLKLESI-DAASKAKVIKEIKTLLGLSLVDSKKFVESVPKVLKESVPKEDAEKI 170

Query: 113 KKKLEDAGATVEL 125
            + L++ GA   +
Sbjct: 171 IETLKNVGAKAIM 183


>gi|22164792|ref|NP_081480.2| 39S ribosomal protein L12, mitochondrial precursor [Mus musculus]
 gi|17865556|sp|Q9DB15|RM12_MOUSE RecName: Full=39S ribosomal protein L12, mitochondrial;
           Short=L12mt; Short=MRP-L12; Flags: Precursor
 gi|13543071|gb|AAH05712.1| Mitochondrial ribosomal protein L12 [Mus musculus]
 gi|18044548|gb|AAH19565.1| Mitochondrial ribosomal protein L12 [Mus musculus]
 gi|26389765|dbj|BAC25787.1| unnamed protein product [Mus musculus]
 gi|74147863|dbj|BAE22297.1| unnamed protein product [Mus musculus]
 gi|74185099|dbj|BAE39152.1| unnamed protein product [Mus musculus]
 gi|74212233|dbj|BAE40275.1| unnamed protein product [Mus musculus]
 gi|123298604|emb|CAM27051.1| mitochondrial ribosomal protein L12 [Mus musculus]
          Length = 201

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE--------------A 48
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V                  
Sbjct: 64  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEED 123

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKD 107
                E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K 
Sbjct: 124 VPKQKERTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKA 182

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++K  LE  G TV L
Sbjct: 183 EAEKIKAALEAVGGTVVL 200


>gi|322707250|gb|EFY98829.1| 54S ribosomal protein L12 [Metarhizium anisopliae ARSEF 23]
          Length = 180

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 44/132 (33%), Positives = 72/132 (54%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---------VVAPVAAEAGSAAS 53
            I  IV+++S LTL+E A+L   L+ +  +                  A    EA  AA+
Sbjct: 49  KIAEIVDQISRLTLLETADLVSSLKSKLNIPDMPMGGFAAAAPAAAPAAEEVEEAAPAAA 108

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EK+ F + L+ FD    K  +IKE++++  L L ++K+ VESAPK +K  + KDEA ++ 
Sbjct: 109 EKSLFTLKLQAFDAGA-KAKIIKEIKSLLGLSLVDSKKFVESAPKMMKENIPKDEAEKII 167

Query: 114 KKLEDAGATVEL 125
             +++ GATV +
Sbjct: 168 ASMKELGATVVM 179


>gi|302510671|ref|XP_003017287.1| hypothetical protein ARB_04166 [Arthroderma benhamiae CBS 112371]
 gi|291180858|gb|EFE36642.1| hypothetical protein ARB_04166 [Arthroderma benhamiae CBS 112371]
          Length = 192

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------------VVAPVAAEAGS 50
            I  IV+++S LTL+E A+L   L+    +                     A    EA  
Sbjct: 58  KITKIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAAAAPGGAAAPAAAAEEEEAAP 117

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKT F + L+ F D   K  +IKEV+++  L L E+K+ VES PK +K  + K+EA 
Sbjct: 118 AAQEKTLFNLKLESF-DAASKAKIIKEVKSMLGLSLVESKKFVESVPKVIKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++   L+  GA   +
Sbjct: 177 KIVASLKALGAVASM 191


>gi|149913533|ref|ZP_01902066.1| 50S ribosomal protein L7/L12 [Roseobacter sp. AzwK-3b]
 gi|149812653|gb|EDM72482.1| 50S ribosomal protein L7/L12 [Roseobacter sp. AzwK-3b]
          Length = 126

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 84/126 (66%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A    AA+ + + E 
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGDAGAAAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIKEVRAIT LGLKEAK+LVE+  K++K  +SKDEA E+KKKLE+AG
Sbjct: 61  DVILKSAGASKINVIKEVRAITGLGLKEAKDLVEAGGKAVKEQVSKDEAEEIKKKLEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|317014587|gb|ADU82023.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Gambia94/24]
          Length = 125

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEEKFGVSATPTVVAGAAVAGGATAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|114319611|ref|YP_741294.1| 50S ribosomal protein L7/L12 [Alkalilimnicola ehrlichii MLHE-1]
 gi|122312462|sp|Q0ABI3|RL7_ALHEH RecName: Full=50S ribosomal protein L7/L12
 gi|114226005|gb|ABI55804.1| LSU ribosomal protein L12P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 125

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  EL + +E+++GV+A+A V+     A     AA E+TEF+VVL  
Sbjct: 6   EEILETISNMTVMEVVELIEEMEEKFGVTAAAAVAAAPAAAGGEAEAAEEQTEFDVVLSS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR IT LGLKEAKE+VE AP  +K G SK+EA E+K KLE+AGA+VE
Sbjct: 66  F--GSNKVAVIKAVRGITGLGLKEAKEVVEGAPSPIKEGASKEEAEEIKAKLEEAGASVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|297802186|ref|XP_002868977.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297314813|gb|EFH45236.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 167

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 54/127 (42%), Positives = 74/127 (58%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA----GSAASEKTEF 58
            +E I + L +L  IE  + S     + G++       VA    EA     +  +EKT F
Sbjct: 41  KLERIADDLLNLNRIELYDYSILFSHKLGLNRYGSAVAVAGSDGEASGSTETKTAEKTAF 100

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L+ F+    KI VIKE+RA TDLGLKEAKELVE AP  +K GL+K+EA ++ +KL+ 
Sbjct: 101 DVKLEKFE-TASKIKVIKEIRAFTDLGLKEAKELVEKAPVIVKKGLTKEEAEKIMEKLKA 159

Query: 119 AGATVEL 125
            GA V L
Sbjct: 160 VGAIVAL 166


>gi|302390616|ref|YP_003826437.1| LSU ribosomal protein L12P [Thermosediminibacter oceani DSM 16646]
 gi|302201244|gb|ADL08814.1| LSU ribosomal protein L12P [Thermosediminibacter oceani DSM 16646]
          Length = 125

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 52/122 (42%), Positives = 84/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  + ++T++E +EL K L++++GV+A+APV+V A  AA   + A+   + E  +  
Sbjct: 4   DEIIAAIENMTVLELSELVKALQEKFGVTAAAPVAVAAGPAAPGAAEAAAPEQTEFDVIL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR +T LGLKEAK+LV+ APK +K  +SK+EA ++K KL + GATVE
Sbjct: 64  ANPGAEKIKVIKVVRELTGLGLKEAKDLVDGAPKPIKEKVSKEEAEQIKAKLAEVGATVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|109893807|sp|Q2LQ88|RL7_SYNAS RecName: Full=50S ribosomal protein L7/L12
          Length = 129

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 83/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +V+ +  +T++E +EL K LE+ +GVSA+APV+V A   A   +AA  + + E     
Sbjct: 8   EDVVKFIEGMTVLELSELVKELEERFGVSAAAPVAVAAVAGAAGEAAAPAEEKTEFDAIL 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VRAIT LGLKEAK+LVE APK +K  +SKDEA ++KKK+E+ G TVE
Sbjct: 68  TGFGDQKIQVIKVVRAITGLGLKEAKDLVEGAPKPIKEAVSKDEAADIKKKIEEVGGTVE 127

Query: 125 LR 126
           ++
Sbjct: 128 VK 129


>gi|85375711|ref|YP_459773.1| ribosomal protein L7/L12 [Erythrobacter litoralis HTCC2594]
 gi|123004981|sp|Q2N5R5|RL7_ERYLH RecName: Full=50S ribosomal protein L7/L12
 gi|84788794|gb|ABC64976.1| ribosomal protein L7/L12 [Erythrobacter litoralis HTCC2594]
          Length = 125

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 95/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I+++VE+LS LT++EAAEL+K LE+EWGVSA+A V+V  P      +A   EK EF+
Sbjct: 1   MADIKALVEELSKLTVLEAAELAKALEEEWGVSAAAAVAVAGPAGGGDAAAPAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L G  D  KKI VIKEVRAIT LGL EAK LVE APK +K G++K EA E+K K+E A
Sbjct: 61  VILTG--DGGKKIQVIKEVRAITGLGLTEAKGLVEGAPKPIKEGVNKAEAEEIKGKIEAA 118

Query: 120 GATVELR 126
           G TVEL+
Sbjct: 119 GGTVELK 125


>gi|51598647|ref|YP_072835.1| 50S ribosomal protein L7/L12 [Borrelia garinii PBi]
 gi|51573218|gb|AAU07243.1| ribosomal protein L7/L12 [Borrelia garinii PBi]
 gi|52694912|gb|AAU85607.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 79/122 (64%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     +E  +L   +E+++GV+A+   +V    A+   + + E+ EF+V+L  
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVTAA-ISAVGGGAASTGSTDSEEQIEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GNSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|115525597|ref|YP_782508.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris BisA53]
 gi|122295398|sp|Q07KK6|RL7_RHOP5 RecName: Full=50S ribosomal protein L7/L12
 gi|115519544|gb|ABJ07528.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris BisA53]
          Length = 123

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 97/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V    AA A + A EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAG-PAAAAAAPAEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 60  VLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKVKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|167629457|ref|YP_001679956.1| 50S ribosomal protein l7/l12 [Heliobacterium modesticaldum Ice1]
 gi|226733693|sp|B0TC46|RL7_HELMI RecName: Full=50S ribosomal protein L7/L12
 gi|167592197|gb|ABZ83945.1| 50S ribosomal protein l7/l12 [Heliobacterium modesticaldum Ice1]
          Length = 125

 Score = 88.4 bits (218), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 68/127 (53%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           MS I  I+E +  LT++E AEL K  E+E+GVSA+APV++ A   A A +A   E+TEF+
Sbjct: 1   MSKINEIIEAVKGLTVLELAELVKAFEEEFGVSAAAPVAMAAMPVAAAAAAPAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK      KK+ VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +KKKLE++
Sbjct: 61  VILKA--AGDKKVNVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKEEAESIKKKLEES 118

Query: 120 GATVELR 126
           GATVE++
Sbjct: 119 GATVEVK 125


>gi|254779746|ref|YP_003057852.1| 50S ribosomal protein L7/L12 [Helicobacter pylori B38]
 gi|254001658|emb|CAX29834.1| 50S ribosomal protein L7/L12 [Helicobacter pylori B38]
          Length = 125

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +SSL+++E AEL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYISSLSVLELAELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|237753297|ref|ZP_04583777.1| 50S ribosomal protein L7/L12 [Helicobacter winghamensis ATCC
           BAA-430]
 gi|229375564|gb|EEO25655.1| 50S ribosomal protein L7/L12 [Helicobacter winghamensis ATCC
           BAA-430]
          Length = 124

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+ P  V   VA    +A+ EKTEF+++L  
Sbjct: 6   EDVLEYIGNLSVMELSELVKAFEEKFGVSAA-PTVVAGAVAGGGAAASEEKTEFDIILT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR +T LGLKEAK+ VE  P ++K G+ K++A+ +K K E+AGA V+
Sbjct: 64  -DSGDKKINVIKVVREVTGLGLKEAKDAVEKTPFTVKEGVKKEDADAIKAKFEEAGAKVD 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|241951804|ref|XP_002418624.1| mitochondrial ribosomal protein, putative [Candida dubliniensis
           CD36]
 gi|223641963|emb|CAX43927.1| mitochondrial ribosomal protein, putative [Candida dubliniensis
           CD36]
          Length = 175

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 76/133 (57%), Gaps = 10/133 (7%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------ 55
           + I +IV+++S+LTL+E ++L   L++   +S  +     A  A  A +A  E+      
Sbjct: 43  AKITTIVDQISTLTLLETSQLINELKERLNISDISLPVGGAQAAPVAQAAPVEEEVKEEV 102

Query: 56  ---TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
              T F + L+ F D K K  +IKEV+ +  L L E+K+ VESAPK LK  ++K++A ++
Sbjct: 103 EEKTIFSIKLESF-DAKSKPKIIKEVKGMLGLSLVESKKFVESAPKILKENVAKEDAEKI 161

Query: 113 KKKLEDAGATVEL 125
           K  LE  GA V L
Sbjct: 162 KATLEGLGAKVSL 174


>gi|206901881|ref|YP_002251085.1| ribosomal protein L7/L12 [Dictyoglomus thermophilum H-6-12]
 gi|226733676|sp|B5YEX7|RL7_DICT6 RecName: Full=50S ribosomal protein L7/L12
 gi|206740984|gb|ACI20042.1| ribosomal protein L7/L12 [Dictyoglomus thermophilum H-6-12]
          Length = 125

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 78/124 (62%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I++ +  + + E  EL K LE+E+GVSA+ PV+ V    A A +AA  + +    +
Sbjct: 2   NKEEIIQAIKEMKVTELVELVKALEEEFGVSAAMPVAAVGSPVAGAAAAAPVEEKTTFDV 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI V+K VR IT LGLKEAK+LV+S PK +K G+SK EA E+K KLE  GA 
Sbjct: 62  ILKDAGANKIKVLKVVREITGLGLKEAKDLVDSTPKPIKEGVSKQEAEEIKAKLEAEGAV 121

Query: 123 VELR 126
           VE++
Sbjct: 122 VEIK 125


>gi|49475397|ref|YP_033438.1| 50S ribosomal protein L7/L12 [Bartonella henselae str. Houston-1]
 gi|81648027|sp|Q6G3X6|RL7_BARHE RecName: Full=50S ribosomal protein L7/L12
 gi|49238203|emb|CAF27413.1| 50S ribosomal protein l7 /l12 [Bartonella henselae str. Houston-1]
          Length = 123

 Score = 88.0 bits (217), Expect = 3e-16,   Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++W   ++A    VA VA  A   A EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKLLEEKW-GVSAAAPVAVAAVAGAAAPVAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SKDEA ++K +LE AG
Sbjct: 60  IL--VEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKDEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|317123105|ref|YP_004103108.1| 50S ribosomal protein L12P [Thermaerobacter marianensis DSM 12885]
 gi|315593085|gb|ADU52381.1| LSU ribosomal protein L12P [Thermaerobacter marianensis DSM 12885]
          Length = 127

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           MS ++ +++ +  +T++E AEL K+ E+E+GVSA+APV+V AP A  A +A     EKTE
Sbjct: 1   MSKVQEVLDIVKGMTVLELAELVKKFEEEFGVSAAAPVAVAAPGAPAAAAAPAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LK  D    KI VIK VR +T LGLKEAK+LV++APK LK G+SK+EA ++K KL 
Sbjct: 61  FNVILK--DVGANKIQVIKVVRELTGLGLKEAKDLVDNAPKPLKEGVSKEEAEQIKAKLA 118

Query: 118 DAGATVELR 126
           +AGATVE++
Sbjct: 119 EAGATVEIQ 127


>gi|21672995|ref|NP_661060.1| 50S ribosomal protein L7/L12 [Chlorobium tepidum TLS]
 gi|25091173|sp|Q8KG16|RL7_CHLTE RecName: Full=50S ribosomal protein L7/L12
 gi|21646057|gb|AAM71402.1| ribosomal protein L7/L12 [Chlorobium tepidum TLS]
          Length = 126

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 65/125 (52%), Positives = 90/125 (72%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+IE++VE++  LTL EA+EL K LE+++GVSA+  V   A +AA AG AA+ + + E 
Sbjct: 1   MSSIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAVMAGAVMAAPAGEAAAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIK VRAIT LGLKEAK++V+ APK++K  +SKDEA ++ K+L+DAG
Sbjct: 61  DVVLKSAGANKINVIKVVRAITGLGLKEAKDMVDGAPKTVKEAVSKDEAEKIAKELKDAG 120

Query: 121 ATVEL 125
           A VEL
Sbjct: 121 AEVEL 125


>gi|291166884|gb|EFE28930.1| 50S ribosomal protein L7/L12 [Filifactor alocis ATCC 35896]
          Length = 122

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+E + ++ ++E  EL K  E+++GVSA+APV V    AA  G+A  EK+EF+V+L
Sbjct: 2   NIEQILEAIENMKVLELNELVKAAEEKFGVSAAAPVMVAG-GAAAGGAAVEEKSEFDVIL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    K+ VIK VR IT LGLK+AK+LV+ APK +K G+SK+EA EMK KLE AGA 
Sbjct: 61  A--DAGSSKVGVIKAVREITGLGLKDAKDLVDGAPKPVKEGVSKEEAEEMKAKLEGAGAK 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|15645813|ref|NP_207990.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 26695]
 gi|2500212|sp|P55834|RL7_HELPY RecName: Full=50S ribosomal protein L7/L12
 gi|2314361|gb|AAD08245.1| ribosomal protein L7/L12 (rpl7/l12) [Helicobacter pylori 26695]
          Length = 125

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E +EL K  EK++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELSELVKMFEKKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|86131816|ref|ZP_01050413.1| 50S ribosomal protein L7/L12 [Dokdonia donghaensis MED134]
 gi|85817638|gb|EAQ38812.1| 50S ribosomal protein L7/L12 [Dokdonia donghaensis MED134]
          Length = 124

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA   A  G AA EK+EF+V
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAVAAGGAGGGDAAEEKSEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLK+AK LV+ AP  +K G++KDEA  +K +LE+AG
Sbjct: 61  ILKA--AGASKLAVVKLVKELTGLGLKDAKGLVDGAPSPVKEGVAKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|291276551|ref|YP_003516323.1| 50S ribosomal protein L7 /L12 [Helicobacter mustelae 12198]
 gi|290963745|emb|CBG39580.1| 50S ribosomal protein L7 /L12 [Helicobacter mustelae 12198]
          Length = 123

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 80/122 (65%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +S L+++E +EL K  E+++GVSA+  V       A  G+A  EKTEF VVL  
Sbjct: 6   EEILDYISGLSVLELSELVKAFEEKFGVSAAPTVVAG--AVAAGGAAVEEKTEFNVVLT- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR IT LGLKEAKE  E+ P  LK G++K++A   KKKLE+AGA VE
Sbjct: 63  -DAGANKINVIKVVREITGLGLKEAKEATEATPSVLKEGVNKEDAENFKKKLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|149372366|ref|ZP_01891554.1| 50S ribosomal protein L7/L12 [unidentified eubacterium SCB49]
 gi|149354756|gb|EDM43319.1| 50S ribosomal protein L7/L12 [unidentified eubacterium SCB49]
          Length = 123

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA     AG AA E++EF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAVA-AGGGAGEAAEEQSEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L        K+AV+K V+ +T  GLK+AK+LV++AP  +K G+SKDEA  +K +LE+AG
Sbjct: 60  ILTA--AGGSKLAVVKLVKELTGAGLKDAKDLVDNAPSPIKEGVSKDEAEALKAQLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AEVELK 123


>gi|229368060|gb|ACQ59010.1| 39S ribosomal protein L12, mitochondrial precursor [Anoplopoma
           fimbria]
          Length = 196

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 74/133 (55%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---------AS 53
            I+ +V  +++LTL+EA++L++ L+K   +     + + A  A+   +A           
Sbjct: 64  KIQPLVGDIANLTLLEASDLNELLKKTLNIQDVGMMPMGAMAASAVPAAAADEEEAPVKK 123

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           E+T F V L       +K+ +IKEV+     L L +AK+LVE+ P+ ++  +SK+EA ++
Sbjct: 124 EQTHFTVKLTELKA-AEKVKLIKEVKNCIQGLNLVQAKKLVEALPQEIRANVSKEEAEKL 182

Query: 113 KKKLEDAGATVEL 125
           K  LE AG TV L
Sbjct: 183 KAALEAAGGTVVL 195


>gi|169830425|ref|YP_001716407.1| ribosomal protein L7/L12 [Candidatus Desulforudis audaxviator
           MP104C]
 gi|226733674|sp|B1I1M6|RL7_DESAP RecName: Full=50S ribosomal protein L7/L12
 gi|169637269|gb|ACA58775.1| ribosomal protein L7/L12 [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 126

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 85/126 (67%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS +  I+E +  LT++E AEL K +E+E+GVSA+APV+ VA V A A     E+ + E 
Sbjct: 1   MSKVNEIIEIVKGLTVLELAELVKAMEEEFGVSAAAPVAAVAAVPAAAAPVVEEEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +   +KI VIK VR IT LGLKEAKELV+ AP  +K  ++K+EA  +KKKLE+ G
Sbjct: 61  DVILKNVGNEKIKVIKVVREITGLGLKEAKELVDGAPNPVKEKVNKEEAETIKKKLEEVG 120

Query: 121 ATVELR 126
           A +E++
Sbjct: 121 AGIEIK 126


>gi|294085950|ref|YP_003552710.1| 50S ribosomal protein L7/L12 [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292665525|gb|ADE40626.1| 50S ribosomal protein L7/L12 [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 126

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 65/126 (51%), Positives = 91/126 (72%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  I E LS+LT++EAAEL+  LE++WGVSA+A    +A  A    +  + + + E 
Sbjct: 1   MADIAKIAEDLSNLTVLEAAELATMLEEKWGVSAAAAPMAMAMPAGGGDAGGAAEAKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIKEVRAIT LGLKEAK+LVE+APK++K G+S+DEANE+K KLE+AG
Sbjct: 61  DVVLTAAGASKINVIKEVRAITGLGLKEAKDLVEAAPKAVKEGVSEDEANEIKGKLEEAG 120

Query: 121 ATVELR 126
           A+VE++
Sbjct: 121 ASVEVK 126


>gi|114567851|ref|YP_755005.1| 50S ribosomal protein L7/L12 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122317277|sp|Q0AUH0|RL7_SYNWW RecName: Full=50S ribosomal protein L7/L12
 gi|114338786|gb|ABI69634.1| LSU ribosomal protein L12P [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
          Length = 125

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           MS ++ +++ +  +T++E +EL K LE+E+GVSA+APV+V A  AA A + A E + EF+
Sbjct: 1   MSKVQEVIDIVKQMTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGAVAEAVEEQYEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L      +KKI VIK VR IT LGLKEAK LV+  P  +K  ++K+EANE+K K+E+A
Sbjct: 61  VILTS--SGEKKINVIKVVREITGLGLKEAKTLVDECPNPVKEKITKEEANEIKAKIEEA 118

Query: 120 GATVELR 126
           G +VE++
Sbjct: 119 GGSVEVK 125


>gi|304310008|ref|YP_003809606.1| 50S Ribosomal protein L7/L12 [gamma proteobacterium HdN1]
 gi|301795741|emb|CBL43940.1| 50S Ribosomal protein L7/L12 [gamma proteobacterium HdN1]
          Length = 124

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 50/122 (40%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ +++++  EL   +E ++GV+A+APV++ A   A A +   E+TEF V++  
Sbjct: 6   DDILNAIAEMSVMDLVELISAIEDKFGVTAAAPVAIAA-GPAAAAAPVEEQTEFNVIMTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   + K+ VIK +RAIT LGLKEAK++VE  P ++K G+SK +A+++KK+LE+AGA V+
Sbjct: 65  F--GENKVNVIKVIRAITGLGLKEAKDMVEGVPATVKEGISKKDADDLKKQLEEAGAKVD 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|19075581|ref|NP_588081.1| mitochondrial ribosomal protein subunit L12 [Schizosaccharomyces
           pombe 972h-]
 gi|74638868|sp|Q9USJ9|MNP1_SCHPO RecName: Full=60 ribosomal protein L12, mitochondrial; AltName:
           Full=Mitochondrial-nucleoid protein 1; Flags: Precursor
 gi|6434017|emb|CAB60683.1| mitochondrial ribosomal protein subunit L12 [Schizosaccharomyces
           pombe]
          Length = 206

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 47/132 (35%), Positives = 72/132 (54%), Gaps = 9/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVS--------ASAPVSVVAPVAAEAGSAAS 53
           + I  +V+K+SSL+L+E +EL K+L+++  ++        A A  S              
Sbjct: 75  AQIGEMVDKISSLSLLETSELVKQLKEKLNIAEIAPMAAVAPAVASAAPSEEKAPEEKKE 134

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT + + L+ FD    K  VIKEV+++  L L +AK+ VESAPK LK  + K++A  +K
Sbjct: 135 EKTTWNLKLESFDAGS-KAKVIKEVKSLLGLSLVDAKKFVESAPKVLKENILKEDAEAIK 193

Query: 114 KKLEDAGATVEL 125
            KLE     V L
Sbjct: 194 SKLEKLSCKVVL 205


>gi|144900872|emb|CAM77736.1| 50S ribosomal protein L7/L12 [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 124

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 77/126 (61%), Positives = 102/126 (80%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A   A A  AA E+TEFEV
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAAAPAAEEQTEFEV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +  +KKI VIKEVRAIT LGLKEAK+LVE APK++K G+SKDEA ++KK LE+AG
Sbjct: 61  VLT--EAGEKKINVIKEVRAITGLGLKEAKDLVEGAPKTVKDGVSKDEAEKIKKVLEEAG 118

Query: 121 ATVELR 126
           A V ++
Sbjct: 119 AKVAVK 124


>gi|149055026|gb|EDM06843.1| ribosomal protein, mitochondrial, L12 [Rattus norvegicus]
          Length = 203

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------- 49
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V                  
Sbjct: 66  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGAVPAAAPAPEAAEEED 125

Query: 50  -SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKD 107
                E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K 
Sbjct: 126 LPKQKEQTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKA 184

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++K  LE  G TV L
Sbjct: 185 EAEKIKAALEAVGGTVVL 202


>gi|118099877|ref|XP_001232214.1| PREDICTED: hypothetical protein [Gallus gallus]
          Length = 194

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 42/134 (31%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV----------APVAAEAGSAA 52
            +  +V  ++ LTL+E A+L+  L++   +     +                  EA    
Sbjct: 61  KVRQLVRDIAGLTLLEVADLNALLKETLKIPDVGVMPAGAAAHLPAQAAPQEEEEAVPMK 120

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANE 111
            EKT F V L        K+ +IKEV+     + L +AK+LVES P+ +K  +SK+EA +
Sbjct: 121 KEKTHFSVRLTELKATD-KVKLIKEVKNFVPGINLVQAKKLVESLPQEIKANVSKEEAEK 179

Query: 112 MKKKLEDAGATVEL 125
           +K  LE AG TV L
Sbjct: 180 IKTALEAAGGTVVL 193


>gi|229915442|gb|ACQ90787.1| ribosomal protein L12 [Oocystis solitaria]
          Length = 131

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 55/127 (43%), Positives = 80/127 (62%), Gaps = 6/127 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-----VSVVAPVAAEAGSAASEKTEFE 59
             I+EKL S+TL+EAAEL  ++E+ +GV ASAP        V            EKT F+
Sbjct: 6   NEIIEKLKSITLLEAAELVSQIEETFGVDASAPTGGGFAMPVMQNDENQKEIVEEKTSFD 65

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L+      K+IAV+K +R +T LG+KEAKE+  S P +LK  +SK+EA   K++LE+A
Sbjct: 66  VILEDI-ASDKRIAVLKVIRNLTSLGVKEAKEVTTSLPHTLKESVSKEEAETAKQQLEEA 124

Query: 120 GATVELR 126
           GA V+++
Sbjct: 125 GAKVKIQ 131


>gi|146299702|ref|YP_001194293.1| 50S ribosomal protein L7/L12 [Flavobacterium johnsoniae UW101]
 gi|189042994|sp|A5FIJ2|RL7_FLAJO RecName: Full=50S ribosomal protein L7/L12
 gi|146154120|gb|ABQ04974.1| 50S ribosomal protein L7/L12 [Flavobacterium johnsoniae UW101]
          Length = 123

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 86/126 (68%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A   VVA      G+A   +TEF V
Sbjct: 1   MADLKQFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVVVA-AGGGDGAAEEAQTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  D    K+AV+K V+ +T LGLKEAK++V+ AP ++K G+SK+EA  +KK LE+AG
Sbjct: 60  VLK--DAGASKLAVVKLVKELTGLGLKEAKDVVDGAPSNVKEGVSKEEAEGLKKSLEEAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|254485901|ref|ZP_05099106.1| ribosomal protein L7/L12 [Roseobacter sp. GAI101]
 gi|214042770|gb|EEB83408.1| ribosomal protein L7/L12 [Roseobacter sp. GAI101]
          Length = 123

 Score = 87.7 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+AG++A EKTEF+V
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGASAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEEVKAKLEAAG 117

Query: 121 ATVEL 125
           A VEL
Sbjct: 118 AEVEL 122


>gi|1313962|emb|CAA56249.1| mitochondrial ribosomal protein L7L12 [Homo sapiens]
          Length = 198

 Score = 87.7 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     V +   ++                 
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 IAKERTHFTVRLTEAKPVD-KVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE  G TV L
Sbjct: 182 EKIKAALEAVGGTVVL 197


>gi|154247291|ref|YP_001418249.1| 50S ribosomal protein L7/L12 [Xanthobacter autotrophicus Py2]
 gi|226734495|sp|A7IKP9|RL7_XANP2 RecName: Full=50S ribosomal protein L7/L12
 gi|154161376|gb|ABS68592.1| ribosomal protein L7/L12 [Xanthobacter autotrophicus Py2]
          Length = 124

 Score = 87.7 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 74/126 (58%), Positives = 97/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LSSLT++EAAEL+K LE++WGVSA+A V+V A  A  A +A  E+TEF V
Sbjct: 1   MADLTKLVDELSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPAGAAAAAVEEQTEFTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL      +KKI VIKEVRAIT LGLKEAK+LVE APK +K  +SKDEA ++K +LE AG
Sbjct: 61  VLAA--AGEKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEAVSKDEAEKLKAQLEKAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|291286304|ref|YP_003503120.1| 50S ribosomal protein L7/L12 [Denitrovibrio acetiphilus DSM 12809]
 gi|290883464|gb|ADD67164.1| ribosomal protein L7/L12 [Denitrovibrio acetiphilus DSM 12809]
          Length = 126

 Score = 87.7 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 80/122 (65%), Gaps = 1/122 (0%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + ++T+IE +EL K LE ++GVSASAP   +      AG  A+   + E  ++ 
Sbjct: 6   EQVIEFIENMTVIELSELVKELEDKFGVSASAP-VAMMAAGPAAGGEAAAAEQTEFTVEL 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KK+ VIK VR IT LGLKEAK LV+ AP  +K G+SK+EA E+K K+E+AGA+V 
Sbjct: 65  TAAGDKKVQVIKVVREITGLGLKEAKALVDGAPAPVKEGVSKEEAEELKAKIEEAGASVT 124

Query: 125 LR 126
           ++
Sbjct: 125 VK 126


>gi|163796060|ref|ZP_02190022.1| Ribosomal protein L7/L12 [alpha proteobacterium BAL199]
 gi|159178519|gb|EDP63059.1| Ribosomal protein L7/L12 [alpha proteobacterium BAL199]
          Length = 123

 Score = 87.7 bits (216), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 79/126 (62%), Positives = 104/126 (82%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV++ A   A+A  AA EKT+F+V
Sbjct: 1   MADLAKLVDELSTLTVLEAAELSKMLEEKWGVSAAAPVAMAA-APADAAPAAEEKTDFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKI VIKEVRAIT LGLKEAK+LVE+APKS+K G SKDEA ++KK+LEDAG
Sbjct: 60  ILATV--GDKKINVIKEVRAITGLGLKEAKDLVEAAPKSVKDGASKDEAAKIKKQLEDAG 117

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 118 ATVELK 123


>gi|308184946|ref|YP_003929079.1| 50S ribosomal protein L7/L12 [Helicobacter pylori SJM180]
 gi|308060866|gb|ADO02762.1| 50S ribosomal protein L7/L12 [Helicobacter pylori SJM180]
          Length = 125

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E AEL K  E+++GVSA+  V   A VA    + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELAELVKMFEEKFGVSATPTVVAGAAVAGGVAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|208435095|ref|YP_002266761.1| ribosomal protein L7/L12 [Helicobacter pylori G27]
 gi|210135357|ref|YP_002301796.1| 50S ribosomal protein L7/L12 [Helicobacter pylori P12]
 gi|217032209|ref|ZP_03437707.1| hypothetical protein HPB128_2g11 [Helicobacter pylori B128]
 gi|298735788|ref|YP_003728313.1| 50S ribosomal protein L7/L12 [Helicobacter pylori B8]
 gi|226733694|sp|B6JN38|RL7_HELP2 RecName: Full=50S ribosomal protein L7/L12
 gi|226733695|sp|B5Z8J6|RL7_HELPG RecName: Full=50S ribosomal protein L7/L12
 gi|208433024|gb|ACI27895.1| ribosomal protein L7/L12 [Helicobacter pylori G27]
 gi|210133325|gb|ACJ08316.1| 50S ribosomal protein L7/l12 [Helicobacter pylori P12]
 gi|216946080|gb|EEC24691.1| hypothetical protein HPB128_2g11 [Helicobacter pylori B128]
 gi|298354977|emb|CBI65849.1| large subunit ribosomal protein L7/L12 [Helicobacter pylori B8]
 gi|307637873|gb|ADN80323.1| LSU ribosomal protein L7/L12(P1/P2) [Helicobacter pylori 908]
 gi|317012980|gb|ADU83588.1| 50S ribosomal protein L7/L12 [Helicobacter pylori Lithuania75]
 gi|325996470|gb|ADZ51875.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 2018]
 gi|325998059|gb|ADZ50267.1| 50S ribosomal protein L7/L12 [Helicobacter pylori 2017]
          Length = 125

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + SL+++E AEL K  E+++GVSA+  V   A VA  A + + EKTEF V+L  
Sbjct: 6   EEVLEYIGSLSVLELAELVKMFEEKFGVSATPTVVAGAAVAGGAAAESEEKTEFNVILA- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+  E  P  LK G++K+EA  +KKKLE+ GA VE
Sbjct: 65  -DSGAEKIKVIKVVREITGLGLKEAKDATEKTPHVLKEGVNKEEAETIKKKLEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|319783307|ref|YP_004142783.1| ribosomal protein L7/L12 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169195|gb|ADV12733.1| ribosomal protein L7/L12 [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 125

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IV+ LS LT++EAAELSK LE++WGVSA+APV+V A   A A +A   EKTEF+
Sbjct: 1   MADLAKIVDDLSKLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAAPAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   +KI VIKEVRAIT LGLKEAK+LVE+APK +K  +SK +A++ K +LE A
Sbjct: 61  VVLT--DAGAQKINVIKEVRAITGLGLKEAKDLVEAAPKPVKEAVSKADADKFKAQLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|327295743|ref|XP_003232566.1| 50S ribosomal protein L12 [Trichophyton rubrum CBS 118892]
 gi|326464877|gb|EGD90330.1| 50S ribosomal protein L12 [Trichophyton rubrum CBS 118892]
          Length = 192

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 66/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------------VVAPVAAEAGS 50
            I  IV+++S LTL+E A+L   L+    +                     A    EA  
Sbjct: 58  KITKIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAAAAPGGAAAPAAAAEEEEAAP 117

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           AA EKT F + L+ F D   K  +IKEV+++  L L E+K+ VES PK +K  + K+EA 
Sbjct: 118 AAQEKTLFNLKLESF-DAASKAKIIKEVKSMLGLSLVESKKFVESVPKVIKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++   L+  GA   +
Sbjct: 177 KIVASLKALGAVASM 191


>gi|299747993|ref|XP_001837387.2| 60S ribosomal protein L7/L12 [Coprinopsis cinerea okayama7#130]
 gi|298407768|gb|EAU84303.2| 60S ribosomal protein L7/L12 [Coprinopsis cinerea okayama7#130]
          Length = 185

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 50/134 (37%), Positives = 72/134 (53%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG----------SAA 52
            I  IV+ +S LTL++AA+L  +L+    +   A  +     A   G             
Sbjct: 52  KISRIVDDISGLTLLQAADLVTQLKTRLNIQEIAMPAAAPAAAPAGGAAAASDEPAAEKP 111

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
            EKT F V L+ FD    K  +I+EV+A + +L L +AK+ VES PK LK  LSK++A +
Sbjct: 112 KEKTVFNVKLESFDAGS-KPKIIREVKALVPNLTLIDAKKFVESLPKMLKENLSKEDAEK 170

Query: 112 MKKKLEDAGATVEL 125
           +KK  ED GA V+L
Sbjct: 171 LKKAFEDLGAVVKL 184


>gi|114670948|ref|XP_001163363.1| PREDICTED: mitochondrial ribosomal protein L12 [Pan troglodytes]
          Length = 198

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 68/136 (50%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     V +   +                  
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMPGAVPAAAAQEAVEEDIP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 IAKERTHFTVRLTEAKPVD-KVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE  G TV L
Sbjct: 182 EKIKAALEAVGGTVVL 197


>gi|108773383|ref|YP_635845.1| ribosomal protein L12 [Oltmannsiellopsis viridis]
 gi|122244722|sp|Q20F00|RK12_OLTVI RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|82541965|gb|ABB82006.1| ribosomal protein L12 [Oltmannsiellopsis viridis]
          Length = 129

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 55/129 (42%), Positives = 80/129 (62%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP----VSVVAPVAAEAGSAASEKT 56
           MS    I+EKL +LTL+EAAEL  ++E+ +GV ASAP    + +    A  A    +EKT
Sbjct: 1   MSTTSEIIEKLKTLTLLEAAELVSQIEETFGVDASAPVGGGMVMAVGDAGGAAEEVAEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+VV++      K++AV+K +R +T LGL E K    S P +L+ G+SK+EA   K +L
Sbjct: 61  TFDVVVEDI-PSDKRVAVLKVIRKLTSLGLAEVKAFTNSLPGTLQEGISKEEAETAKTEL 119

Query: 117 EDAGATVEL 125
           E AGA V++
Sbjct: 120 EAAGAVVKI 128


>gi|170111671|ref|XP_001887039.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164638082|gb|EDR02362.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 186

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 69/131 (52%), Gaps = 10/131 (7%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG--------SAASEK 55
           I  IV+ +SSLTL++A +L   L+    +   A  +        A             EK
Sbjct: 56  ISRIVDDISSLTLLQAVDLVTELKTRLNIQEIAMPAAGVAAPQAAAPAADEPAVEKPKEK 115

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V L+ FD    K  VI+EV+A + +L L +AK+ VES PK LK  LSKD+A +++K
Sbjct: 116 TVFNVRLESFDAGS-KPKVIREVKALVPNLTLIDAKKFVESLPKVLKENLSKDDAEKLQK 174

Query: 115 KLEDAGATVEL 125
             E  GA V+L
Sbjct: 175 TFEAIGAIVKL 185


>gi|224178075|ref|YP_002600904.1| ribosomal protein L12 [Pyramimonas parkeae]
 gi|215882742|gb|ACJ71115.1| ribosomal protein L12 [Pyramimonas parkeae]
          Length = 130

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 65/126 (51%), Positives = 91/126 (72%), Gaps = 5/126 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA----ASEKTEFEV 60
           ++I+E+L S+TL+EAAEL  ++E+ +GV ASAPV     +AA  G+A      EKTEF+V
Sbjct: 6   DAIIEQLKSITLLEAAELVSQIEETFGVDASAPVGGGMMMAAAPGAASGAAEEEKTEFDV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+      K+IAVIK VRA+T LGLKEAK L+ES PK +K G+SKD+A + KK+LE+AG
Sbjct: 66  ILEEV-PSDKRIAVIKAVRALTSLGLKEAKSLIESTPKPIKEGVSKDDAEDAKKQLEEAG 124

Query: 121 ATVELR 126
             V ++
Sbjct: 125 GKVSIK 130


>gi|114771280|ref|ZP_01448700.1| ribosomal protein L7/L12 [alpha proteobacterium HTCC2255]
 gi|114548205|gb|EAU51092.1| ribosomal protein L7/L12 [alpha proteobacterium HTCC2255]
          Length = 140

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 64/126 (50%), Positives = 87/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I+ + E++ +LTL+EA EL   L+ E+G+  +A    V   AA   +A  EK EF+V
Sbjct: 18  MADIKKLAEEIVALTLLEAQELKTLLKDEYGIEPAAGG-AVVMAAAGDTAAEEEKDEFDV 76

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK      KKI VIKEVR IT LGLKEAK+LVE+  K++K G+SK EA E+KK+LE AG
Sbjct: 77  ILKS--AGDKKINVIKEVRGITGLGLKEAKDLVEAGGKAVKEGVSKSEAEELKKQLEAAG 134

Query: 121 ATVELR 126
           A VEL+
Sbjct: 135 AEVELK 140


>gi|312217306|emb|CBX97254.1| similar to ribosomal protein L12 [Leptosphaeria maculans]
          Length = 181

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 48/134 (35%), Positives = 74/134 (55%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I +IV+++S LTL+E A+L   L+    +         A  A  A +AA          
Sbjct: 48  KIATIVDQISQLTLLETADLVSTLKTRLNIPDMPMGGFAAGPAGAAPAAAPVEEEEAAPA 107

Query: 53  -SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
             EKT F + L+ FD    K  VIKE++A+  L L ++K+ VESAPK +K G++K+EA +
Sbjct: 108 AQEKTMFNLKLEKFDAAA-KPKVIKEIKAMLGLSLVDSKKFVESAPKMMKEGVAKEEAEK 166

Query: 112 MKKKLEDAGATVEL 125
           + + L+  GATV +
Sbjct: 167 IVETLKALGATVVM 180


>gi|51209891|ref|YP_063555.1| ribosomal protein L12 [Gracilaria tenuistipitata var. liui]
 gi|68053124|sp|Q6B905|RK12_GRATL RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|50657645|gb|AAT79630.1| 50S ribosomal protein L12 [Gracilaria tenuistipitata var. liui]
          Length = 131

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/130 (44%), Positives = 86/130 (66%), Gaps = 6/130 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS-----APVSVVAPVAAEAGSAASEKT 56
           + I +I+E L SLTL+EAAEL K++E+ + V AS       + +   V     +   EKT
Sbjct: 3   TKITNIIEDLKSLTLLEAAELIKQIEETFDVDASITSQSQAIVMPTAVDNSNKNEIEEKT 62

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+++L+      KKIA++K VR+IT LGLKEAK LVESAPK +K   +K+ + E+K++L
Sbjct: 63  EFDIILEEV-PAAKKIAILKVVRSITGLGLKEAKALVESAPKMIKDNTNKENSEEIKQQL 121

Query: 117 EDAGATVELR 126
           E+AGA V ++
Sbjct: 122 EEAGAKVSIK 131


>gi|163868088|ref|YP_001609292.1| 50S ribosomal protein L7/L12 [Bartonella tribocorum CIP 105476]
 gi|189042981|sp|A9ISF8|RL7_BART1 RecName: Full=50S ribosomal protein L7/L12
 gi|161017739|emb|CAK01297.1| 50S ribosomal protein L7/L12 [Bartonella tribocorum CIP 105476]
          Length = 123

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 93/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LTL+EAAELSK LE++W   ++A    VA VA  A  AA EKTEF+V
Sbjct: 1   MADLAKIVEDLSNLTLLEAAELSKLLEEKW-GVSAAAPVAVAAVAGAAAPAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   +   +KI VIKEVRA+T LGLKEAK+LVE APK +K G SK+EA ++K +LE AG
Sbjct: 60  IL--VEGGAQKINVIKEVRALTGLGLKEAKDLVEGAPKPIKEGASKEEAEKIKSQLEAAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|109119096|ref|XP_001111712.1| PREDICTED: 39S ribosomal protein L12, mitochondrial [Macaca
           mulatta]
          Length = 198

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 72/136 (52%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------- 55
            I+ +V+ ++SLTL+E ++L++ L+K   +     V +   +     +AA+++       
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMPGAVPAAAAQEVVEEEIP 122

Query: 56  -----TEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
                T F V L   +    K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 RAKERTHFTVRLTEANPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE  G TV L
Sbjct: 182 EKIKAALEAVGGTVVL 197


>gi|114053440|gb|ABI49504.1| Ribosomal protein L7/L12 C-terminal domain containing protein
           [Solanum demissum]
          Length = 262

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 48/128 (37%), Positives = 72/128 (56%), Gaps = 12/128 (9%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-----------PVAAEAGSAASE 54
            +V+++S LTL+E  E+S  + K  G++    V V+               A       E
Sbjct: 58  RLVDEVSGLTLVEVTEVSSIIMKRLGMTEQPTVGVMKAGAAELAAAMKGPEAAKEEKKPE 117

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KT FE+ L+ F+   +KI +IKEVR+ TDLGLKEAK+LVE  P   K G+SK++A ++  
Sbjct: 118 KTVFELKLESFES-AQKIKIIKEVRSSTDLGLKEAKDLVEKTPAVFKKGVSKEKAEQIID 176

Query: 115 KLEDAGAT 122
           K++  GA 
Sbjct: 177 KMKAVGAK 184


>gi|258512680|ref|YP_003186114.1| 50S ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257479406|gb|ACV59725.1| ribosomal protein L7/L12 [Alicyclobacillus acidocaldarius subsp.
           acidocaldarius DSM 446]
          Length = 123

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/121 (47%), Positives = 84/121 (69%), Gaps = 2/121 (1%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            I+E + ++T++E  EL K +E+E+GV+A+APV+          +A +E+TEF+V+L   
Sbjct: 5   EILEAVKNMTVLELNELVKAIEEEFGVTAAAPVAFAGAAPGAGEAAQAEQTEFDVILAS- 63

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                KI VIK VR IT LGLKEAKELV+ APK +K  +SK+EA  +K KLE+AGA+VE+
Sbjct: 64  -AGASKINVIKVVREITGLGLKEAKELVDGAPKPIKEKVSKEEAESIKAKLEEAGASVEI 122

Query: 126 R 126
           +
Sbjct: 123 K 123


>gi|298206597|ref|YP_003714776.1| 50S ribosomal protein L7/L12 [Croceibacter atlanticus HTCC2559]
 gi|83849227|gb|EAP87095.1| 50S ribosomal protein L7/L12 [Croceibacter atlanticus HTCC2559]
          Length = 124

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L++E+G+  +A    VA         A E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAAGGGADAGGADEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LKG      K+AV+K V+ +T  GLK+AKELV++AP  +K G++KDEA  +K +LE+AG
Sbjct: 61  ILKG--AGASKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGIAKDEAEALKAQLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|39936332|ref|NP_948608.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris CGA009]
 gi|192292058|ref|YP_001992663.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris TIE-1]
 gi|81562130|sp|Q6N4R8|RL7_RHOPA RecName: Full=50S ribosomal protein L7/L12; AltName:
           Full=RRP-L7/L12
 gi|226733729|sp|B3QC01|RL7_RHOPT RecName: Full=50S ribosomal protein L7/L12
 gi|39650187|emb|CAE28710.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris CGA009]
 gi|192285807|gb|ACF02188.1| ribosomal protein L7/L12 [Rhodopseudomonas palustris TIE-1]
          Length = 125

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A   +A   EKTEF 
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK LK G++K+EA ++K +LE A
Sbjct: 61  VVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVNKEEAEKVKAQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|228472149|ref|ZP_04056915.1| ribosomal protein L7/L12 [Capnocytophaga gingivalis ATCC 33624]
 gi|228276352|gb|EEK15076.1| ribosomal protein L7/L12 [Capnocytophaga gingivalis ATCC 33624]
          Length = 124

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 87/126 (69%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    V    A AG AA+EKTEF+V
Sbjct: 1   MADLKNFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVTAGPAAAGEAAAEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK +A  +KK LE+AG
Sbjct: 61  ILKS--AGDNKLAVVKLVKDLTGLGLKEAKEVVDGAPSKVKEGVSKADAENLKKSLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|27380522|ref|NP_772051.1| 50S ribosomal protein L7/L12 [Bradyrhizobium japonicum USDA 110]
 gi|81736391|sp|Q89J73|RL7_BRAJA RecName: Full=50S ribosomal protein L7/L12
 gi|27353686|dbj|BAC50676.1| 50S ribosomal protein L7/L12 [Bradyrhizobium japonicum USDA 110]
          Length = 125

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V  P    A +A   EKTEF 
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAGPAGGGAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL      +KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLAS--AGEKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEAEKIKVQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|223154|prf||0601198A polymerase beta,RNA
          Length = 253

 Score = 87.7 bits (216), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 53/70 (75%), Gaps = 2/70 (2%)

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+LK       K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK L
Sbjct: 1   EFDVILKA--AGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKAL 58

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 59  EEAGAEVEVK 68


>gi|321310983|ref|YP_004193312.1| 50S ribosomal protein L7/L12 [Mycoplasma haemofelis str. Langford
           1]
 gi|319802827|emb|CBY93473.1| ribosomal protein L7/L12 [Mycoplasma haemofelis str. Langford 1]
          Length = 124

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MS +  + I+E L   +++E  +L K +E+E+G+SA    SV A            ++EF
Sbjct: 1   MSKLSSKEIIESLKQYSILELNDLVKAIEEEFGISA--NFSVAAGSGGADAPKEDAQSEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
              L   +    KIAVIK +R +T LGL EAK++V++ P  +K  +   E  ++KKK  +
Sbjct: 59  N--LHLVNAGTNKIAVIKIIRELTGLGLMEAKKMVDTVPALVKEAVPAVEVEDLKKKFVE 116

Query: 119 AGATVELR 126
           AGA VE +
Sbjct: 117 AGAVVEFK 124


>gi|15965100|ref|NP_385453.1| 50S ribosomal protein L7/L12 [Sinorhizobium meliloti 1021]
 gi|307314835|ref|ZP_07594428.1| ribosomal protein L7/L12 [Sinorhizobium meliloti BL225C]
 gi|307322134|ref|ZP_07601508.1| ribosomal protein L7/L12 [Sinorhizobium meliloti AK83]
 gi|20978567|sp|Q92QH8|RL7_RHIME RecName: Full=50S ribosomal protein L7/L12
 gi|15074280|emb|CAC45926.1| Probable 50S ribosomal protein L7/L12 (L8) [Sinorhizobium meliloti
           1021]
 gi|306892219|gb|EFN23031.1| ribosomal protein L7/L12 [Sinorhizobium meliloti AK83]
 gi|306898949|gb|EFN29596.1| ribosomal protein L7/L12 [Sinorhizobium meliloti BL225C]
          Length = 126

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 72/126 (57%), Positives = 94/126 (74%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A   +A  E+ + E 
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAGAAAPVEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDAG
Sbjct: 61  DVILTDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDAG 120

Query: 121 ATVELR 126
           A V+++
Sbjct: 121 AKVDVK 126


>gi|303247798|ref|ZP_07334067.1| ribosomal protein L7/L12 [Desulfovibrio fructosovorans JJ]
 gi|302490882|gb|EFL50781.1| ribosomal protein L7/L12 [Desulfovibrio fructosovorans JJ]
          Length = 130

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 59/132 (44%), Positives = 90/132 (68%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           MS+I  E +V+ ++++T++E ++  K LE+++GVSA+AP   +   A  AG  A+     
Sbjct: 1   MSDITKEQVVDFIANMTVLELSQFIKELEEKFGVSAAAPAMGMMMAAPAAGGDAAAAEEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+VVL   +    KIAVIK VRA+T LGLKEAK  V+  P ++K G++K +A E KK
Sbjct: 61  KTEFDVVLT--NAGGNKIAVIKVVRALTGLGLKEAKAKVDELPSTIKEGVAKADAEEAKK 118

Query: 115 KLEDAGATVELR 126
           +L++AGAT E++
Sbjct: 119 QLDEAGATCEIK 130


>gi|57242439|ref|ZP_00370377.1| ribosomal protein L7/L12 [Campylobacter upsaliensis RM3195]
 gi|57016724|gb|EAL53507.1| ribosomal protein L7/L12 [Campylobacter upsaliensis RM3195]
          Length = 125

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  V      A    +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVVVAGGAAAGGGAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K +A E KK+LE+AGA VE
Sbjct: 65  -DSGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKADAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|163759406|ref|ZP_02166492.1| putative 50S ribosomal protein L7/L12 (L8) [Hoeflea phototrophica
           DFL-43]
 gi|162283810|gb|EDQ34095.1| putative 50S ribosomal protein L7/L12 (L8) [Hoeflea phototrophica
           DFL-43]
          Length = 125

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 76/127 (59%), Positives = 101/127 (79%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A     A + A+E KTEF+
Sbjct: 1   MADLAKIVEDLSNLTVLEAAELSKMLEEKWGVSAAAPVAVAAAGGGAAPAEAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVR+IT LGLKEAK+LVE+APK++K G+SK EA ++KKKLEDA
Sbjct: 61  VILA--EAGANKINVIKEVRSITGLGLKEAKDLVEAAPKAVKEGISKGEAEDLKKKLEDA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEVK 125


>gi|259146437|emb|CAY79694.1| Mnp1p [Saccharomyces cerevisiae EC1118]
          Length = 194

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 51/142 (35%), Positives = 68/142 (47%), Gaps = 20/142 (14%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-------------------SAPVSVVAP 43
            I  IV+ +S LTL+E + L   L+    +                         +  A 
Sbjct: 53  KISKIVQDISQLTLLETSSLINELKTVLNIPEISMPMGGFMAGAAGAGAGNVPSSTGEAG 112

Query: 44  VAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
             AE  +    KT F V L  F D K K  VIKEV+ +  L L EAK+ VE+APK LK  
Sbjct: 113 SGAEEEAKPEAKTVFTVKLDSF-DTKTKAKVIKEVKGLLGLSLVEAKKFVEAAPKVLKEN 171

Query: 104 LSKDEANEMKKKLEDAGATVEL 125
           ++KD+A ++KK LED GA V L
Sbjct: 172 VAKDDAEKIKKTLEDLGAKVSL 193


>gi|52840566|ref|YP_094365.1| 50S ribosomal protein L7/L12 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|54293313|ref|YP_125728.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Lens]
 gi|54296357|ref|YP_122726.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Paris]
 gi|148361061|ref|YP_001252268.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Corby]
 gi|296105870|ref|YP_003617570.1| large subunit ribosomal protein L7/L12 [Legionella pneumophila
           2300/99 Alcoy]
 gi|81601552|sp|Q5WZM0|RL7_LEGPL RecName: Full=50S ribosomal protein L7/L12
 gi|81602030|sp|Q5X867|RL7_LEGPA RecName: Full=50S ribosomal protein L7/L12
 gi|81603559|sp|Q5ZYQ1|RL7_LEGPH RecName: Full=50S ribosomal protein L7/L12
 gi|166222179|sp|A5IHS2|RL7_LEGPC RecName: Full=50S ribosomal protein L7/L12
 gi|52627677|gb|AAU26418.1| 50S ribosomal protein L7/L12 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|53750142|emb|CAH11534.1| 50S ribosomal subunit protein L7/L12 [Legionella pneumophila str.
           Paris]
 gi|53753145|emb|CAH14592.1| 50S ribosomal subunit protein L7/L12 [Legionella pneumophila str.
           Lens]
 gi|148282834|gb|ABQ56922.1| 50S ribosomal protein L7/L12 [Legionella pneumophila str. Corby]
 gi|295647771|gb|ADG23618.1| large subunit ribosomal protein L7/L12 [Legionella pneumophila
           2300/99 Alcoy]
 gi|307609130|emb|CBW98576.1| 50S ribosomal subunit protein L7/L12 [Legionella pneumophila 130b]
          Length = 126

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 89/123 (72%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
             I+E +S++T++E  EL + +E+++ VSA+A    VA  AA AG+AA  E+TEF VV+ 
Sbjct: 6   NEILETISNMTVMEVVELIEAMEEKFNVSAAAAAVAVAAPAAGAGAAAAEEQTEFTVVMT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+ VIK +R IT LGLKEAK+LVE AP ++K G+SKDEA  +KK+LE+AGATV
Sbjct: 66  SF--GSNKVNVIKAIRGITGLGLKEAKDLVEGAPSTVKEGVSKDEAASIKKELEEAGATV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|295133027|ref|YP_003583703.1| 50S ribosomal protein L7/L12 [Zunongwangia profunda SM-A87]
 gi|294981042|gb|ADF51507.1| 50S ribosomal protein L7/L12 [Zunongwangia profunda SM-A87]
          Length = 125

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 89/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++   E+L +LT+ E  EL+  L++E+G+  +A    VA  AA  G  A+E +TEF+
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGAAAGGEEAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLK+AKELV+ APK++K G+SKDEA  +K +LE+A
Sbjct: 61  VILKA--PGGSKLAVVKLVKELTGLGLKDAKELVDGAPKAVKEGVSKDEAEALKSQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|260780674|ref|YP_003227040.1| 50S ribosomal protein L12 [Bryopsis hypnoides]
 gi|260176752|gb|ACX33761.1| 50S ribosomal protein L12 [Bryopsis hypnoides]
          Length = 135

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 80/133 (60%), Gaps = 8/133 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA-----GSAASEKT 56
           +    I+EKL ++TL+EA EL K +E+ +GV  S    +      EA      ++  E+T
Sbjct: 3   TKTNEIIEKLKNITLLEAVELVKDIEETFGVDTSIGAPMTIGTNTEALNSVEATSQKEQT 62

Query: 57  EFEVVLKGFDDPKKK---IAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EF ++L+      +K   +++ + +R IT LGLK+AKEL    P+ LK  +SK++A+++K
Sbjct: 63  EFTIILEQVPGEDQKSKRLSIFRLIREITSLGLKDAKELTTKLPQPLKEAISKEQADDIK 122

Query: 114 KKLEDAGATVELR 126
            + E+AGA V+++
Sbjct: 123 NQFEEAGAKVKIQ 135


>gi|218672630|ref|ZP_03522299.1| 50S ribosomal protein L7/L12 [Rhizobium etli GR56]
          Length = 125

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +    EKTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGGPAGPAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLEDA
Sbjct: 61  VILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|188583687|ref|YP_001927132.1| 50S ribosomal protein L7/L12 [Methylobacterium populi BJ001]
 gi|226733707|sp|B1ZGR9|RL7_METPB RecName: Full=50S ribosomal protein L7/L12
 gi|179347185|gb|ACB82597.1| ribosomal protein L7/L12 [Methylobacterium populi BJ001]
          Length = 126

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 68/126 (53%), Positives = 91/126 (72%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  A    +A + + + E 
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAGGGAAAPAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK +K  ++KDEA ++K +LE AG
Sbjct: 61  TVVLASAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKESVAKDEAEKLKAQLEKAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|11465805|ref|NP_053949.1| ribosomal protein L12 [Porphyra purpurea]
 gi|1710409|sp|P51339|RK12_PORPU RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|1276805|gb|AAC08225.1| 50S ribosomal protein L12 [Porphyra purpurea]
          Length = 129

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 74/128 (57%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           + +E+I+E+L SL L+EAAEL K++E+ + V ASA    V + AP +A A S   EKTEF
Sbjct: 3   TKVENILEELKSLNLLEAAELVKQIEETFDVDASAASGGVMMAAPSSAPAASDVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+    PK KIAV+K VR++T LGLKEAK+LVESAPK+LK G SKD+A  MKK+LED
Sbjct: 63  DVVLEEVPAPK-KIAVLKVVRSLTGLGLKEAKDLVESAPKTLKEGASKDDAEAMKKQLED 121

Query: 119 AGATVELR 126
           AGATV ++
Sbjct: 122 AGATVGVK 129


>gi|149240043|ref|XP_001525897.1| hypothetical protein LELG_02455 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146450020|gb|EDK44276.1| hypothetical protein LELG_02455 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 183

 Score = 87.3 bits (215), Expect = 6e-16,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 72/133 (54%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS----------AA 52
            I  IV+++S LTL E ++L   L+    +S  A  +  A   + A +            
Sbjct: 51  KISQIVDQISVLTLFETSQLVSELKSRLNISDIALPAAGAAAPSGASAAPAEEEETKVPV 110

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F + L+ F D K K  +IKEV+ +  L L E+K+ VESAPK LK  ++K++A+++
Sbjct: 111 EEKTIFTIKLESF-DAKSKPKIIKEVKGLLGLSLVESKKFVESAPKVLKENVAKEDADKI 169

Query: 113 KKKLEDAGATVEL 125
           K  LE  GA V L
Sbjct: 170 KATLEGLGAKVTL 182


>gi|302916079|ref|XP_003051850.1| hypothetical protein NECHADRAFT_73620 [Nectria haematococca mpVI
           77-13-4]
 gi|256732789|gb|EEU46137.1| hypothetical protein NECHADRAFT_73620 [Nectria haematococca mpVI
           77-13-4]
          Length = 181

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------VVAPVAAEAGSAA 52
            IE+IV+++S LTL+E A+L   L+ +  +                   A  A EA  AA
Sbjct: 49  KIEAIVDQISQLTLLETADLVSSLKTKLNIPDMPIGGFAAAAPAAAAPAAEEAEEAAPAA 108

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           +EKT F + L+GF+    K  VIKEV+ +  L L ++K+ VESAPK +K  + K++A ++
Sbjct: 109 AEKTLFTLKLQGFE-TASKAKVIKEVKNMLGLSLVDSKKFVESAPKMMKENVPKEDAEKI 167

Query: 113 KKKLEDAGATVEL 125
              +++ GATV +
Sbjct: 168 ISAMKELGATVVM 180


>gi|325982733|ref|YP_004295135.1| 50S ribosomal protein L7/L12 [Nitrosomonas sp. AL212]
 gi|325532252|gb|ADZ26973.1| ribosomal protein L7/L12 [Nitrosomonas sp. AL212]
          Length = 126

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 91/123 (73%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           + I+E ++++T++E ++L K +E+++GVSA+A V+V A  +   G+AA  E+TEF V+L 
Sbjct: 6   DEILEAIANMTVLELSKLIKEMEEKFGVSAAAAVAVAAAPSGGGGAAAEAEQTEFTVILS 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                + K+ VIK VRA+T LGLKEAK+LV+ APK +K G SKDEA+ ++K+L +AGAT 
Sbjct: 66  S--AGESKVNVIKVVRAVTGLGLKEAKDLVDGAPKPVKEGASKDEADSIQKQLVEAGATC 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|86137184|ref|ZP_01055762.1| ribosomal protein L7/L12 [Roseobacter sp. MED193]
 gi|85826508|gb|EAQ46705.1| ribosomal protein L7/L12 [Roseobacter sp. MED193]
          Length = 123

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 66/125 (52%), Positives = 86/125 (68%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E +  LTL+EA EL   L+ E+G+  +A  +VV       G AA EKTEF+V
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMATGDAGGEAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+SKDEA E+K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVSKDEAEEVKGKLEAAG 117

Query: 121 ATVEL 125
           A VE+
Sbjct: 118 AEVEV 122


>gi|86749404|ref|YP_485900.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris HaA2]
 gi|109893792|sp|Q2IXS1|RL7_RHOP2 RecName: Full=50S ribosomal protein L7/L12
 gi|86572432|gb|ABD06989.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris HaA2]
          Length = 123

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 97/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A     A +A  EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAA-APGAAAAAVEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++K+EA+++K +LE AG
Sbjct: 60  MLAA--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKEEADKLKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|295107383|emb|CBL04926.1| LSU ribosomal protein L12P [Gordonibacter pamelaeae 7-10-1-b]
          Length = 125

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 72/122 (59%), Positives = 94/122 (77%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A   AE G+AA EKT+F+VVL+G
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAAAPAEGGAAAEEKTDFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KIAVIK VR IT LGLKEAKELVE APK ++ G++KD+A E+K KLE+AGA V 
Sbjct: 66  F--GDNKIAVIKVVREITSLGLKEAKELVEGAPKPIQEGVAKDKAEEIKAKLEEAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|22654272|sp|P41188|RL7_BUCAP RecName: Full=50S ribosomal protein L7/L12
 gi|21622931|gb|AAM67607.1| 50S ribosomal protein L7/l12 [Buchnera aphidicola str. Sg
           (Schizaphis graminum)]
          Length = 122

 Score = 87.3 bits (215), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S ++++   EL   +EK++GVSA      V        S   EKTEF++ LK 
Sbjct: 6   EQILEAVSEMSVMNVVELISAMEKKFGVSA---NMSVNTNNNSEKSTIEEKTEFDIFLKS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++VIK VR+ T LGLKEAK+LVESAP  LK  +SK++A  +KK LEDAGA +E
Sbjct: 63  I--GPNKVSVIKSVRSATGLGLKEAKDLVESAPTVLKENMSKNDAESLKKTLEDAGAEIE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|168063646|ref|XP_001783781.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162664724|gb|EDQ51433.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 195

 Score = 86.9 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 56/135 (41%), Positives = 82/135 (60%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV------------VAPVAAEAGS 50
            ++ I +++S+L+++EA +LS  L+K+ G+ A   +               +  AA A  
Sbjct: 61  KVQRIADEISTLSMVEAVDLSTLLKKKLGLPAGMGMMPMGMMPPGMGMPGSSGAAAAAEE 120

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
              EKT F+V L+ F D   KI +IKEVR  T LGLKEAKELVE AP  LK G+SK+EA+
Sbjct: 121 KKPEKTSFDVKLEKF-DAASKIKIIKEVRTFTALGLKEAKELVEKAPIVLKAGVSKEEAD 179

Query: 111 EMKKKLEDAGATVEL 125
           ++ +KL+  GATV +
Sbjct: 180 QIIEKLKSVGATVVM 194


>gi|27436901|ref|NP_002940.2| 39S ribosomal protein L12, mitochondrial precursor [Homo sapiens]
 gi|20981709|sp|P52815|RM12_HUMAN RecName: Full=39S ribosomal protein L12, mitochondrial;
           Short=L12mt; Short=MRP-L12; AltName: Full=5c5-2; Flags:
           Precursor
 gi|11177148|gb|AAG32154.1|AF059736_1 mitoribosomal protein L12 [Homo sapiens]
 gi|12803085|gb|AAH02344.1| Mitochondrial ribosomal protein L12 [Homo sapiens]
 gi|13960112|gb|AAH07497.1| Mitochondrial ribosomal protein L12 [Homo sapiens]
 gi|119610086|gb|EAW89680.1| mitochondrial ribosomal protein L12 [Homo sapiens]
          Length = 198

 Score = 86.9 bits (214), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 40/136 (29%), Positives = 69/136 (50%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     V +   ++                 
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQEAVEEDIP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
            A E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 IAKERTHFTVRLTEAKPVD-KVKLIKEIKNYIQGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE  G TV L
Sbjct: 182 EKIKAALEAVGGTVVL 197


>gi|30249987|ref|NP_842057.1| ribosomal protein L7/L12 domain-containing protein [Nitrosomonas
           europaea ATCC 19718]
 gi|81584589|sp|Q82T74|RL7_NITEU RecName: Full=50S ribosomal protein L7/L12
 gi|30139094|emb|CAD85958.1| Ribosomal protein L7/L12 C-terminal domain [Nitrosomonas europaea
           ATCC 19718]
          Length = 124

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 56/121 (46%), Positives = 86/121 (71%), Gaps = 3/121 (2%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            I+E ++++T++E +EL K +E+++GVSA+A    VA  A  A +A  E+TEF V+L   
Sbjct: 7   EILESIANMTVLELSELIKEMEEKFGVSAAAATVAVA-AAPAAAAAVEEQTEFSVILTA- 64

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                K+ VIK VRA+T LGLKEAK+LV+ APK++K G+SK++A  +KK+L +AGA  E+
Sbjct: 65  -AGDNKVNVIKVVRAVTGLGLKEAKDLVDGAPKTVKEGISKEDAESLKKQLVEAGAGCEI 123

Query: 126 R 126
           +
Sbjct: 124 K 124


>gi|90424948|ref|YP_533318.1| 50S ribosomal protein L7/L12 [Rhodopseudomonas palustris BisB18]
 gi|109893793|sp|Q211D7|RL7_RHOPB RecName: Full=50S ribosomal protein L7/L12
 gi|90106962|gb|ABD88999.1| LSU ribosomal protein L12P [Rhodopseudomonas palustris BisB18]
          Length = 123

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 99/126 (78%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V    AA A + A EKTEF V
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAG-PAAAAAAPAEEKTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL      +KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA+++K +LE AG
Sbjct: 60  VLAA--AGEKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVNKDEADKIKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|298531093|ref|ZP_07018494.1| ribosomal protein L7/L12 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509116|gb|EFI33021.1| ribosomal protein L7/L12 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 130

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 92/132 (69%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           MS+I  E +++ +S++T++E +E  K LE ++GVSA+APV+ +A   A  G  A+     
Sbjct: 1   MSDITKEQVIDFISNMTVLELSEFIKELEDKFGVSAAAPVAAMAAAPAAGGGEAAAEEEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+VVLK  D    KI VIK VRA+T+LGLKEAK  V+  P  +K  +SKD+A E KK
Sbjct: 61  QTEFDVVLK--DVGSNKIGVIKAVRALTNLGLKEAKAKVDELPSPIKEAVSKDDAAEAKK 118

Query: 115 KLEDAGATVELR 126
           +LE+AGATVE++
Sbjct: 119 QLEEAGATVEVK 130


>gi|115465515|ref|NP_001056357.1| Os05g0568300 [Oryza sativa Japonica Group]
 gi|4176422|dbj|BAA37170.1| ribosomal protein L12 [Oryza sativa Japonica Group]
 gi|51038123|gb|AAT93926.1| putative 50S ribosomal protein L12 [Oryza sativa Japonica Group]
 gi|51854291|gb|AAU10672.1| ribosomal protein L12 [Oryza sativa Japonica Group]
 gi|113579908|dbj|BAF18271.1| Os05g0568300 [Oryza sativa Japonica Group]
          Length = 179

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 52/128 (40%), Positives = 73/128 (57%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EKTE 57
            +  + + ++ LTL EA  L   L++  GVSA+A        A  A          EKTE
Sbjct: 52  KVLELGDAIAGLTLEEARGLVDHLQERLGVSAAAFAPAAVVAAPGAAGGGEDGAPAEKTE 111

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV++       +IA IK VRA+T+L LKEAK+L+E  PK  K  +SK+EA E KK+LE
Sbjct: 112 FDVVIEEVPSSA-RIATIKVVRALTNLALKEAKDLIEGLPKKAKEAVSKEEAEEAKKQLE 170

Query: 118 DAGATVEL 125
           + GA V +
Sbjct: 171 EVGAKVSI 178


>gi|292492413|ref|YP_003527852.1| ribosomal protein L7/L12 [Nitrosococcus halophilus Nc4]
 gi|291581008|gb|ADE15465.1| ribosomal protein L7/L12 [Nitrosococcus halophilus Nc4]
          Length = 127

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 89/122 (72%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T+++  EL + +E+++GVSA+APV+ VA  AA A + A+ + + E  +  
Sbjct: 6   EEILETISNMTVMDVVELIEAMEEKFGVSAAAPVAAVAAPAAGAEAGAAAEEKTEFDVVM 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR +T LGLKEAKELVE AP ++K G+SKDEA ++KK+LE+AGA+VE
Sbjct: 66  TSFGSNKVQVIKAVRGVTGLGLKEAKELVEGAPSAVKEGVSKDEAEDVKKQLEEAGASVE 125

Query: 125 LR 126
           ++
Sbjct: 126 VK 127


>gi|238020178|ref|ZP_04600604.1| hypothetical protein GCWU000324_00053 [Kingella oralis ATCC 51147]
 gi|237868572|gb|EEP69576.1| hypothetical protein GCWU000324_00053 [Kingella oralis ATCC 51147]
          Length = 124

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S+LT++E  EL K  E+++   ++A V+V A  AA   +A   KTEF+V+L  
Sbjct: 6   EDILEAVSNLTVMELNELVKAFEEKF-GVSAAAVAVAAGPAAGGAAAGEAKTEFDVILAS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK+LV+ APK+LK G+S+ EA+++KK+LE+AGA VE
Sbjct: 65  --AGDQKVGVIKVVRAITGLGLKEAKDLVDGAPKTLKEGVSQAEADDIKKQLEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|330720886|gb|EGG99073.1| LSU ribosomal protein L7/L12 (P1/P2) [gamma proteobacterium
           IMCC2047]
          Length = 125

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 89/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++  ++ ++++E  EL + +E+++GVSA+A V+     A +AG+AA  +TEF+VVL  
Sbjct: 6   DDLLNAIAEMSVMEVVELIEAMEEKFGVSAAAAVAAAPAAAGDAGAAAEAQTEFDVVLAS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KK+  IK VRAIT LGLKEAKE+V+ AP ++K G+SK+EA E+K +LE+AGATVE
Sbjct: 66  --AGDKKVNAIKAVRAITGLGLKEAKEMVDGAPSTVKEGVSKEEAEEIKGQLEEAGATVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|73964761|ref|XP_850016.1| PREDICTED: similar to 39S ribosomal protein L12, mitochondrial
           precursor (L12mt) (MRP-L12) (5c5-2) [Canis familiaris]
          Length = 198

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 39/136 (28%), Positives = 69/136 (50%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------S 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   + + A              
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGAMPSAAPAAAAPEAVEEEIP 122

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEA 109
              E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K EA
Sbjct: 123 KQKERTHFTVRLTEAKPVD-KVKLIKEIKNYIPGINLVQAKKLVESLPQEIKANVAKAEA 181

Query: 110 NEMKKKLEDAGATVEL 125
            ++K  LE  G TV L
Sbjct: 182 EKIKAALEAVGGTVVL 197


>gi|68482464|ref|XP_714864.1| likely mitochondrial ribosomal protein (E. coli L7/L12) [Candida
           albicans SC5314]
 gi|68482587|ref|XP_714802.1| likely mitochondrial ribosomal protein (E. coli L7/L12) [Candida
           albicans SC5314]
 gi|46436397|gb|EAK95760.1| likely mitochondrial ribosomal protein (E. coli L7/L12) [Candida
           albicans SC5314]
 gi|46436462|gb|EAK95824.1| likely mitochondrial ribosomal protein (E. coli L7/L12) [Candida
           albicans SC5314]
 gi|238883611|gb|EEQ47249.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 174

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 77/133 (57%), Gaps = 10/133 (7%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------ 55
           + I +IV+++S+LTL+E ++L   L++   +S  +     A  A  A +A +E+      
Sbjct: 42  AKITTIVDQISTLTLLETSQLINELKERLNISDISLPVGGAQAAPVAQAAPAEEEVKEEV 101

Query: 56  ---TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
              T F + L+ F D K K  +IKEV+ +  L L E+K+ VESAPK LK  ++K++A ++
Sbjct: 102 EEKTIFSIKLESF-DAKSKPKIIKEVKGMLGLSLVESKKFVESAPKVLKENVAKEDAEKI 160

Query: 113 KKKLEDAGATVEL 125
           K  LE  GA V L
Sbjct: 161 KATLEGLGAKVSL 173


>gi|16124752|ref|NP_419316.1| 50S ribosomal protein L7/L12 [Caulobacter crescentus CB15]
 gi|221233468|ref|YP_002515904.1| 50S ribosomal protein L7/L12 [Caulobacter crescentus NA1000]
 gi|295688168|ref|YP_003591861.1| 50S 50S ribosomal protein L7/L12 [Caulobacter segnis ATCC 21756]
 gi|20978571|sp|Q9AAU7|RL7_CAUCR RecName: Full=50S ribosomal protein L7/L12
 gi|254806270|sp|B8GZW2|RL7_CAUCN RecName: Full=50S ribosomal protein L7/L12
 gi|13421676|gb|AAK22484.1| ribosomal protein L7/L12 [Caulobacter crescentus CB15]
 gi|220962640|gb|ACL93996.1| LSU ribosomal protein L12P (L7/L12) [Caulobacter crescentus NA1000]
 gi|295430071|gb|ADG09243.1| ribosomal protein L7/L12 [Caulobacter segnis ATCC 21756]
          Length = 127

 Score = 86.9 bits (214), Expect = 8e-16,   Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 92/127 (72%), Gaps = 1/127 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS +E +VE+LS+L+++EAAELSK LE++WGVSA+APV+V A   A A  A + + + E 
Sbjct: 1   MSKLEKLVEELSTLSVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAPAEAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
            +   D   KKI VIKEVR +  DLGLKEAK+LVE AP+++   +SK +A E+ KKL +A
Sbjct: 61  TVVLVDGGDKKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVVENVSKQQAEEISKKLTEA 120

Query: 120 GATVELR 126
           GA ++++
Sbjct: 121 GAKIQIK 127


>gi|20808669|ref|NP_623840.1| ribosomal protein L7/L12 [Thermoanaerobacter tengcongensis MB4]
 gi|24212244|sp|Q8R7U5|RL7_THETN RecName: Full=50S ribosomal protein L7/L12
 gi|20517305|gb|AAM25444.1| Ribosomal protein L7/L12 [Thermoanaerobacter tengcongensis MB4]
          Length = 125

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 87/122 (71%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ + ++T++E AEL K LE+E+GVSA+APV+V A  AA A +AA  + + E  +  
Sbjct: 4   EEILQAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGAPAAAPAEEKTEFDVIL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAK+LV+S PK +K G+SK+EAN++K K E+ GA VE
Sbjct: 64  QEVGSDKIKVIKVVREITGLGLKEAKDLVDSVPKPIKEGVSKEEANQIKAKFEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|12837801|dbj|BAB23955.1| unnamed protein product [Mus musculus]
          Length = 201

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 39/138 (28%), Positives = 67/138 (48%), Gaps = 16/138 (11%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE--------------A 48
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   V                  
Sbjct: 64  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMVPGPVSAAAPASEAAEEED 123

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKD 107
                E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K 
Sbjct: 124 VPKQKERTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKA 182

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++K  LE  G TV L
Sbjct: 183 EAEKIKAALEAVGGTVVL 200


>gi|78187805|ref|YP_375848.1| 50S ribosomal protein L7/L12 [Chlorobium luteolum DSM 273]
 gi|109893779|sp|Q3B1H6|RL7_PELLD RecName: Full=50S ribosomal protein L7/L12
 gi|78167707|gb|ABB24805.1| LSU ribosomal protein L12P [Chlorobium luteolum DSM 273]
          Length = 123

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 92/123 (74%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE++VE++  LTL EA+EL K LE+++GVSA+  V      AA A +AA E+TEF+VVL 
Sbjct: 3   IETLVEEIGKLTLTEASELVKSLEEKFGVSAAPAVVAGVAAAAPAAAAAEEQTEFDVVLT 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                + KI VIK VRAIT LGLKEAK++V+ APK++K  +SKDEA ++ K+L+DAGA+V
Sbjct: 63  A--AGESKINVIKVVRAITGLGLKEAKDMVDGAPKTVKEAVSKDEAEKLMKELKDAGASV 120

Query: 124 ELR 126
           EL+
Sbjct: 121 ELK 123


>gi|325285441|ref|YP_004261231.1| 50S ribosomal protein L7/L12 [Cellulophaga lytica DSM 7489]
 gi|324320895|gb|ADY28360.1| 50S ribosomal protein L7/L12 [Cellulophaga lytica DSM 7489]
          Length = 125

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 88/127 (69%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA     AG  A+E +TEF+
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELANILKDEYGIEPAAAAVAVAAGGGAAGGEAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+AV+K V+ +T LGLK+AK++V+SAPK++K G+SKDEA  +KK LE+A
Sbjct: 61  VVLKS--AGASKLAVVKLVKELTGLGLKDAKDIVDSAPKAVKEGVSKDEAEGIKKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|281348654|gb|EFB24238.1| hypothetical protein PANDA_000708 [Ailuropoda melanoleuca]
          Length = 176

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 68/137 (49%), Gaps = 15/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------- 49
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   +   A              
Sbjct: 40  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGTMPGAAPAAAAPPEAAEEDI 99

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDE 108
               E+T F V L        K+ +IKEV+     + L +AK+LVES P+ +K  ++K E
Sbjct: 100 PTQKEQTHFTVRLTEAKPTD-KVKLIKEVKNYIQGINLVQAKKLVESLPQEIKANVAKAE 158

Query: 109 ANEMKKKLEDAGATVEL 125
           A ++K  LE  G TV L
Sbjct: 159 AEKIKAALEAVGGTVVL 175


>gi|152991726|ref|YP_001357447.1| 50S ribosomal protein L7/L12 [Sulfurovum sp. NBC37-1]
 gi|166222220|sp|A6Q6I1|RL7_SULNB RecName: Full=50S ribosomal protein L7/L12
 gi|151423587|dbj|BAF71090.1| 50S ribosomal protein L7/L12 [Sulfurovum sp. NBC37-1]
          Length = 124

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GV+A A   V A  AA  G AA E+TEF VVL  
Sbjct: 6   EDVLEFISNLSVLELSELVKEFEEKFGVTAQAT-VVAAGGAAAGGEAAEEQTEFNVVLT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI  IK VRAIT LGLKEAK  VE  P  LK G+SK+EA E KK++E+AGA+ E
Sbjct: 64  -DAGAKKINAIKVVRAITGLGLKEAKAAVEETPTVLKEGVSKEEAEEFKKQIEEAGASCE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|125553362|gb|EAY99071.1| hypothetical protein OsI_21028 [Oryza sativa Indica Group]
          Length = 179

 Score = 86.9 bits (214), Expect = 9e-16,   Method: Composition-based stats.
 Identities = 52/128 (40%), Positives = 73/128 (57%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-----EKTE 57
            +  + + ++ LTL EA  L   L++  GVSA+A        A  A          EKTE
Sbjct: 52  KVLELGDAIAGLTLEEARGLVDHLQERLGVSAAAFAPAAVVAAPGAAGGGEDGAPAEKTE 111

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VV++       +IA IK VRA+T+L LKEAK+L+E  PK  K  +SK+EA E KK+LE
Sbjct: 112 FDVVIEEVPSSA-RIATIKVVRALTNLVLKEAKDLIEGLPKKAKEAVSKEEAEEAKKQLE 170

Query: 118 DAGATVEL 125
           + GA V +
Sbjct: 171 EVGAKVSI 178


>gi|220921890|ref|YP_002497191.1| 50S ribosomal protein L7/L12 [Methylobacterium nodulans ORS 2060]
 gi|254806383|sp|B8IS76|RL7_METNO RecName: Full=50S ribosomal protein L7/L12
 gi|219946496|gb|ACL56888.1| ribosomal protein L7/L12 [Methylobacterium nodulans ORS 2060]
          Length = 126

 Score = 86.9 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 92/126 (73%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V+ LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +A + + + E 
Sbjct: 1   MADLAKLVDDLSSLTVLEAAELAKMLEEKWGVSAAAAVAVAAGPAAGGAAAPAVEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK +K  ++KDEA ++K +LE AG
Sbjct: 61  TVVLAGAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKESVAKDEAEKIKAQLEKAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|121534750|ref|ZP_01666571.1| ribosomal protein L7/L12 [Thermosinus carboxydivorans Nor1]
 gi|121306770|gb|EAX47691.1| ribosomal protein L7/L12 [Thermosinus carboxydivorans Nor1]
          Length = 125

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 84/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T++E AEL K LE+++GVSA+APV+V A  AA A +A + + + E  +  
Sbjct: 4   EQIMEAIEKMTVLELAELVKALEEKFGVSAAAPVAVAAAPAAGAAAAPAAEEKTEFDVIL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAK+LV+ APK +K  +SK +A  +K KL +AGATVE
Sbjct: 64  TNPGAGKINVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKADAEAIKAKLVEAGATVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|257792071|ref|YP_003182677.1| 50S ribosomal protein L7/L12 [Eggerthella lenta DSM 2243]
 gi|257475968|gb|ACV56288.1| ribosomal protein L7/L12 [Eggerthella lenta DSM 2243]
          Length = 125

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 71/122 (58%), Positives = 94/122 (77%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A   AE G+AA EKTEF+VVL+G
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAAAPAEGGAAAEEKTEFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KIAVIK VR IT LGLKEAKELVE APK ++ G++K++A E+K KLE+AGA V 
Sbjct: 66  F--GDNKIAVIKVVREITSLGLKEAKELVEGAPKPIQEGVNKEKAEEIKAKLEEAGAAVT 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|121997657|ref|YP_001002444.1| 50S ribosomal protein L7/L12 [Halorhodospira halophila SL1]
 gi|166222174|sp|A1WVD0|RL7_HALHL RecName: Full=50S ribosomal protein L7/L12
 gi|121589062|gb|ABM61642.1| LSU ribosomal protein L12P [Halorhodospira halophila SL1]
          Length = 128

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 84/128 (65%), Gaps = 5/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEF 58
           ++ + I+E +++++++E  EL + +E+++GV+A+A V+         G        +TEF
Sbjct: 3   ASKDEILESIANMSVMEVVELIEAMEEKFGVTAAAAVAAAPAAGGGGGDEGGAAEEQTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L        K+ VIK VR +T LGLKEAKE+VE  P  +K G SK+EA+++K KLE+
Sbjct: 63  DVILSSH--GDNKVGVIKAVRGVTGLGLKEAKEVVEGCPAPIKEGASKEEADDIKAKLEE 120

Query: 119 AGATVELR 126
           AGA+VEL+
Sbjct: 121 AGASVELK 128


>gi|289579154|ref|YP_003477781.1| ribosomal protein L7/L12 [Thermoanaerobacter italicus Ab9]
 gi|289528867|gb|ADD03219.1| ribosomal protein L7/L12 [Thermoanaerobacter italicus Ab9]
          Length = 125

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 84/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E A+L K LE+E+GVSA+APV   AP A    + A  + + E  +  
Sbjct: 4   EEILEAIKNMTVLELADLVKALEEEFGVSAAAPVVTAAPTAGAPAAGAPAEEKTEFDVIL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+ GA VE
Sbjct: 64  QEVGSDKIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|23012509|ref|ZP_00052576.1| COG0222: Ribosomal protein L7/L12 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 125

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  +V+ LS+LT++EAAELSK LE++WGVSA+APV+V A   A A + A  E+TEF+
Sbjct: 1   MADLAKLVDDLSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAGAAAPAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D  +KKI VIKEVRAIT LGLKE K+LVE+APKS+K G+SKDEA ++KK LE+A
Sbjct: 61  VILT--DAGEKKINVIKEVRAITGLGLKEVKDLVEAAPKSVKDGVSKDEAEKIKKVLEEA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVQVK 125


>gi|256269709|gb|EEU04979.1| Mnp1p [Saccharomyces cerevisiae JAY291]
          Length = 194

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 51/142 (35%), Positives = 68/142 (47%), Gaps = 20/142 (14%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-------------------SAPVSVVAP 43
            I  IV+ +S LTL+E + L   L+    +                         +  A 
Sbjct: 53  KISKIVQDISQLTLLETSSLINELKTVLNIPEISMPMGGFMAGAAGAGAGNVPSSTGEAG 112

Query: 44  VAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
             AE  +    KT F V L  F D K K  VIKEV+ +  L L EAK+ VE+APK LK  
Sbjct: 113 SGAEEEAKPEAKTVFTVKLDSF-DTKTKAKVIKEVKGLLGLSLVEAKKFVEAAPKVLKEN 171

Query: 104 LSKDEANEMKKKLEDAGATVEL 125
           ++KD+A ++KK LED GA V L
Sbjct: 172 VAKDDAEKIKKTLEDLGAKVSL 193


>gi|167772349|ref|ZP_02444402.1| hypothetical protein ANACOL_03726 [Anaerotruncus colihominis DSM
           17241]
 gi|167665452|gb|EDS09582.1| hypothetical protein ANACOL_03726 [Anaerotruncus colihominis DSM
           17241]
          Length = 125

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 63/124 (50%), Positives = 84/124 (67%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I   VE + +LT++E  EL K +E+E+GVSA+APV V    A  A    +EKTEF+V+L
Sbjct: 5   KILKFVEDIKTLTVLELNELVKAIEEEFGVSAAAPVMVAG-PATAAAGGEAEKTEFDVIL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+ VIK V+ IT LGLKEAK LV+ APK +K G+SK +A ++K KLE+AGAT
Sbjct: 64  AS--AGASKMGVIKLVKEITGLGLKEAKALVDEAPKPVKEGISKADAEDIKAKLEEAGAT 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|77165795|ref|YP_344320.1| 50S ribosomal protein L7/L12 [Nitrosococcus oceani ATCC 19707]
 gi|254434143|ref|ZP_05047651.1| ribosomal protein L7/L12 [Nitrosococcus oceani AFC27]
 gi|109893775|sp|Q3J8Q6|RL7_NITOC RecName: Full=50S ribosomal protein L7/L12
 gi|76884109|gb|ABA58790.1| LSU ribosomal protein L12P [Nitrosococcus oceani ATCC 19707]
 gi|207090476|gb|EDZ67747.1| ribosomal protein L7/L12 [Nitrosococcus oceani AFC27]
          Length = 126

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 94/123 (76%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E I+E +S++T+++  EL + +E+++GVSA+AP++  AP A     AA+ EKTEF+VVL 
Sbjct: 6   EEILETISNMTVMDVVELIEAMEEKFGVSAAAPIAAAAPAAGAEAGAAAEEKTEFDVVLV 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+ VIK VR+IT LGLKEAK+LVE AP  +K G+SKDEA+E+KK+LE+AGA++
Sbjct: 66  SF--GSNKVQVIKAVRSITSLGLKEAKDLVEGAPSPVKEGISKDEADEIKKQLEEAGASI 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|261401764|ref|ZP_05987889.1| ribosomal protein L7/L12 [Neisseria lactamica ATCC 23970]
 gi|313667425|ref|YP_004047709.1| 50S ribosomal protein L7/L12 [Neisseria lactamica ST-640]
 gi|59800190|sp|P0A0W8|RL7_NEILA RecName: Full=50S ribosomal protein L7/L12
 gi|59800191|sp|P0A0W9|RL7_NEISI RecName: Full=50S ribosomal protein L7/L12
 gi|11321428|gb|AAG34164.1|AF312972_1 ribosomal protein L7/L12 [Neisseria lactamica]
 gi|11321432|gb|AAG34166.1|AF312974_1 ribosomal protein L7/L12 [Neisseria sicca ATCC 29256]
 gi|269208102|gb|EEZ74557.1| ribosomal protein L7/L12 [Neisseria lactamica ATCC 23970]
 gi|309379170|emb|CBX22301.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313004887|emb|CBN86313.1| 50S ribosomal protein L7/L12 [Neisseria lactamica 020-06]
          Length = 122

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 87/122 (71%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++GVSA+A        +A   +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKFGVSAAAVAVAS---SAGPAAAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 63  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|17555534|ref|NP_499360.1| hypothetical protein W09D10.3 [Caenorhabditis elegans]
 gi|3880624|emb|CAB07857.1| C. elegans protein W09D10.3, confirmed by transcript evidence
           [Caenorhabditis elegans]
          Length = 173

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 5/129 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-----SEKT 56
           + + S+VE++++L+L++ ++L+  L+K   +     ++  A   A    A       +K 
Sbjct: 44  AKVSSLVEEIANLSLLDVSDLNWALKKRLNIPDQPLMAAAAAAPAAQAEAEAASDVPQKM 103

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F V L  FDD KK   + +   AI  L L +AK+ VE+AP ++K  L K EA+E+K  L
Sbjct: 104 TFTVKLTKFDDTKKIAIIKEIRNAIPGLNLVQAKKFVETAPVNVKEDLGKAEADELKAIL 163

Query: 117 EDAGATVEL 125
           E AGAT+E+
Sbjct: 164 EKAGATIEI 172


>gi|70994008|ref|XP_751851.1| 50S ribosomal protein L12 [Aspergillus fumigatus Af293]
 gi|66849485|gb|EAL89813.1| 50S ribosomal protein L12 [Aspergillus fumigatus Af293]
 gi|159125231|gb|EDP50348.1| 50S ribosomal protein L12 [Aspergillus fumigatus A1163]
          Length = 187

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/137 (29%), Positives = 65/137 (47%), Gaps = 15/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I  IV+++S LTL+E A+L   L+    +                G+AA          
Sbjct: 51  KITQIVDQISQLTLLETADLVASLKSRLNIPDLPVGGFAVAAGPGGGAAAAPAAAEEEEA 110

Query: 53  ----SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
                EKT F + L+   D   K  VIKE++ +  L L ++K+ VES PK +K  + K+E
Sbjct: 111 APAAQEKTLFNLKLETV-DAASKAKVIKEIKGLLGLSLVDSKKFVESVPKMMKESVPKEE 169

Query: 109 ANEMKKKLEDAGATVEL 125
           A ++ + L+  GA V +
Sbjct: 170 AEKIIETLKAVGAKVVM 186


>gi|6321369|ref|NP_011447.1| Mnp1p [Saccharomyces cerevisiae S288c]
 gi|1723848|sp|P53163|MNP1_YEAST RecName: Full=54S ribosomal protein L12, mitochondrial; AltName:
           Full=Mitochondrial-nucleoid protein 1; Flags: Precursor
 gi|1322579|emb|CAA96773.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|151943736|gb|EDN62046.1| mitochondrial-nucleoid protein [Saccharomyces cerevisiae YJM789]
 gi|190407028|gb|EDV10295.1| conserved hypothetical protein [Saccharomyces cerevisiae RM11-1a]
 gi|207345332|gb|EDZ72188.1| YGL068Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|285812134|tpg|DAA08034.1| TPA: Mnp1p [Saccharomyces cerevisiae S288c]
          Length = 194

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 51/142 (35%), Positives = 68/142 (47%), Gaps = 20/142 (14%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-------------------SAPVSVVAP 43
            I  IV+ +S LTL+E + L   L+    +                         +  A 
Sbjct: 53  KISKIVQDISQLTLLETSSLINELKTVLNIPEISMPMGGFMAGAAGAGAGNVPSSTGEAG 112

Query: 44  VAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
             AE  +    KT F V L  F D K K  VIKEV+ +  L L EAK+ VE+APK LK  
Sbjct: 113 SGAEEEAKPEAKTVFTVKLDSF-DTKTKAKVIKEVKGLLGLSLVEAKKFVEAAPKVLKEN 171

Query: 104 LSKDEANEMKKKLEDAGATVEL 125
           ++KD+A ++KK LED GA V L
Sbjct: 172 VAKDDAEKIKKTLEDLGAKVSL 193


>gi|313903160|ref|ZP_07836554.1| LSU ribosomal protein L12P [Thermaerobacter subterraneus DSM 13965]
 gi|313466662|gb|EFR62182.1| LSU ribosomal protein L12P [Thermaerobacter subterraneus DSM 13965]
          Length = 127

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           MS ++ +++ +  +T++E AEL K+ E+E+GVSA+APV+V AP AA   +A     EKTE
Sbjct: 1   MSKVQEVLDIVKGMTVLELAELVKKFEEEFGVSAAAPVAVAAPAAAAGAAAPAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LK  D    KI VIK VR +T LGLKEAK+LV++APK +K G SK+EA ++K KL 
Sbjct: 61  FNVILK--DVGANKIQVIKVVRELTGLGLKEAKDLVDNAPKPIKEGASKEEAEQIKAKLA 118

Query: 118 DAGATVELR 126
           + GATVE++
Sbjct: 119 EVGATVEIQ 127


>gi|256427010|gb|ACU81078.1| 50S ribosomal protein L12 [Candidatus Liberibacter psyllaurous]
          Length = 119

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 89/121 (73%), Positives = 104/121 (85%), Gaps = 2/121 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MSNIESIVE+LSSLTLI+AAELSK+LE++WGVSASAPV+V A  A E+  A +EKTEF+V
Sbjct: 1   MSNIESIVEQLSSLTLIQAAELSKKLEEKWGVSASAPVAVSASAATESV-AVAEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL GF+    KI VIKEVRAIT+LGLKEAKELVES+PKSLK G+SK +A E+KKKLE AG
Sbjct: 60  VLTGFNATS-KINVIKEVRAITNLGLKEAKELVESSPKSLKGGVSKGDAEEIKKKLEAAG 118

Query: 121 A 121
           A
Sbjct: 119 A 119


>gi|11467547|ref|NP_043693.1| ribosomal protein L12 [Odontella sinensis]
 gi|1350607|sp|P49550|RK12_ODOSI RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|1185242|emb|CAA91725.1| 50S ribosomal protein L12 [Odontella sinensis]
          Length = 127

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 80/124 (64%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I+ IVE+L +LTL+EA+EL  ++E+ + V ASA V     +A  A     E+     V+
Sbjct: 4   KIDQIVEELKTLTLLEASELVSKIEETFDVDASASVGGGMMMAGPAVVEEVEEKTEFDVM 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KKIAV+K VR++T LGLKEAKELVESAPK ++ G++KD A E KK++EDAG  
Sbjct: 64  LDEVPADKKIAVLKVVRSLTGLGLKEAKELVESAPKQIQEGVAKDAAEEAKKQIEDAGGK 123

Query: 123 VELR 126
             L+
Sbjct: 124 ASLK 127


>gi|53804625|ref|YP_113540.1| 50S ribosomal protein L7/L12 [Methylococcus capsulatus str. Bath]
 gi|81682420|sp|Q60A07|RL7_METCA RecName: Full=50S ribosomal protein L7/L12
 gi|53758386|gb|AAU92677.1| ribosomal protein L7/L12 [Methylococcus capsulatus str. Bath]
          Length = 125

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  +L   +E+++GVSA+A V+V    A  A  A  EKTEF+VV+  
Sbjct: 6   EDILETISNMTVMEIVDLISAMEEKFGVSAAAAVAVAPVAAGAAAPAVEEKTEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK +R IT LGLKEAK+LVE  P ++K G+SK EA+++KKKLE+AGA V+
Sbjct: 66  F--GANKVNVIKAIREITGLGLKEAKDLVEGVPSTVKEGISKAEADDIKKKLEEAGAAVD 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|329890168|ref|ZP_08268511.1| ribosomal protein L7/L12 [Brevundimonas diminuta ATCC 11568]
 gi|328845469|gb|EGF95033.1| ribosomal protein L7/L12 [Brevundimonas diminuta ATCC 11568]
          Length = 126

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 74/128 (57%), Positives = 96/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++  IVE+LS+LT++EAAELSK LE++WGVSA+APV+V A   A   + A E +TEF 
Sbjct: 1   MADLAKIVEELSALTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGAAEAAPAGEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           VVL   D   KKI VIKEVR + TDLGLKEAK+LVE AP+ +   +SK  A E+KKKLE+
Sbjct: 61  VVL--VDGGDKKINVIKEVRGVRTDLGLKEAKDLVEGAPQPVVENVSKQTAEELKKKLEE 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAKVEIK 126


>gi|114778902|ref|ZP_01453699.1| ribosomal protein L7/L12 [Mariprofundus ferrooxydans PV-1]
 gi|114550871|gb|EAU53437.1| ribosomal protein L7/L12 [Mariprofundus ferrooxydans PV-1]
          Length = 127

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 85/122 (69%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + +++ + S+T++E +EL   LE+++GVSA+APV+V A  AA  G+A + + + E  +  
Sbjct: 6   DELIQAIESMTVLELSELVSALEEKFGVSAAAPVAVAAGPAAAGGAADAAEEKTEFDVVL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR  T LGLKEAK +V+ AP ++K G+SKD+A  +K KLE+AGATVE
Sbjct: 66  ASAGDKKIQVIKAVREATGLGLKEAKAVVDGAPGTVKEGVSKDDAEALKAKLEEAGATVE 125

Query: 125 LR 126
           L+
Sbjct: 126 LK 127


>gi|83594028|ref|YP_427780.1| 50S ribosomal protein L7/L12 [Rhodospirillum rubrum ATCC 11170]
 gi|109893794|sp|Q2RQV2|RL7_RHORT RecName: Full=50S ribosomal protein L7/L12
 gi|83576942|gb|ABC23493.1| LSU ribosomal protein L12P [Rhodospirillum rubrum ATCC 11170]
          Length = 123

 Score = 86.5 bits (213), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 80/126 (63%), Positives = 103/126 (81%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A VAAEA +   EKTEF+V
Sbjct: 1   MADLAKLVDELSALTVLEAAELSKLLEEKWGVSAAAPVAVAA-VAAEAAAPVEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   KKI VIKEVRAIT+LGLKEAK+LVE APK +K  +SKDEA  +KKKLE+AG
Sbjct: 60  IL--VDAGDKKINVIKEVRAITNLGLKEAKDLVEGAPKPVKEAVSKDEAASIKKKLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|315925311|ref|ZP_07921522.1| 50S ribosomal protein L7/L12 [Pseudoramibacter alactolyticus ATCC
           23263]
 gi|315621212|gb|EFV01182.1| 50S ribosomal protein L7/L12 [Pseudoramibacter alactolyticus ATCC
           23263]
          Length = 125

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 91/124 (73%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            +E ++E + +L+++E +EL   LE+E+GVSA+APV+V A  AA  G A +EK++F+VVL
Sbjct: 4   KVEKLIEDVKALSVMELSELVSALEEEFGVSAAAPVAVAAAPAAAGGEAPAEKSDFDVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR +T LGLKEAK LV+ APK LK G++K+EA EMK K+E+ GAT
Sbjct: 64  ASV--GDQKIKVIKVVRELTGLGLKEAKALVDGAPKPLKEGVAKEEAEEMKSKIEEVGAT 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|121707491|ref|XP_001271854.1| 50S ribosomal protein L12 [Aspergillus clavatus NRRL 1]
 gi|119400002|gb|EAW10428.1| 50S ribosomal protein L12 [Aspergillus clavatus NRRL 1]
          Length = 184

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I  IV+++S LTL+E A+L   L+    +               AG+AA          
Sbjct: 51  KITQIVDQISQLTLLETADLVASLKSRLNIPDLPMGGFAMAAGPGAGAAAPVEEEEAAPA 110

Query: 53  -SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
             EKT F + L+   D   K  VIKE++ +  L L ++K+ VES PK +K  + K+EA +
Sbjct: 111 VQEKTLFNLKLEAV-DAASKAKVIKEIKGLLGLSLVDSKKFVESVPKVMKESVPKEEAEK 169

Query: 112 MKKKLEDAGATVEL 125
           + + L+  G  V +
Sbjct: 170 IIETLKAVGGKVIM 183


>gi|307267201|ref|ZP_07548707.1| ribosomal protein L7/L12 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306917780|gb|EFN48048.1| ribosomal protein L7/L12 [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 125

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 64/124 (51%), Positives = 88/124 (70%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E AEL K LE+E+GVSA+APV+V A  AA   +AA  + + E  +
Sbjct: 2   NKEEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGVPAAAPAEEKTEFDV 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+ GA 
Sbjct: 62  ILQEVGSDKIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEEVGAK 121

Query: 123 VELR 126
           VE++
Sbjct: 122 VEIK 125


>gi|167036792|ref|YP_001664370.1| ribosomal protein L7/L12 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|320115214|ref|YP_004185373.1| 50S ribosomal protein L7/L12 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|326390670|ref|ZP_08212225.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus JW 200]
 gi|226734486|sp|B0KCJ1|RL7_THEP3 RecName: Full=50S ribosomal protein L7/L12
 gi|166855626|gb|ABY94034.1| ribosomal protein L7/L12 [Thermoanaerobacter pseudethanolicus ATCC
           33223]
 gi|319928305|gb|ADV78990.1| ribosomal protein L7/L12 [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993348|gb|EGD51785.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus JW 200]
          Length = 125

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 89/124 (71%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E AEL K LE+E+GVSA+APV+V A  AA A +AA  + + E  +
Sbjct: 2   NKEEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGAPAAAPAEEKTEFDV 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+ GA 
Sbjct: 62  ILQEVGSDKIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEEVGAK 121

Query: 123 VELR 126
           VE++
Sbjct: 122 VEIK 125


>gi|224074131|ref|XP_002304265.1| predicted protein [Populus trichocarpa]
 gi|222841697|gb|EEE79244.1| predicted protein [Populus trichocarpa]
          Length = 216

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 15/134 (11%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV--------------VAPVAAEAGSA 51
            +VE+++ LTL+E +EL   + K   ++    + V                  AA     
Sbjct: 83  KLVEEIAGLTLMEISELGTIIMKRMKMTEPPTIGVLKGGAAGLAGMAMKAPAAAAAKEEK 142

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
            +EKT FE+ L+ F+    KI VIKEVR+ TDLGLKEAK+LVE  P  LK G+SK+E  +
Sbjct: 143 KAEKTVFELKLESFEA-ASKIKVIKEVRSFTDLGLKEAKDLVEKTPSVLKKGVSKEEGEQ 201

Query: 112 MKKKLEDAGATVEL 125
           + +K++  GA V L
Sbjct: 202 IIEKMKAIGAKVVL 215


>gi|149723255|ref|XP_001488564.1| PREDICTED: similar to mitochondrial ribosomal protein L7/12 isoform
           1 [Equus caballus]
          Length = 199

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 40/137 (29%), Positives = 68/137 (49%), Gaps = 15/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG------------- 49
            I+ +V+ ++SLTL+E ++L++ L+K   +     + V   +   A              
Sbjct: 63  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPVGGMMPGAAPAAAAAPEAAEEDI 122

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDE 108
               E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K E
Sbjct: 123 PKQKEQTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAKAE 181

Query: 109 ANEMKKKLEDAGATVEL 125
           A ++K  LE  G TV L
Sbjct: 182 AEKIKAALEAVGGTVVL 198


>gi|150025249|ref|YP_001296075.1| 50S ribosomal protein L7/L12 [Flavobacterium psychrophilum
           JIP02/86]
 gi|166222166|sp|A6GYU1|RL7_FLAPJ RecName: Full=50S ribosomal protein L7/L12
 gi|45439265|gb|AAS64309.1| putative ribosomal protein L7/L12 [Flavobacterium psychrophilum]
 gi|149771790|emb|CAL43264.1| 50S ribosomal protein L7/L12 [Flavobacterium psychrophilum
           JIP02/86]
          Length = 122

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  +L+  L+ E+G+  +A   V+   A    +A   +TEF V
Sbjct: 1   MADLKQFAEQLVNLTVKEVNDLATILKDEYGIEPAAAAVVM--QAGGGEAAEEAQTEFTV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    K+AV+K V+ +T LGLKEAK+LV++AP ++K G+SKDEA  +KK LE+AG
Sbjct: 59  VLK--EAGASKLAVVKAVKELTGLGLKEAKDLVDAAPSNVKEGVSKDEAEGLKKSLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AVVELK 122


>gi|221632697|ref|YP_002521918.1| 50S ribosomal protein L7/L12 [Thermomicrobium roseum DSM 5159]
 gi|221157085|gb|ACM06212.1| ribosomal protein L7/L12 [Thermomicrobium roseum DSM 5159]
          Length = 132

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 84/128 (65%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA----ASEKTEF 58
            +E I++ +  +T++E ++L K LE+ +GV+A+      AP A  A +A      EKTEF
Sbjct: 7   KLEEIIQAIEQMTVLELSQLVKALEERFGVTAAPVAVAAAPAAGAAPAAAAPAEEEKTEF 66

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L   D    KI VIK VR +T LGLKEAK+LVE+APK +K G+SK EA  +K+KLE 
Sbjct: 67  DVILS--DVGPNKIQVIKVVRELTQLGLKEAKDLVEAAPKPVKQGVSKQEAETIKQKLEA 124

Query: 119 AGATVELR 126
            GA VE++
Sbjct: 125 VGAKVEIK 132


>gi|257460969|ref|ZP_05626069.1| ribosomal protein L7/L12 [Campylobacter gracilis RM3268]
 gi|257441632|gb|EEV16775.1| ribosomal protein L7/L12 [Campylobacter gracilis RM3268]
          Length = 126

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 87/123 (70%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  AG+AA  EKTEF+VVL 
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGAGAAAAEEKTEFDVVL- 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D   KKI VIK VRA+T LGLKEAK+  E+ P  LK GL+K++A + KK+LE+AGA V
Sbjct: 65  -LDAGDKKINVIKVVRALTGLGLKEAKDATEATPSVLKEGLNKEDAEKAKKELEEAGAKV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|238927911|ref|ZP_04659671.1| ribosomal protein L7/L12 [Selenomonas flueggei ATCC 43531]
 gi|238884244|gb|EEQ47882.1| ribosomal protein L7/L12 [Selenomonas flueggei ATCC 43531]
          Length = 123

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 87/124 (70%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A   A   +   EK+EF VVL
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGGAAPAAGGEEKSEFTVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KKI VIK VR  T LGLKEAKELV+ APK +K  + K EA E+KKKLE+AGAT
Sbjct: 62  AA--AGDKKINVIKAVREATGLGLKEAKELVDGAPKPVKENVGKAEAEELKKKLEEAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|326472320|gb|EGD96329.1| 50S ribosomal protein L12 [Trichophyton tonsurans CBS 112818]
 gi|326484490|gb|EGE08500.1| 50S ribosomal protein L12 [Trichophyton equinum CBS 127.97]
          Length = 192

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I  IV+++S LTL+E A+L   L+    +         A     A + A          
Sbjct: 58  KITKIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAAAAPGGAAAPAAAAEEEEAVP 117

Query: 53  --SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
              EKT F + L+ F D   K  +IKEV+++  L L E+K+ VES PK +K  + K+EA 
Sbjct: 118 AAQEKTLFNLKLESF-DAASKAKIIKEVKSMLGLSLVESKKFVESVPKVIKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++   L+  GA   +
Sbjct: 177 KIVASLKALGAVASM 191


>gi|255725004|ref|XP_002547431.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240135322|gb|EER34876.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 171

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 47/133 (35%), Positives = 78/133 (58%), Gaps = 10/133 (7%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------ 55
           + I +IV+++S+LTL+E ++L   L++   +S  +  +  A  A  A +A +E+      
Sbjct: 39  AKITTIVDQISTLTLLETSQLINELKERLNISDISLPAAGAGAAPAAQAAPAEEEVKEEV 98

Query: 56  ---TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
              T F + L+ F D K K  +IKEV+ +  L L E+K+ VESAPK LK  ++K++A ++
Sbjct: 99  EEKTIFSIKLESF-DAKSKPKIIKEVKGMLGLSLVESKKFVESAPKVLKENVTKEDAEKI 157

Query: 113 KKKLEDAGATVEL 125
           K  LE  GA + L
Sbjct: 158 KATLEGLGAKITL 170


>gi|262277087|ref|ZP_06054880.1| ribosomal protein L7/L12 [alpha proteobacterium HIMB114]
 gi|262224190|gb|EEY74649.1| ribosomal protein L7/L12 [alpha proteobacterium HIMB114]
          Length = 123

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IV++LS+L+++EAAELSK LE +WGV+A+APV+  A   A  G+ A EK EF V
Sbjct: 1   MADLNKIVDELSTLSVVEAAELSKLLEDKWGVTAAAPVAAAA-APAAGGAPAEEKDEFSV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL        KI VIKEVRA T LGLKEAK+LVE APK LK G++K +A E+KKK E AG
Sbjct: 60  VLSA--AGDNKIGVIKEVRAFTGLGLKEAKDLVEGAPKELKAGVNKKDAEEVKKKFEAAG 117

Query: 121 ATVELR 126
           A +EL+
Sbjct: 118 AKIELK 123


>gi|126659908|ref|ZP_01731032.1| 50S ribosomal protein L7/L12 [Cyanothece sp. CCY0110]
 gi|126618772|gb|EAZ89517.1| 50S ribosomal protein L7/L12 [Cyanothece sp. CCY0110]
          Length = 133

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 63/132 (47%), Positives = 87/132 (65%), Gaps = 8/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-------VSVVAPVAAEAGSAASE 54
           +  + I+EKL SLTL+EA+EL  ++E+ +GVSASAP               A A     E
Sbjct: 3   AATDEILEKLKSLTLLEASELVTQIEEAFGVSASAPSGGMMMMAPGAGAPGAAAAEPEEE 62

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L+      KKIA++K VR IT LGLKEAK++VES PK +K G  K++A ++KK
Sbjct: 63  KTEFDVILEDV-PGDKKIAILKVVRGITGLGLKEAKDMVESTPKPIKEGTGKEDAEDIKK 121

Query: 115 KLEDAGATVELR 126
           KLE+AGA V ++
Sbjct: 122 KLEEAGAKVTVK 133


>gi|254490696|ref|ZP_05103881.1| ribosomal protein L7/L12 [Methylophaga thiooxidans DMS010]
 gi|224464152|gb|EEF80416.1| ribosomal protein L7/L12 [Methylophaga thiooxydans DMS010]
          Length = 125

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S++T++E  +L + +E+++GV+A+APV+  A  A    +AA+E+TEF+VV+  
Sbjct: 6   DDILEAISNMTVVEVVDLIEAMEEKFGVTAAAPVAAAAAPAEGGAAAAAEQTEFDVVMTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K++VIK VR +T LGLKEAKE+VE  P ++K G+ K EA ++ K+L +AGA  E
Sbjct: 66  F--GDNKVSVIKVVRGLTGLGLKEAKEMVEGVPATVKEGVEKAEAEDVVKQLTEAGAAAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|217979964|ref|YP_002364111.1| 50S ribosomal protein L7/L12 [Methylocella silvestris BL2]
 gi|254806384|sp|B8EMS0|RL7_METSB RecName: Full=50S ribosomal protein L7/L12
 gi|217505340|gb|ACK52749.1| ribosomal protein L7/L12 [Methylocella silvestris BL2]
          Length = 126

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 95/126 (75%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+A V+V A  AA A +AA  + + E 
Sbjct: 1   MANLEKIVEDLSTLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGAAAAAPAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRA+T LGLKEAK+LVE+APK +K G++K+EA ++K  LE AG
Sbjct: 61  TVVLAAFGDKKIEVIKEVRAVTGLGLKEAKDLVEAAPKPVKEGVTKEEAEKIKAALEKAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|297582439|ref|YP_003698219.1| 50S ribosomal protein L7/L12 [Bacillus selenitireducens MLS10]
 gi|297140896|gb|ADH97653.1| ribosomal protein L7/L12 [Bacillus selenitireducens MLS10]
          Length = 121

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++  +  ++++E  +L K +E+E+GV+A+APV+     A     AA+E+TEF+VVL+ 
Sbjct: 4   QDMIAAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAGAGEEAAAEQTEFDVVLES 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLK+AK LV+  P  +K G+ K EA E+K KLE+AGA+VE
Sbjct: 62  --AGSSKIGVIKIVREITGLGLKDAKALVDGVPAPVKEGVEKAEAEEIKGKLEEAGASVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|145220409|ref|YP_001131118.1| 50S ribosomal protein L7/L12 [Prosthecochloris vibrioformis DSM
           265]
 gi|189043005|sp|A4SGK7|RL7_PROVI RecName: Full=50S ribosomal protein L7/L12
 gi|145206573|gb|ABP37616.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Chlorobium
           phaeovibrioides DSM 265]
          Length = 123

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 90/123 (73%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE++VE++  LTL +AA L K LE+++GVSA+  +      AA A +AA E+TEF+VVL 
Sbjct: 3   IETLVEEIGGLTLTDAAALVKALEEKFGVSAAPAMVAGVAAAAPAAAAAEEQTEFDVVLT 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRAIT LGLKEAK+LV+ APK++K  +SK++A ++ K+L+DAGA+V
Sbjct: 63  A--AGDSKINVIKVVRAITGLGLKEAKDLVDGAPKAVKEAVSKEDAEKIVKELKDAGASV 120

Query: 124 ELR 126
           EL+
Sbjct: 121 ELK 123


>gi|260655336|ref|ZP_05860824.1| ribosomal protein L7/L12 [Jonquetella anthropi E3_33 E1]
 gi|260629784|gb|EEX47978.1| ribosomal protein L7/L12 [Jonquetella anthropi E3_33 E1]
          Length = 125

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 83/121 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  + S+T++E +EL K +E+++GVSA+AP  ++A  AA   +A + + + E  +  
Sbjct: 4   EEILSAIESMTVLELSELVKAMEEKFGVSAAAPAMMMAAPAAAGAAAPAAEEKTEFNVIL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLK+AK+ V++  K+LK G+SK+EA  +KK++ + GATVE
Sbjct: 64  KDVGAEKIKVIKVVREITGLGLKDAKDFVDNPGKALKEGVSKEEAENIKKQMAEVGATVE 123

Query: 125 L 125
           L
Sbjct: 124 L 124


>gi|268678993|ref|YP_003303424.1| ribosomal protein L7/L12 [Sulfurospirillum deleyianum DSM 6946]
 gi|268617024|gb|ACZ11389.1| ribosomal protein L7/L12 [Sulfurospirillum deleyianum DSM 6946]
          Length = 124

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S L+++E ++L K  E+++GVSA+ PV V    A  A +A  EKTEF+V+LK 
Sbjct: 6   EDVLEYISGLSVLELSQLVKDFEEKFGVSAA-PVMVAGAGAGVAAAAVEEKTEFDVILK- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D  +KKI  IK VR IT LGLKEAK+ VE AP ++K G+SK+ A E+KKKLE+AGA  E
Sbjct: 64  -DGGEKKINAIKVVREITGLGLKEAKDAVEGAPTTIKEGVSKELAEEIKKKLEEAGAVAE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|163787870|ref|ZP_02182317.1| 50S ribosomal protein L7/L12 [Flavobacteriales bacterium ALC-1]
 gi|159877758|gb|EDP71815.1| 50S ribosomal protein L7/L12 [Flavobacteriales bacterium ALC-1]
          Length = 125

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 54/127 (42%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++   E+L +L++ +  EL+  L+ E+G+  +A    VA     AG  A  E+TEF+
Sbjct: 1   MADLKDFAEQLVNLSVKDVNELATILKDEYGIEPAAAAVAVAAGGGAAGGDAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLK+AK LV+ AP ++K G+SKDEA  +K  LE+A
Sbjct: 61  VILKA--AGGSKLAVVKLVKELTGLGLKDAKGLVDDAPSAIKEGVSKDEAEGLKSSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|464518|sp|Q06036|RK122_SECCE RecName: Full=50S ribosomal protein L12-2, chloroplastic; AltName:
           Full=CL12-2; Flags: Precursor
 gi|288584|emb|CAA48414.1| ribosomal protein L12 [Secale cereale]
          Length = 174

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 75/124 (60%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA-GSAASEKTEFEVV 61
            +  + + ++ LTL EA  L   L++   VSA++     A + A A   A  E+TEF+VV
Sbjct: 51  KVLELGDAIAGLTLEEARNLVDHLQERLCVSAASFPPAAAGLRAAAVEEAPVEQTEFDVV 110

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           ++       +IA IK VRA+T+L LKEAK+L+E  PK LK  +SKDEA E KK+LE  GA
Sbjct: 111 IEEV-PSSARIATIKIVRALTNLALKEAKDLIEGLPKKLKEAVSKDEAEEAKKQLEGVGA 169

Query: 122 TVEL 125
            V +
Sbjct: 170 KVSI 173


>gi|182678329|ref|YP_001832475.1| 50S ribosomal protein L7/L12 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|226733642|sp|B2IK54|RL7_BEII9 RecName: Full=50S ribosomal protein L7/L12
 gi|182634212|gb|ACB94986.1| ribosomal protein L7/L12 [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 126

 Score = 86.1 bits (212), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 69/126 (54%), Positives = 92/126 (73%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +AA  + + E 
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGGAAAAPVEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVR +T LGLKEAK+LVE+APK +K G+SK+EA ++K  LE AG
Sbjct: 61  TVVLAAVGDKKIEVIKEVRGVTGLGLKEAKDLVEAAPKPVKEGVSKEEAEKIKAALEKAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|297170815|gb|ADI21835.1| hypothetical protein [uncultured gamma proteobacterium
           HF0130_25M15]
          Length = 131

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 89/125 (71%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           ++ E ++E +S +++++  EL   +E+++GV+A+APV+V +  AA   + A+ + + E  
Sbjct: 7   ASKEDVLEAISQMSVMDLVELISEMEEKFGVTAAAPVAVASAPAAGDSAEAAGEEQTEFE 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +        KIAVIK VR+IT LGLK+AK+LVE APK LK  +SKDEA EMKK+LE+AGA
Sbjct: 67  IILAAAGDNKIAVIKAVRSITGLGLKDAKDLVEGAPKPLKDSVSKDEAEEMKKQLEEAGA 126

Query: 122 TVELR 126
           +VEL+
Sbjct: 127 SVELK 131


>gi|322434563|ref|YP_004216775.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX9]
 gi|321162290|gb|ADW67995.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX9]
          Length = 123

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I+ + + + SL+L+EA+ L K+LE+  GVSA+A  +  A     A +   EKTEF V
Sbjct: 1   MADIQQLEDSIVSLSLLEASALVKKLEERLGVSAAAAAAAPAAGGGAAAAVVEEKTEFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  D    KI+ IK VR +T LGLKEAK+LV+ APK LK G+SKD+A  + KK E   
Sbjct: 61  ILK--DAGANKISTIKTVREVTGLGLKEAKDLVDGAPKPLKEGVSKDDAAAIAKKFEGI- 117

Query: 121 ATVELR 126
           ATVE++
Sbjct: 118 ATVEIK 123


>gi|323141138|ref|ZP_08076041.1| ribosomal protein L7/L12 [Phascolarctobacterium sp. YIT 12067]
 gi|322414404|gb|EFY05220.1| ribosomal protein L7/L12 [Phascolarctobacterium sp. YIT 12067]
          Length = 123

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 66/124 (53%), Positives = 92/124 (74%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N + I+E + S+T++E +EL K LE+++GVSA+APV+V A  AA   +AA+EKTEF+V+L
Sbjct: 2   NKDQIIEAIESMTVLELSELVKALEEKFGVSAAAPVAVAAAPAAGGEAAAAEKTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR  T LGLKEAKELV+ APK++K  +SK +A+ +K+KLE AGAT
Sbjct: 62  TS--AGASKIGVIKAVREATGLGLKEAKELVDGAPKAIKEKISKADADALKEKLEAAGAT 119

Query: 123 VELR 126
           VE++
Sbjct: 120 VEVK 123


>gi|134298084|ref|YP_001111580.1| 50S ribosomal protein L7/L12 [Desulfotomaculum reducens MI-1]
 gi|172044213|sp|A4J102|RL7_DESRM RecName: Full=50S ribosomal protein L7/L12
 gi|134050784|gb|ABO48755.1| LSU ribosomal protein L12P [Desulfotomaculum reducens MI-1]
          Length = 124

 Score = 86.1 bits (212), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS +  ++E +  LT++E AEL K  E+E+GVSA+APV+V A  AA A +A  EKTEF+V
Sbjct: 1   MSKVAEVLEIVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAPAAGAAAAEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKI VIK VR IT LGLKEAKELV+ APK +K  ++K+EA  +K KL +AG
Sbjct: 61  ILTS--AGDKKINVIKVVREITGLGLKEAKELVDGAPKPVKEKIAKEEAESIKAKLTEAG 118

Query: 121 ATVELR 126
           ATV+++
Sbjct: 119 ATVDVK 124


>gi|325115529|emb|CBZ51084.1| unnamed protein product [Neospora caninum Liverpool]
          Length = 265

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 51/129 (39%), Positives = 79/129 (61%), Gaps = 9/129 (6%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-------PVAAEAGSAASEKTE 57
           ++++E++  LTL+EAAEL   +E  +GVSA   V+            A E   A  EKT+
Sbjct: 137 QAVLEEIKKLTLVEAAELVSLIEATFGVSARLAVAGPGAGAAPSDAEAEEKKEAPPEKTQ 196

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F+VV+K      K+IAVIK +R + TDLGLKEAK ++++ P ++   + K +A E++K L
Sbjct: 197 FDVVIKAV-PLDKRIAVIKTLRTVRTDLGLKEAKAVIDALPNTILKQVDKVKAEEVRKTL 255

Query: 117 EDAGATVEL 125
            DAGA + +
Sbjct: 256 ADAGAEIAI 264


>gi|308272987|emb|CBX29591.1| 50S ribosomal protein L7/L12 [uncultured Desulfobacterium sp.]
          Length = 127

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 92/129 (71%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA-GSAASEKTE 57
           MS+I  E ++E ++++++++ +EL K LE ++GVSA+APV++VA     A  S   E+TE
Sbjct: 1   MSDITKEDVIEFIATMSVLDLSELVKELEDKFGVSAAAPVAMVAAAGPAAAESQPEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+L       KKI +IKEVRAIT LGLKEAK LV+  PK +K  +SK+EA ++K +LE
Sbjct: 61  FSVIL--LSHGDKKIQIIKEVRAITGLGLKEAKTLVDEIPKPVKEAISKEEAEKIKAQLE 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAQVEIK 127


>gi|83591285|ref|YP_431294.1| 50S ribosomal protein L12P [Moorella thermoacetica ATCC 39073]
 gi|109893773|sp|Q2RFN8|RL7_MOOTA RecName: Full=50S ribosomal protein L7/L12
 gi|83574199|gb|ABC20751.1| LSU ribosomal protein L12P [Moorella thermoacetica ATCC 39073]
          Length = 126

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 85/126 (67%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS ++ I+E +  LT++E +EL K LE E+GVSA+APV++     A A + A  + + E 
Sbjct: 1   MSKVQEIIEAVKGLTVLELSELVKALEDEFGVSAAAPVAMAVAPGAAAPAEAPAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +   KKI VIK VR IT LGLKEAK LV+ APK +K  +SK+EA  +K KLE+AG
Sbjct: 61  DVILKEAGDKKINVIKVVREITALGLKEAKALVDEAPKPVKEKVSKEEAESIKAKLEEAG 120

Query: 121 ATVELR 126
           ATVE++
Sbjct: 121 ATVEIK 126


>gi|42518511|ref|NP_964441.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii NCC 533]
 gi|116629033|ref|YP_814205.1| 50S ribosomal protein L7/L12 [Lactobacillus gasseri ATCC 33323]
 gi|227888777|ref|ZP_04006582.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii ATCC 33200]
 gi|238853600|ref|ZP_04643969.1| ribosomal protein L7/L12 [Lactobacillus gasseri 202-4]
 gi|268318931|ref|YP_003292587.1| ribosomal protein L7/L12 [Lactobacillus johnsonii FI9785]
 gi|282852738|ref|ZP_06262080.1| ribosomal protein L7/L12 [Lactobacillus gasseri 224-1]
 gi|300362317|ref|ZP_07058493.1| ribosomal protein L7/L12 [Lactobacillus gasseri JV-V03]
 gi|311111172|ref|ZP_07712569.1| ribosomal protein L7/L12 [Lactobacillus gasseri MV-22]
 gi|81668238|sp|Q74L08|RL7_LACJO RecName: Full=50S ribosomal protein L7/L12
 gi|122273969|sp|Q045V5|RL7_LACGA RecName: Full=50S ribosomal protein L7/L12
 gi|41582796|gb|AAS08407.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii NCC 533]
 gi|116094615|gb|ABJ59767.1| LSU ribosomal protein L12P [Lactobacillus gasseri ATCC 33323]
 gi|227850614|gb|EEJ60700.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii ATCC 33200]
 gi|238833744|gb|EEQ26012.1| ribosomal protein L7/L12 [Lactobacillus gasseri 202-4]
 gi|262397306|emb|CAX66320.1| ribosomal protein L7/L12 [Lactobacillus johnsonii FI9785]
 gi|282556480|gb|EFB62100.1| ribosomal protein L7/L12 [Lactobacillus gasseri 224-1]
 gi|300353308|gb|EFJ69180.1| ribosomal protein L7/L12 [Lactobacillus gasseri JV-V03]
 gi|311066326|gb|EFQ46666.1| ribosomal protein L7/L12 [Lactobacillus gasseri MV-22]
 gi|329666781|gb|AEB92729.1| 50S ribosomal protein L7/L12 [Lactobacillus johnsonii DPC 6026]
          Length = 120

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E L   +++E  +L K +E E+GVSA+APV      AA A  A +EKTEF+V L
Sbjct: 4   DTEKIIEDLKGASILELNDLVKAIEDEFGVSAAAPV-----AAAGAAGAGAEKTEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--DVGQEKVKVIKVVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V ++
Sbjct: 117 VTVK 120


>gi|297170770|gb|ADI21792.1| hypothetical protein [uncultured gamma proteobacterium
           HF0130_22O14]
          Length = 131

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 89/125 (71%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           ++ E ++E +S +++++  EL   +E+++GV+A+APV+V A  AA   + A+ + + E  
Sbjct: 7   ASKEDVLEAISQMSVMDLVELISEMEEKFGVTAAAPVAVAAAPAAGDSAEAAGEEQTEFE 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +        KIAVIK VR+IT LGLK+AK+LVE APK LK  +SKDEA EMKK+LE+AGA
Sbjct: 67  IVLAAAGDNKIAVIKAVRSITGLGLKDAKDLVEGAPKPLKDSVSKDEAEEMKKQLEEAGA 126

Query: 122 TVELR 126
           +VEL+
Sbjct: 127 SVELK 131


>gi|167039511|ref|YP_001662496.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X514]
 gi|256752778|ref|ZP_05493623.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300915238|ref|ZP_07132553.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X561]
 gi|307725162|ref|YP_003904913.1| 50S ribosomal protein L7/L12 [Thermoanaerobacter sp. X513]
 gi|226734487|sp|B0K5G7|RL7_THEPX RecName: Full=50S ribosomal protein L7/L12
 gi|166853751|gb|ABY92160.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X514]
 gi|256748339|gb|EEU61398.1| ribosomal protein L7/L12 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300888962|gb|EFK84109.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X561]
 gi|307582223|gb|ADN55622.1| ribosomal protein L7/L12 [Thermoanaerobacter sp. X513]
          Length = 125

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 88/122 (72%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E AEL K LE+E+GVSA+APV+V A  AA A +AA  + + E  +  
Sbjct: 4   EEILEAIKNMTVLELAELVKALEEEFGVSAAAPVAVAAAPAAGAPAAAPAEEKTEFDVIL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR +T LGLKEAK+LVESAPK +K G+SKDEAN++K K E+ GA VE
Sbjct: 64  QEVGSDKIKVIKVVREVTGLGLKEAKDLVESAPKPVKEGVSKDEANQIKAKFEEVGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|34556891|ref|NP_906706.1| 50S ribosomal protein L7/L12 [Wolinella succinogenes DSM 1740]
 gi|81653584|sp|Q7MA57|RL7_WOLSU RecName: Full=50S ribosomal protein L7/L12
 gi|34482606|emb|CAE09606.1| PUTATIVE 50S RIBOSOMAL SUBUNIT PROTEIN L7/L12 [Wolinella
           succinogenes]
          Length = 124

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  L+++E +EL K  E+++GVSA+ P  V    A  A +A  EKTEF+V+L  
Sbjct: 6   EELLDYIGGLSVLELSELVKAFEEKFGVSAA-PTVVAGAGAGVAAAAVEEKTEFDVIL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D  +KKI VIK VR +T LGLKEAK+ VE  P ++K G +KD+A  MK KLE+AGA VE
Sbjct: 63  LDGGEKKINVIKVVRELTGLGLKEAKDAVEKTPTTIKEGANKDDAAAMKAKLEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|108773254|ref|YP_635778.1| ribosomal protein L12 [Chara vulgaris]
 gi|77157910|gb|ABA61951.1| ribosomal protein L12 [Chara vulgaris]
          Length = 139

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 76/129 (58%), Gaps = 6/129 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE-----AGSAASEKTE 57
           ++  ++  + SLTL E    + +L+ E G+S+    S    +              EKTE
Sbjct: 12  DLNQLLNAIKSLTLQEIKIFTDKLQDELGISSDNLYSSRGILTESTSHNKEVEEIDEKTE 71

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+++L+       +I VIK +R+IT+ GLKEAKE +E+ PK++K G+SK+EA  +K +LE
Sbjct: 72  FDIILEEV-PSSSRITVIKVIRSITNSGLKEAKEFIEALPKTVKEGISKEEAESVKAQLE 130

Query: 118 DAGATVELR 126
           ++GA V LR
Sbjct: 131 ESGAKVTLR 139


>gi|299830334|ref|YP_003734549.1| ribosomal protein L12 [Kryptoperidinium foliaceum]
 gi|297385036|gb|ADI40334.1| ribosomal protein L12 [Kryptoperidinium foliaceum]
          Length = 128

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 82/126 (65%), Gaps = 3/126 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGV--SASAPVSVVAPVAAEAGSAASEKTEFEV 60
            I  IVE+L +LTL+EA+EL   +E+ +GV  SA+A   V+   AA       EKTEF++
Sbjct: 4   KINQIVEELKTLTLLEASELVSAIEETFGVDASAAAGGPVMMAAAAGPAEEVEEKTEFDL 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L       KKIAV+K VR IT LGLKEAKELVESAPK ++ G++KD   + KK++E+AG
Sbjct: 64  SLDEV-PADKKIAVLKVVRGITGLGLKEAKELVESAPKVIQEGVAKDAGEDAKKQIEEAG 122

Query: 121 ATVELR 126
               L+
Sbjct: 123 GKASLK 128


>gi|91089255|ref|XP_969352.1| PREDICTED: similar to 60S ribosomal protein L7/L12 [Tribolium
           castaneum]
 gi|270011463|gb|EFA07911.1| hypothetical protein TcasGA2_TC005486 [Tribolium castaneum]
          Length = 180

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-----SVVAPVAAEAGSAASEKTE 57
            IE +V ++S L L+E +ELS  L+    +  +  +     +  AP   E  +    K+ 
Sbjct: 52  KIEKLVTEISQLNLLEVSELSGALKTRLNLPDAPVMPVGGFAAPAPAEEEDEAPKQVKSV 111

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V L  F D K+K+A+IKE++ +   + L +AK+ VE AP  +K  +SK+EA ++K  +
Sbjct: 112 FNVKLMKF-DEKQKVALIKEIKGLMEGMNLVQAKKFVEGAPALVKGDVSKEEAEKLKAAI 170

Query: 117 EDAGATVEL 125
           E  G  VE+
Sbjct: 171 EKVGGVVEI 179


>gi|328543348|ref|YP_004303457.1| 50S ribosomal protein L7/L12 [Polymorphum gilvum SL003B-26A1]
 gi|326413093|gb|ADZ70156.1| 50S ribosomal protein L7/L12 [Polymorphum gilvum SL003B-26A1]
          Length = 126

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 73/126 (57%), Positives = 97/126 (76%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  A    +A +E+ + E 
Sbjct: 1   MADLAKLVDELSALTVMEAAELSKLLEEKWGVSAAAPVAVAAVAAGGGAAAPAEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D   KKI VIKEVRAIT LGLKEAKELVE APK++K  +SK EA E+KKKLE+AG
Sbjct: 61  DVVLADAGDKKINVIKEVRAITGLGLKEAKELVEGAPKTVKEQVSKAEAEELKKKLEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|317968190|ref|ZP_07969580.1| 50S ribosomal protein L7/L12 [Synechococcus sp. CB0205]
          Length = 128

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 86/127 (67%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFE 59
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+A   VV    A  G+A +   KTEF+
Sbjct: 3   ATTDQILEQLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAAPAAGGAAEAAEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V L+GFD    KI V+K VR  T LGL EAK LVE AP ++K G++K +A  MKK +E+A
Sbjct: 63  VHLEGFDAAA-KIKVLKAVREATGLGLGEAKALVEGAPCNVKEGVAKADAEAMKKAIEEA 121

Query: 120 GATVELR 126
           G  V L+
Sbjct: 122 GGKVSLK 128


>gi|87198056|ref|YP_495313.1| 50S ribosomal protein L7/L12 [Novosphingobium aromaticivorans DSM
           12444]
 gi|109893777|sp|Q2GCD1|RL7_NOVAD RecName: Full=50S ribosomal protein L7/L12
 gi|87133737|gb|ABD24479.1| LSU ribosomal protein L12P [Novosphingobium aromaticivorans DSM
           12444]
          Length = 123

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 98/126 (77%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I  +VE+LS LT++EAA+L+K LE+ WGVSA+A V  VA   A A  AA EKTEF+V
Sbjct: 1   MADIAKLVEELSKLTVLEAADLAKALEEAWGVSAAAAV-AVAAAPAAAAEAAEEKTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L G  D  KKI VIKEVRAIT+LGL EAK LVE APK++K G+SK EA ++KKK+E+AG
Sbjct: 60  ILTG--DGGKKIQVIKEVRAITNLGLTEAKALVEGAPKAIKEGVSKAEAEDIKKKIEEAG 117

Query: 121 ATVELR 126
            TVE++
Sbjct: 118 GTVEVK 123


>gi|283851495|ref|ZP_06368775.1| ribosomal protein L7/L12 [Desulfovibrio sp. FW1012B]
 gi|283573029|gb|EFC21009.1| ribosomal protein L7/L12 [Desulfovibrio sp. FW1012B]
          Length = 128

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 81/122 (66%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +V+ ++++T++E ++  K LE+++GVSA+AP   +   A  A +A +E+ + E  +  
Sbjct: 7   EQVVDFIANMTVLELSQFIKELEEKFGVSAAAPAMGMMMAAPAADAAPAEEEKTEFDVIL 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KIAVIK VRA+T LGLKEAK  V+  P ++K  +SK EA + KK+L+++GAT E
Sbjct: 67  TGAGGNKIAVIKVVRALTGLGLKEAKAKVDELPSTIKEAVSKAEAEDAKKQLDESGATCE 126

Query: 125 LR 126
           ++
Sbjct: 127 IK 128


>gi|260893759|ref|YP_003239856.1| ribosomal protein L7/L12 [Ammonifex degensii KC4]
 gi|260865900|gb|ACX53006.1| ribosomal protein L7/L12 [Ammonifex degensii KC4]
          Length = 128

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 70/130 (53%), Positives = 94/130 (72%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKT 56
           MS +  I+E +  LT++E A+L K LE+E+GV+A+APV+V A  AA A + A     EKT
Sbjct: 1   MSKVAEIIEAIKGLTVVELADLVKALEEEFGVTAAAPVAVAAAPAAGAAAPAAAPAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L       KKI VIK VR IT LGLKEAK+LV++APK +K  +SK+EA  +KKKL
Sbjct: 61  EFDVILTS--AGDKKINVIKVVREITGLGLKEAKDLVDNAPKPVKEKVSKEEAEAIKKKL 118

Query: 117 EDAGATVELR 126
           E+AGATVE++
Sbjct: 119 EEAGATVEIK 128


>gi|297737999|emb|CBI27200.3| unnamed protein product [Vitis vinifera]
          Length = 216

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 51/131 (38%), Positives = 77/131 (58%), Gaps = 14/131 (10%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA-------------AEA 48
           + +  +V++++ LTL+E AELS  L K+ G+     V+++ P A             A  
Sbjct: 69  ARVFRLVDEIAGLTLVEVAELSSILRKKLGMKEPPVVAIMKPGAVAAVSGGGMKAASAAK 128

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
                EKT FE+ L+ ++    KI +IKEVR+ TDLGLKEAK+LVE AP  LK G+SK+E
Sbjct: 129 EEKKPEKTVFELKLESYEA-ASKIKIIKEVRSFTDLGLKEAKDLVEKAPSVLKAGVSKEE 187

Query: 109 ANEMKKKLEDA 119
             ++ +KL+  
Sbjct: 188 GEQLVEKLKAL 198


>gi|254798662|ref|YP_003058321.1| ribosomal protein L12 [Parachlorella kessleri]
 gi|229915610|gb|ACQ90953.1| ribosomal protein L12 [Parachlorella kessleri]
          Length = 131

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 83/126 (65%), Gaps = 6/126 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----VVAPVAAEAGSAASEKTEFE 59
             I+EKL S+TL+EAAEL  ++E+ +GV ASAPV+          AA    A  EKT F+
Sbjct: 6   NEIIEKLKSITLLEAAELVSQIEETFGVDASAPVAGGFLAAPMESAASQKEAVEEKTTFD 65

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           ++L+      K+I V+K +R +T L LKEAKE + S PK++K G+SK+EA   K++LE+A
Sbjct: 66  IILEDV-PSDKRIPVLKVIRNLTSLDLKEAKESITSLPKAIKQGISKEEAETAKQQLEEA 124

Query: 120 GATVEL 125
           GA V++
Sbjct: 125 GAKVKI 130


>gi|229917368|ref|YP_002886014.1| ribosomal protein L7/L12 [Exiguobacterium sp. AT1b]
 gi|229468797|gb|ACQ70569.1| ribosomal protein L7/L12 [Exiguobacterium sp. AT1b]
          Length = 122

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L S+T++E  EL K +E+E+     +  + VA   A AG+AA EKTEF+V+L
Sbjct: 4   NKEQFIEDLKSMTVLELNELVKTIEEEF---GVSAAAPVAVAGAGAGAAAEEKTEFDVIL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR IT LGLKEAK LV+  P  +K G+SK++A+ +K KLE+AGA+
Sbjct: 61  T--NAGAGKINVIKAVREITGLGLKEAKALVDGTPAPVKEGVSKEDADAIKAKLEEAGAS 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|14860969|gb|AAK72378.1| 60S ribosomal protein L7/L12 precursor [Spodoptera frugiperda]
          Length = 179

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-------SVVAPVAAEAGSAASEK 55
            IE IV ++++L L+E +ELS+ L+K   +  +  +       +  A    E  +  + K
Sbjct: 49  KIEKIVSEITNLNLLEVSELSQVLKKRLNLPDAPVMPMGGFVAAAPAAQDEEEAAPKAVK 108

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V L  FDD K+K+A+IKE++ +     L +AK+ VES P  +K  +SKDEA ++K+
Sbjct: 109 TNFTVKLTKFDD-KQKVALIKEIKGLLEGYNLVQAKKFVESVPAVVKADVSKDEAEKLKE 167

Query: 115 KLEDAGATVEL 125
            L   G  +E+
Sbjct: 168 ALSKVGGVIEI 178


>gi|296120713|ref|YP_003628491.1| ribosomal protein L7/L12 [Planctomyces limnophilus DSM 3776]
 gi|296013053|gb|ADG66292.1| ribosomal protein L7/L12 [Planctomyces limnophilus DSM 3776]
          Length = 130

 Score = 85.7 bits (211), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 59/132 (44%), Positives = 89/132 (67%), Gaps = 8/132 (6%)

Query: 1   MSNIE----SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--SE 54
           M++ +     + +K+ +LTL++A  L+  LE+  G+  +    V+AP    A  AA   E
Sbjct: 1   MADFDSATTELGDKIVALTLLQAKALADYLEQVHGIKPAGGAVVMAPGGGGAAPAAPVEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L GF     K++VIK VR  T LGLKEAK+LVE APK +KTG+SK++A+++KK
Sbjct: 61  KTEFDVILTGF--GDNKLSVIKVVRTATGLGLKEAKDLVEGAPKPVKTGISKEDADKLKK 118

Query: 115 KLEDAGATVELR 126
           +LE +GAT E++
Sbjct: 119 ELEASGATAEIK 130


>gi|319654858|ref|ZP_08008933.1| 50S ribosomal protein L7/L12 [Bacillus sp. 2_A_57_CT2]
 gi|317393421|gb|EFV74184.1| 50S ribosomal protein L7/L12 [Bacillus sp. 2_A_57_CT2]
          Length = 121

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 91/122 (74%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  +L K +E+E+GV+A+APV+V+    A  G AA+EKTEF+VVL  
Sbjct: 4   EQIIEAVKNMTVLELNDLVKAIEEEFGVTAAAPVAVM--GGAAGGDAAAEKTEFDVVLAS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR IT LGLKEAKELV++ PK+LK G+SK+EA E+K KLE+ GA VE
Sbjct: 62  --AGDQKIKVIKVVREITGLGLKEAKELVDNTPKALKEGVSKEEAEEVKAKLEEVGAGVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|224418579|ref|ZP_03656585.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|253826870|ref|ZP_04869755.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|313142107|ref|ZP_07804300.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|253510276|gb|EES88935.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
 gi|313131138|gb|EFR48755.1| 50S ribosomal protein L7/L12 [Helicobacter canadensis MIT 98-5491]
          Length = 124

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + +L+++E +EL K  E+++GVSA+ P  V   VA  AG+AA EKTEF+V+L  
Sbjct: 6   EDVLEYIGNLSVMELSELVKAFEEKFGVSAA-PTVVAGAVAGGAGAAAEEKTEFDVILA- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR +T LGLKEAK+ VE  P ++K G+ K++A  MK K E+AGA VE
Sbjct: 64  -DSGDKKINVIKVVREVTGLGLKEAKDAVEKTPFTVKEGVKKEDAEAMKAKFEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|147676644|ref|YP_001210859.1| 50S ribosomal protein L7/L12 [Pelotomaculum thermopropionicum SI]
 gi|189043003|sp|A5D5H9|RL7_PELTS RecName: Full=50S ribosomal protein L7/L12
 gi|146272741|dbj|BAF58490.1| ribosomal protein L7/L12 [Pelotomaculum thermopropionicum SI]
          Length = 129

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 65/131 (49%), Positives = 89/131 (67%), Gaps = 7/131 (5%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-----ASEK 55
           MS ++ I+E +  LT++E +EL K  E+E+GVSA+APV+V A   A A  A       E+
Sbjct: 1   MSKVQEILEAVKGLTVLELSELVKAFEEEFGVSAAAPVAVAAAPGAAAAPAAPAAAEEEQ 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+V+L       KK+ VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +K K
Sbjct: 61  TEFDVILTAV--GDKKVNVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKEEAAAIKAK 118

Query: 116 LEDAGATVELR 126
           L +AGATVE++
Sbjct: 119 LTEAGATVEVK 129


>gi|157738104|ref|YP_001490788.1| 50S ribosomal protein L7/L12 [Arcobacter butzleri RM4018]
 gi|315636456|ref|ZP_07891698.1| ribosomal protein L7/L12 [Arcobacter butzleri JV22]
 gi|166990981|sp|A8EVZ5|RL7_ARCB4 RecName: Full=50S ribosomal protein L7/L12
 gi|157699958|gb|ABV68118.1| 50S ribosomal protein L7/L12 [Arcobacter butzleri RM4018]
 gi|315479237|gb|EFU69928.1| ribosomal protein L7/L12 [Arcobacter butzleri JV22]
          Length = 123

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 78/122 (63%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S L+++E +EL K  E+++GVSA          A  A  A  EKTEF+V++  
Sbjct: 6   EDVLEFISGLSVLELSELVKEFEEKFGVSAQPVAVAG--GAVAAVEAVEEKTEFDVII-- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIKE+RAIT LGLKEAK+  E  P ++K G+SK +A   K +LE AGA VE
Sbjct: 62  VDSGDKKINVIKEIRAITGLGLKEAKDAAEQTPSTIKEGISKADAEAFKAQLEAAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|326429321|gb|EGD74891.1| 50S ribosomal protein L7/L12 [Salpingoeca sp. ATCC 50818]
          Length = 189

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 58/127 (45%), Positives = 80/127 (62%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFE 59
            IE++V ++SS+TL+E A+L   L+    +S     +V    A  A +AA     KTEFE
Sbjct: 63  KIENLVSEISSMTLLEVADLVDALKTRLNISDMPVAAVGVAAAPAAEAAAEPVEEKTEFE 122

Query: 60  VVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           V L  F+D   KI VIKEVR I  DL L EAK+LVE  P++LK  +SK++A  +KK LE+
Sbjct: 123 VKLVKFEDKA-KIKVIKEVRNILPDLKLAEAKKLVEDLPQTLKQDVSKEDAEAIKKALEE 181

Query: 119 AGATVEL 125
            GA+VE+
Sbjct: 182 IGASVEI 188


>gi|71083811|ref|YP_266531.1| 50S ribosomal protein L31 [Candidatus Pelagibacter ubique HTCC1062]
 gi|91763153|ref|ZP_01265117.1| probable 50S ribosomal protein L31 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|109893780|sp|Q4FLL1|RL7_PELUB RecName: Full=50S ribosomal protein L7/L12
 gi|71062924|gb|AAZ21927.1| probable 50S ribosomal protein L31 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|91717566|gb|EAS84217.1| probable 50S ribosomal protein L31 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 121

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 65/126 (51%), Positives = 87/126 (69%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M ++  I+E LSSLT++EAAELSK+LE++WGV+A A         A A   A+E+ + + 
Sbjct: 1   MPDLNKIIEDLSSLTVVEAAELSKQLEEKWGVTAMAAA-----APAAAAGGAAEEAKDDF 55

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRA T LGLKEAK+LVE APK +K+G++K +A E+K KLE AG
Sbjct: 56  TIMLISAGDKKINVIKEVRAATSLGLKEAKDLVEGAPKEVKSGVNKKDAEEIKAKLEAAG 115

Query: 121 ATVELR 126
           A VEL+
Sbjct: 116 AKVELK 121


>gi|295658575|ref|XP_002789848.1| 50S ribosomal protein L12 [Paracoccidioides brasiliensis Pb01]
 gi|226282992|gb|EEH38558.1| 50S ribosomal protein L12 [Paracoccidioides brasiliensis Pb01]
          Length = 198

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 45/139 (32%), Positives = 71/139 (51%), Gaps = 17/139 (12%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------------VVAPVAA 46
            I  IV+++S LTL+E A+L   L+    +      S                  A    
Sbjct: 60  KITQIVDQISQLTLLETADLVSTLKSRLNIPDLPIGSFAAGPAAGTAAGGAAPAAAVEEE 119

Query: 47  EAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSK 106
           +A  AA EKT F + L+ F D   K  VIKE++++  L L ++K+ VESAPK +K  + K
Sbjct: 120 DAAPAAQEKTLFNLKLESF-DAASKPKVIKEIKSLLSLSLVDSKKFVESAPKVMKESVPK 178

Query: 107 DEANEMKKKLEDAGATVEL 125
           ++A ++ K ++D GA V +
Sbjct: 179 EQAEKIVKTMKDLGAKVVM 197


>gi|163813885|ref|ZP_02205279.1| hypothetical protein COPEUT_00038 [Coprococcus eutactus ATCC 27759]
 gi|158450755|gb|EDP27750.1| hypothetical protein COPEUT_00038 [Coprococcus eutactus ATCC 27759]
          Length = 144

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 72/122 (59%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  L+++E  +L K  E+E+   ++A   VVA   A+  +AA EK  F V L  
Sbjct: 26  QEIIEVIKGLSVLELNDLVKACEEEF-GVSAAAGVVVAAAGADGAAAAEEKDSFNVELTE 84

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR +T LGLKEAK+ V+ APK +K   +K+EA E K KLE  GA V 
Sbjct: 85  V--GPNKVKVIKVVRELTGLGLKEAKDAVDGAPKVIKEDATKEEAEEAKTKLEAEGAKVT 142

Query: 125 LR 126
           L+
Sbjct: 143 LK 144


>gi|300114744|ref|YP_003761319.1| 50S ribosomal protein L7/l12 [Nitrosococcus watsonii C-113]
 gi|300114756|ref|YP_003761331.1| 50S ribosomal protein L7/l12 [Nitrosococcus watsonii C-113]
 gi|299540681|gb|ADJ28998.1| ribosomal protein L7/L12 [Nitrosococcus watsonii C-113]
 gi|299540693|gb|ADJ29010.1| ribosomal protein L7/L12 [Nitrosococcus watsonii C-113]
          Length = 126

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 93/123 (75%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E I+E +S++T+++  EL + +E+++GVSA+APV+  AP A     AA+ EKTEF+V+L 
Sbjct: 6   EEILETISNMTVMDVVELIEAMEEKFGVSAAAPVAAAAPAAGAEAGAAAEEKTEFDVILA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+ VIK VR+IT LGLKEAKELVE AP  +K G+ KDEA+E+KK+LE+AGA++
Sbjct: 66  SF--GSNKVQVIKAVRSITSLGLKEAKELVEGAPSPIKEGVPKDEADEIKKQLEEAGASI 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|15604015|ref|NP_220530.1| 50S ribosomal protein L7/L12 [Rickettsia prowazekii str. Madrid E]
 gi|6226011|sp|Q9ZE21|RL7_RICPR RecName: Full=50S ribosomal protein L7/L12
 gi|3860706|emb|CAA14607.1| 50S RIBOSOMAL PROTEIN L7/L12 (rplL) [Rickettsia prowazekii]
 gi|292571733|gb|ADE29648.1| 50S ribosomal protein L7/L12 [Rickettsia prowazekii Rp22]
          Length = 125

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M+++  I E+LSSLTL++AAEL K LE++WGVSA+AP++V  A VAA    A +EKTEFE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWGVSAAAPITVASAGVAAPLAEAVTEKTEFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KK+ VIK V+ IT LGL EAK+LV+ APKS+K  + K EA E+K KLE A
Sbjct: 61  VVLTAT--GDKKVEVIKIVKDITGLGLIEAKKLVDEAPKSIKNNVKKAEAEEIKSKLEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|75675541|ref|YP_317962.1| 50S ribosomal protein L7/L12 [Nitrobacter winogradskyi Nb-255]
 gi|109893776|sp|Q3SSY1|RL7_NITWN RecName: Full=50S ribosomal protein L7/L12
 gi|74420411|gb|ABA04610.1| LSU ribosomal protein L12P [Nitrobacter winogradskyi Nb-255]
          Length = 125

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 74/127 (58%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V A   A  G+ A  EKTEF 
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGGAPAAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLAA--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKIKAQLEKA 118

Query: 120 GATVELR 126
           G  VEL+
Sbjct: 119 GGKVELK 125


>gi|156095354|ref|XP_001613712.1| 50S ribosomal subunit protein L12 [Plasmodium vivax SaI-1]
 gi|148802586|gb|EDL43985.1| 50S ribosomal subunit protein L12, putative [Plasmodium vivax]
          Length = 246

 Score = 85.3 bits (210), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 39/132 (29%), Positives = 69/132 (52%), Gaps = 9/132 (6%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE------ 57
           +  I+E L  LTL+EA+EL K++E  + V     +   +       +AA    E      
Sbjct: 115 VNKIIESLKELTLLEASELVKQIEATFSVDTRQSIGASSTDQDSRKNAADANAEEEEDDE 174

Query: 58  ---FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
              +++VL+  +  KK   +        DL LK+AK+LV++ P++L   ++K+ A++ K 
Sbjct: 175 NKVYDLVLENIEPNKKIPIIKIVKEIKKDLNLKQAKDLVDNLPQTLFEKINKETADKWKT 234

Query: 115 KLEDAGATVELR 126
           KL +AG  V+L+
Sbjct: 235 KLTEAGGIVKLK 246


>gi|315320477|ref|YP_004072533.1| 50S ribosomal protein L7/L12 [Thalassiosira oceanica CCMP1005]
 gi|283568950|gb|ADB27487.1| 50S ribosomal protein L7/L12 [Thalassiosira oceanica CCMP1005]
          Length = 128

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 66/125 (52%), Positives = 81/125 (64%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFEV 60
            I  IVE+L +LTL+EA+EL   +E+ +GV ASA V   VV   A  A   A EKTEF V
Sbjct: 4   KINQIVEELKTLTLLEASELVTAIEETFGVDASASVGGGVVMAAAPAAAEEAEEKTEFNV 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKIAV+K VR +T LGLKEAKELVESAPK ++  L KD A + KK++E AG
Sbjct: 64  MLDEV-PADKKIAVLKVVRTLTGLGLKEAKELVESAPKMVQEALGKDAAEDAKKQIEAAG 122

Query: 121 ATVEL 125
             V L
Sbjct: 123 GKVSL 127


>gi|254495702|ref|ZP_05108619.1| 50S ribosomal protein L7/L12 [Legionella drancourtii LLAP12]
 gi|254355081|gb|EET13699.1| 50S ribosomal protein L7/L12 [Legionella drancourtii LLAP12]
          Length = 124

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
             I+E +S+++++E  EL + +E+++ VSA+A    V    A A +A  E+TEF V++  
Sbjct: 6   NEILETISNMSVMEVVELIEAMEEKFNVSAAAAAVAVV-APAAAAAAVEEQTEFNVIMTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK VR +T LGLKEAK+LVE AP ++K G+SKDEA  +KK+LE+AGA+VE
Sbjct: 65  F--GANKVNVIKAVRGLTGLGLKEAKDLVEGAPSTIKEGVSKDEAASVKKELEEAGASVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|239907753|ref|YP_002954494.1| 50S ribosomal protein L7/L12 [Desulfovibrio magneticus RS-1]
 gi|259491644|sp|C4XIP0|RL7_DESMR RecName: Full=50S ribosomal protein L7/L12
 gi|239797619|dbj|BAH76608.1| 50S ribosomal protein L7/L12 [Desulfovibrio magneticus RS-1]
          Length = 129

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 57/125 (45%), Positives = 85/125 (68%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E +V+ ++++T++E ++  K LE+++GVSA+AP   +   A  AG AA     KTEF+V+
Sbjct: 7   EQVVDFIANMTVLELSQFIKELEEKFGVSAAAPAMGMMMAAPAAGEAAPAEEEKTEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   +    KIAVIK VRA+T LGLKEAK  V+  P S+K  +SK EA + KK+LE++GA
Sbjct: 67  LT--NAGGNKIAVIKVVRALTGLGLKEAKAKVDELPSSIKEAVSKAEAEDAKKQLEESGA 124

Query: 122 TVELR 126
           T E++
Sbjct: 125 TCEIK 129


>gi|190891346|ref|YP_001977888.1| 50S ribosomal protein L7/L12 [Rhizobium etli CIAT 652]
 gi|226733726|sp|B3PW58|RL7_RHIE6 RecName: Full=50S ribosomal protein L7/L12
 gi|190696625|gb|ACE90710.1| 50S ribosomal protein L7/L12 [Rhizobium etli CIAT 652]
 gi|327194524|gb|EGE61382.1| 50S ribosomal protein L7/L12 [Rhizobium etli CNPAF512]
          Length = 127

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 77/129 (59%), Positives = 98/129 (75%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A      G+A     EKTE
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAVAGGAGGAAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLE
Sbjct: 61  FDVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLE 118

Query: 118 DAGATVELR 126
           DAGA  +++
Sbjct: 119 DAGAKADVK 127


>gi|86357296|ref|YP_469188.1| 50S ribosomal protein L7/L12 [Rhizobium etli CFN 42]
 gi|109893790|sp|Q2K9M5|RL7_RHIEC RecName: Full=50S ribosomal protein L7/L12
 gi|86281398|gb|ABC90461.1| 50S ribosomal protein L7/L12 [Rhizobium etli CFN 42]
          Length = 127

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 78/129 (60%), Positives = 99/129 (76%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A  G+A     EKTE
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAVGGAAGGAAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K G+SK EA ++KKKLE
Sbjct: 61  FDVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVSKAEAADIKKKLE 118

Query: 118 DAGATVELR 126
           DAGA  +++
Sbjct: 119 DAGAKADVK 127


>gi|94502267|ref|ZP_01308750.1| ribosomal protein L7/L12 [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
 gi|94451174|gb|EAT14116.1| ribosomal protein L7/L12 [Candidatus Sulcia muelleri str. Hc
           (Homalodisca coagulata)]
          Length = 299

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 41/123 (33%), Positives = 73/123 (59%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I ++ ++L +LT+ E  EL+  L+K++G+ +S   SV      ++ +   +K   +  +
Sbjct: 176 KIANLAKELVNLTVTEVNELTIILKKDYGLESSYDNSVKKITETDSINQEQKKENRKYNV 235

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+AV+K ++ IT  GLK++KELV+S P ++K  ++K+EA   KKK E+ GA 
Sbjct: 236 ILKSSGPSKLAVVKLIKEITGRGLKDSKELVDSVPTTIKESINKEEAELFKKKFEEIGAE 295

Query: 123 VEL 125
           +EL
Sbjct: 296 IEL 298


>gi|163847744|ref|YP_001635788.1| 50S ribosomal protein L7/L12 [Chloroflexus aurantiacus J-10-fl]
 gi|222525607|ref|YP_002570078.1| 50S ribosomal protein L7/L12 [Chloroflexus sp. Y-400-fl]
 gi|189042985|sp|A9WFP9|RL7_CHLAA RecName: Full=50S ribosomal protein L7/L12
 gi|254806272|sp|B9LI32|RL7_CHLSY RecName: Full=50S ribosomal protein L7/L12
 gi|163669033|gb|ABY35399.1| ribosomal protein L7/L12 [Chloroflexus aurantiacus J-10-fl]
 gi|222449486|gb|ACM53752.1| ribosomal protein L7/L12 [Chloroflexus sp. Y-400-fl]
          Length = 132

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 62/134 (46%), Positives = 87/134 (64%), Gaps = 10/134 (7%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA--------EAGSAA 52
           MS I+SI+E +  L ++E  EL K++E++WGV+A+APV  +              A +  
Sbjct: 1   MSKIDSIIEMIEGLNVLELVELKKKMEEKWGVTAAAPVMAMGAAMPVAAAGDGAAAAAPV 60

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKTEF+V+LK  +    KI VIK VR +T LGLKEAK+LVE APK ++ G+SK+EA   
Sbjct: 61  EEKTEFDVILK--EAGPNKIQVIKVVRELTSLGLKEAKDLVEGAPKPVREGVSKEEAEAA 118

Query: 113 KKKLEDAGATVELR 126
           K KL +AGA VE++
Sbjct: 119 KAKLTEAGAVVEIK 132


>gi|254418132|ref|ZP_05031856.1| ribosomal protein L7/L12 [Brevundimonas sp. BAL3]
 gi|196184309|gb|EDX79285.1| ribosomal protein L7/L12 [Brevundimonas sp. BAL3]
          Length = 127

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 63/127 (49%), Positives = 91/127 (71%), Gaps = 1/127 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV++  P    A  A + + + E 
Sbjct: 1   MADLAKIVEDLSALTVLEAAELSKLLEEKWGVSAAAPVAMAMPAGGGAAPAEAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
            +   D   KKI VIKEVR + +DLGLKEAK+LVE AP+++   +SK  A+E+ KKL +A
Sbjct: 61  TVVLIDGGDKKINVIKEVRGVRSDLGLKEAKDLVEGAPQNVVENVSKQAADEVAKKLTEA 120

Query: 120 GATVELR 126
           GA V+++
Sbjct: 121 GAKVQIK 127


>gi|126724852|ref|ZP_01740695.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2150]
 gi|126706016|gb|EBA05106.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2150]
          Length = 124

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 89/126 (70%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++ +LTL+EA EL   L+ E+G+  +A  +V+     +AG +A  +TEF+V
Sbjct: 1   MADLKKMAEEIVNLTLLEAQELKTILKDEYGIEPAAGGAVMMAAGGDAGESAEAQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       +KI VIKEVRAIT LGLKEAK+LVE+  K++K G+S+ EA+E+K KLE AG
Sbjct: 61  IL--VAAGAQKIGVIKEVRAITGLGLKEAKDLVEAGGKAVKEGVSQAEADEIKAKLEAAG 118

Query: 121 ATVELR 126
           A V L+
Sbjct: 119 AEVTLK 124


>gi|296421886|ref|XP_002840494.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636712|emb|CAZ84685.1| unnamed protein product [Tuber melanosporum]
          Length = 175

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS----------VVAPVAAEAGSAA 52
            I  IV+++S LTL+E A+L   L+    +   A  S            A     A    
Sbjct: 43  KISGIVDQISGLTLMETADLVSLLKSRLNIPDVALQSFSAGPAIAAPTAAAEEEAAAEPV 102

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F V+L  F+    K  +IKEV+++  L L ++K+ VES PK LK GL K+EA ++
Sbjct: 103 QEKTMFNVMLVSFEAGS-KPKIIKEVKSLLGLSLVDSKKFVESIPKMLKEGLVKEEAEKI 161

Query: 113 KKKLEDAGATVEL 125
           +K L+D GA   L
Sbjct: 162 QKTLKDLGAVAAL 174


>gi|300087462|ref|YP_003757984.1| 50S ribosomal protein L7/L12 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
 gi|299527195|gb|ADJ25663.1| ribosomal protein L7/L12 [Dehalogenimonas lykanthroporepellens
           BL-DC-9]
          Length = 125

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 84/123 (68%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           +  I+ ++  L ++E +EL K LE+E+GVSA+ P++  AP A    +AA  + + E  + 
Sbjct: 3   VNDIISQIKELNVMELSELVKALEEEFGVSAAVPMAAAAPAAGGGEAAAPAEEQTEFDVI 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VI+ VR +T LGLKE+K+LVE+APK++K G SK+E+  +K+KLE AGATV
Sbjct: 63  LKDVGANKINVIRVVRELTGLGLKESKDLVEAAPKAVKEGASKEESASIKEKLEAAGATV 122

Query: 124 ELR 126
           E++
Sbjct: 123 EVK 125


>gi|197294700|ref|YP_001799241.1| 50S ribosomal protein L7/L12 [Candidatus Phytoplasma australiense]
 gi|254806388|sp|B1VAM7|RL7_PHYAS RecName: Full=50S ribosomal protein L7/L12
 gi|171854027|emb|CAM12000.1| 50S ribosomal protein L7/L12 [Candidatus Phytoplasma australiense]
          Length = 124

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 72/128 (56%), Gaps = 6/128 (4%)

Query: 1   MSNIES--IVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     +  L  ++L+E  EL   L++E+G+  +A    VA         A EKTEF
Sbjct: 1   MAKLTKELFISALKEMSLLEIKELLDGLKEEFGIDPNAL--AVASAGPSNAPEAEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VV+K F   K ++ VIK +R IT LGL +A + ++   + +K  +SK  A ++K KLE 
Sbjct: 59  TVVMKNF--GKNRLPVIKVIREITGLGLLDADKFIKVPDQKVKENVSKALAEDIKAKLEQ 116

Query: 119 AGATVELR 126
           AGA +EL+
Sbjct: 117 AGAVIELQ 124


>gi|241765527|ref|ZP_04763489.1| ribosomal protein L7/L12 [Acidovorax delafieldii 2AN]
 gi|241364684|gb|EER59709.1| ribosomal protein L7/L12 [Acidovorax delafieldii 2AN]
          Length = 125

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +  A       +AA EKTEF VVL
Sbjct: 4   DKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAAGGGAGAAAAEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    K++VIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA 
Sbjct: 64  T--DAGANKVSVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGAK 121

Query: 123 VELR 126
            EL+
Sbjct: 122 AELK 125


>gi|323705652|ref|ZP_08117226.1| ribosomal protein L7/L12 [Thermoanaerobacterium xylanolyticum
           LX-11]
 gi|323535129|gb|EGB24906.1| ribosomal protein L7/L12 [Thermoanaerobacterium xylanolyticum
           LX-11]
          Length = 124

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 69/125 (55%), Positives = 94/125 (75%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           N E I+E + ++T++E A+L K LE+E+GVSA+APV+V A  AA A +A   EKTEF+V+
Sbjct: 2   NKEEILEAIKNMTVLELADLVKALEEEFGVSAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D   +KI VIK VR +T+LGLKEAK+LVE APK +K G+SKDEAN++K K E+ GA
Sbjct: 62  LS--DVGSEKIKVIKVVREVTNLGLKEAKDLVEGAPKPIKEGVSKDEANQIKAKFEEVGA 119

Query: 122 TVELR 126
            VE++
Sbjct: 120 KVEIK 124


>gi|84499872|ref|ZP_00998138.1| ribosomal protein L7/L12 [Oceanicola batsensis HTCC2597]
 gi|84391806|gb|EAQ04074.1| ribosomal protein L7/L12 [Oceanicola batsensis HTCC2597]
          Length = 127

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 63/129 (48%), Positives = 87/129 (67%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A  G A +    KTE
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGGDAGAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       KI VIKEVR IT LGLKEAKELVE+  K++K G+SKDEA E+K KLE
Sbjct: 61  FDVILKS--AGASKINVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKDEAEEIKGKLE 118

Query: 118 DAGATVELR 126
            AGA +EL+
Sbjct: 119 AAGAEIELK 127


>gi|294101328|ref|YP_003553186.1| ribosomal protein L7/L12 [Aminobacterium colombiense DSM 12261]
 gi|293616308|gb|ADE56462.1| ribosomal protein L7/L12 [Aminobacterium colombiense DSM 12261]
          Length = 126

 Score = 85.3 bits (210), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E I++ +  +T++E +EL K LE ++GVSASAP   +  +   AG+A +    KTEF+VV
Sbjct: 4   EEIIQAIEGMTVLELSELVKALEDKFGVSASAPAMAMPMMMPGAGAAVAAEEEKTEFDVV 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LKG      KIA IK VR +T LGLKEAKELV++APK +K  +SK+EA+E+K KLE+AGA
Sbjct: 64  LKG--PGSNKIATIKVVRELTGLGLKEAKELVDNAPKPVKEAVSKEEADEIKAKLEEAGA 121

Query: 122 TVELR 126
            VE++
Sbjct: 122 EVEVK 126


>gi|258591308|emb|CBE67607.1| 50S ribosomal subunit protein L7/L12 [NC10 bacterium 'Dutch
           sediment']
          Length = 130

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SE 54
           M+ +  + +++ + + T+++  +L K +E ++GVSA+A + + A  +  AG+AA     E
Sbjct: 1   MAKVTVDDVLDSIETWTVLDLNKLVKGIEDKFGVSATAMMPMAAVGSGGAGAAAAPAAEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF V+L      +KKI VIKEVRAIT LGLKEAK+LVE APK +K GLSK EA E+K 
Sbjct: 61  KTEFSVILASV--GEKKIQVIKEVRAITGLGLKEAKDLVEGAPKPVKEGLSKAEAEEIKA 118

Query: 115 KLEDAGATVELR 126
           KLE  GAT EL+
Sbjct: 119 KLEATGATAELK 130


>gi|226309796|ref|YP_002769690.1| 50S ribosomal protein L7/L12 [Brevibacillus brevis NBRC 100599]
 gi|254806265|sp|C0ZIG8|RL7_BREBN RecName: Full=50S ribosomal protein L7/L12
 gi|226092744|dbj|BAH41186.1| 50S ribosomal protein L7/L12 [Brevibacillus brevis NBRC 100599]
          Length = 120

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 82/126 (65%), Gaps = 6/126 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS  + I+E +  ++++E  +L K +E+E+        + VA VA     AA+E+TEF V
Sbjct: 1   MSK-DQILEAIKGMSVLELNDLVKAIEEEF---GVTAAAPVAVVAGGGAEAAAEQTEFTV 56

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI VIK VR +T LGLKEAK+LV++APK+LK G+SKDEA  +K KLE+AG
Sbjct: 57  NL--VSGGASKINVIKVVRELTGLGLKEAKDLVDNAPKTLKEGVSKDEAEALKAKLEEAG 114

Query: 121 ATVELR 126
           A VE++
Sbjct: 115 AQVEVK 120


>gi|7524913|ref|NP_045915.1| ribosomal protein L12 [Chlorella vulgaris]
 gi|3024542|sp|P56345|RK12_CHLVU RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|2224507|dbj|BAA57991.1| 50S ribosomal protein L12 [Chlorella vulgaris]
          Length = 131

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 54/129 (41%), Positives = 79/129 (61%), Gaps = 6/129 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-----APVAAEAGSAASEKT 56
           +    I++ L S+TL+EAAEL  ++E+ +GV ASAPV              A     EKT
Sbjct: 3   TKTNEILDILKSITLLEAAELVSQIEETFGVDASAPVGGGFMAAPGGAGTAAAEIVEEKT 62

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+V+++      K++ V+K VR +T L LKEAKE + S PK ++ G+SKD+A   KK+L
Sbjct: 63  TFDVIIEDV-ASDKRVPVLKVVRNLTSLDLKEAKEAITSLPKVIQQGVSKDDAEASKKQL 121

Query: 117 EDAGATVEL 125
           EDAGA V++
Sbjct: 122 EDAGAKVKI 130


>gi|296444413|ref|ZP_06886378.1| ribosomal protein L7/L12 [Methylosinus trichosporium OB3b]
 gi|296258060|gb|EFH05122.1| ribosomal protein L7/L12 [Methylosinus trichosporium OB3b]
          Length = 126

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 70/126 (55%), Positives = 90/126 (71%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+A V+V A   A   +AA  + + E 
Sbjct: 1   MANLEKIVEDLSALTVLEAAELAKMLEEKWGVSAAAAVAVAAAPGAGGAAAAPVEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK +K G+ KDEA ++K  LE  G
Sbjct: 61  NVILAAAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVGKDEAEKIKATLEKVG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|298291426|ref|YP_003693365.1| ribosomal protein L7/L12 [Starkeya novella DSM 506]
 gi|296927937|gb|ADH88746.1| ribosomal protein L7/L12 [Starkeya novella DSM 506]
          Length = 127

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 74/129 (57%), Positives = 99/129 (76%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTE 57
           M+++  +V++LS+LT++EAAEL+K LE++WGVSA+A V+V A   A  G+AA    E+TE
Sbjct: 1   MADLSKLVDELSNLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAAGGAAAPAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F VVL       KKI VIKEVRAIT LGLKEAK+LVE+APK +K G+SKDEA ++K ++E
Sbjct: 61  FTVVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEAAPKPIKEGVSKDEAEKIKAQVE 118

Query: 118 DAGATVELR 126
            AGA VEL+
Sbjct: 119 KAGAKVELK 127


>gi|254456000|ref|ZP_05069429.1| ribosomal protein L7/L12 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083002|gb|EDZ60428.1| ribosomal protein L7/L12 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 121

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 69/126 (54%), Positives = 92/126 (73%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M ++  I+E LSSLT+ EAAELSK+LE++WGV+   P++  AP AA   + A +K +F +
Sbjct: 1   MPDLNKIIEDLSSLTVAEAAELSKQLEEKWGVT---PMAAAAPAAAGGAAPAEDKDDFTI 57

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L      +KKI VIKEVRA T LGLKEAK+LVE APK +K+G++K EA E+K KLE AG
Sbjct: 58  ML--VSAGEKKINVIKEVRAATSLGLKEAKDLVEGAPKEVKSGVNKKEAEEIKAKLEAAG 115

Query: 121 ATVELR 126
           A VEL+
Sbjct: 116 AKVELK 121


>gi|206890982|ref|YP_002249157.1| ribosomal protein L7/L12 [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742920|gb|ACI21977.1| ribosomal protein L7/L12 [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 128

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 86/125 (68%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFEVV 61
           E + +   +LT++E ++  K  E+ +GV+A+APV+V A   A A  AA    EKT F+V+
Sbjct: 6   EEVFQFFDNLTILELSQFIKEFEERYGVTAAAPVAVAAAPGAPAAQAAPAAEEKTSFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK      KKI VIK VR +T LGLKEAK+LV+ APK +KTG+SK+EA+ +K KLE  GA
Sbjct: 66  LKA--AGDKKIQVIKVVRELTGLGLKEAKDLVDGAPKPVKTGVSKEEADTIKSKLEAEGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIQ 128


>gi|84515196|ref|ZP_01002559.1| ribosomal protein L7/L12 [Loktanella vestfoldensis SKA53]
 gi|84511355|gb|EAQ07809.1| ribosomal protein L7/L12 [Loktanella vestfoldensis SKA53]
          Length = 123

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 65/125 (52%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL++A EL   L+ E+G+  +A  +V+    A    AA EKTEF+V
Sbjct: 1   MADLKKLAEEIVGLTLLQAQELKTILKDEYGIEPAAGGAVMMAGPAATAEAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  D   +KI VIKEVR IT LGLKEAK+LVE+  K +K G SK EA+E+K KLE AG
Sbjct: 61  VLK--DAGAQKINVIKEVRGITGLGLKEAKDLVEAGGK-VKEGASKAEADEIKAKLEAAG 117

Query: 121 ATVEL 125
           ATVEL
Sbjct: 118 ATVEL 122


>gi|125987529|sp|Q1ACG9|RK12_CHAVU RecName: Full=50S ribosomal protein L12, chloroplastic
          Length = 135

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 76/129 (58%), Gaps = 6/129 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE-----AGSAASEKTE 57
           ++  ++  + SLTL E    + +L+ E G+S+    S    +              EKTE
Sbjct: 8   DLNQLLNAIKSLTLQEIKIFTDKLQDELGISSDNLYSSRGILTESTSHNKEVEEIDEKTE 67

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+++L+       +I VIK +R+IT+ GLKEAKE +E+ PK++K G+SK+EA  +K +LE
Sbjct: 68  FDIILEEV-PSSSRITVIKVIRSITNSGLKEAKEFIEALPKTVKEGISKEEAESVKAQLE 126

Query: 118 DAGATVELR 126
           ++GA V LR
Sbjct: 127 ESGAKVTLR 135


>gi|317488688|ref|ZP_07947227.1| ribosomal protein L7/L12 [Eggerthella sp. 1_3_56FAA]
 gi|325831654|ref|ZP_08164871.1| ribosomal protein L7/L12 [Eggerthella sp. HGA1]
 gi|316912204|gb|EFV33774.1| ribosomal protein L7/L12 [Eggerthella sp. 1_3_56FAA]
 gi|325486525|gb|EGC88974.1| ribosomal protein L7/L12 [Eggerthella sp. HGA1]
          Length = 125

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 70/122 (57%), Positives = 94/122 (77%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  ++L+EA+EL K +E+ +GVSA+APV+V A   AE G+AA EKT+F+VVL+G
Sbjct: 6   EEIIEALKEMSLLEASELVKDIEETFGVSAAAPVAVAAAAPAEGGAAAEEKTDFDVVLEG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KIAVIK VR IT LGLKEAKE VE APK+++ G++K++A E+K KLE+AGA V 
Sbjct: 66  F--GDNKIAVIKVVREITGLGLKEAKEAVEGAPKAIQEGVNKEKAEEIKAKLEEAGAAVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|261854942|ref|YP_003262225.1| ribosomal protein L7/L12 [Halothiobacillus neapolitanus c2]
 gi|261835411|gb|ACX95178.1| ribosomal protein L7/L12 [Halothiobacillus neapolitanus c2]
          Length = 125

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +S+++++E  +L   +E+++GVSA+A V+V  P AA   +A  EKTEF+VVLK 
Sbjct: 6   DDILEAISNMSVMEVVDLISAMEEKFGVSAAAAVAVAGPAAAGPAAAVEEKTEFDVVLKS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK VR +T LGLKEAK++VE AP ++K G S  +A  MK KL +AGA VE
Sbjct: 66  F--GANKVGVIKAVRELTGLGLKEAKDMVEGAPATIKEGASAADAEAMKAKLTEAGAEVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|193213523|ref|YP_001999476.1| 50S ribosomal protein L7/L12 [Chlorobaculum parvum NCIB 8327]
 gi|226733658|sp|B3QQS3|RL7_CHLP8 RecName: Full=50S ribosomal protein L7/L12
 gi|193087000|gb|ACF12276.1| ribosomal protein L7/L12 [Chlorobaculum parvum NCIB 8327]
          Length = 126

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 65/125 (52%), Positives = 89/125 (71%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+IE++VE++  LTL EA+EL K LE+++GVSA+  V      AA AG AA+ + + E 
Sbjct: 1   MSSIETLVEEIGKLTLTEASELVKALEEKFGVSAAPAVVAGGMAAAPAGEAAAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       +KI VIK VRAIT LGLKEAKE+V+ APK++K  +SKDEA ++ K+L+DAG
Sbjct: 61  DVVLKAAGAQKINVIKVVRAITGLGLKEAKEMVDGAPKTVKEAVSKDEAEKIAKELKDAG 120

Query: 121 ATVEL 125
           A VEL
Sbjct: 121 AEVEL 125


>gi|159042822|ref|YP_001531616.1| 50S ribosomal protein L7/L12 [Dinoroseobacter shibae DFL 12]
 gi|157910582|gb|ABV92015.1| 50S ribosomal protein L7/L12 [Dinoroseobacter shibae DFL 12]
          Length = 126

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 82/126 (65%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A   + A+ + + E 
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGDAGAAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       +KI VIKEVRA+T LGLKEAKELVE+  K++K G+ K EA E+K KLE AG
Sbjct: 61  DVILKAAGAQKINVIKEVRALTGLGLKEAKELVEAGGKAVKEGVDKAEAEEIKGKLEAAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|304315931|ref|YP_003851076.1| ribosomal protein L7/L12 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302777433|gb|ADL67992.1| ribosomal protein L7/L12 [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
          Length = 124

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           N E I+E + S+T++E A+L K LE+E+GVSA+APV+V A  AA A +A   EKTEF+V+
Sbjct: 2   NKEEILEAIKSMTVLELADLVKALEEEFGVSAAAPVAVAAAPAAGAAAAPAEEKTEFDVI 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D   +KI VIK VR +T+LGLKEAK+LVE APK +K G+SKDEAN++K K E+ GA
Sbjct: 62  LT--DVGSEKIKVIKVVREVTNLGLKEAKDLVEGAPKPIKEGVSKDEANQIKAKFEEVGA 119

Query: 122 TVELR 126
            VE++
Sbjct: 120 KVEIK 124


>gi|315226067|ref|ZP_07867855.1| ribosomal protein L7/L12 [Parascardovia denticolens DSM 10105]
 gi|315120199|gb|EFT83331.1| ribosomal protein L7/L12 [Parascardovia denticolens DSM 10105]
          Length = 136

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 82/128 (64%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + +++    +TL+E +E  K+ E+E+ V A+APV+ VA   A   +A  E+TEF
Sbjct: 11  MAKLSTDELLDAFKEMTLVELSEFVKKFEEEFDVEAAAPVAAVAAAPAAVAAAEEEQTEF 70

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL       KKI VIK VRA+T LGL EAK LV+ AP ++   +SK++A + K  LE+
Sbjct: 71  TVVLSAV--GDKKIQVIKAVRALTKLGLAEAKGLVDGAPANVLENVSKEDAEKAKADLEE 128

Query: 119 AGATVELR 126
           AGATV L+
Sbjct: 129 AGATVTLK 136


>gi|269469119|gb|EEZ80667.1| ribosomal protein L7/L12 [uncultured SUP05 cluster bacterium]
          Length = 125

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++   EL   +E+++GVSA+A  +  A  AA+AG A  EK+EF VVL  
Sbjct: 6   DDILNAIADMSVMNVVELVSAMEEKFGVSAAAAAAAPAAAAADAGGAVEEKSEFNVVLTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   +KK+AVIK VR+IT LGLKEAK++VESA   +K G SK EA E++K+LE+AGA+VE
Sbjct: 66  F--GEKKVAVIKAVRSITGLGLKEAKDMVESADAVIKEGASKAEAEEIQKQLEEAGASVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|149195229|ref|ZP_01872319.1| 50S ribosomal protein L7/L12 [Caminibacter mediatlanticus TB-2]
 gi|149134662|gb|EDM23148.1| 50S ribosomal protein L7/L12 [Caminibacter mediatlanticus TB-2]
          Length = 123

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + +LT+ E  EL K  E+++ VSA    +VVA   A  G AA EK+EF+V+LK 
Sbjct: 6   EQILETIENLTVKELNELVKLFEEKFEVSAQP--TVVAGAGAAGGEAAEEKSEFDVILK- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VR IT  GLKEAKE+V+ AP ++K  +SK+EA E+KK LE+AGATVE
Sbjct: 63  -DAGAKKINVIKVVRQITGAGLKEAKEMVDGAPTTIKEAVSKEEAEEIKKALEEAGATVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|329897162|ref|ZP_08271903.1| LSU ribosomal protein L7/L12 (L23e) [gamma proteobacterium
           IMCC3088]
 gi|328921379|gb|EGG28772.1| LSU ribosomal protein L7/L12 (L23e) [gamma proteobacterium
           IMCC3088]
          Length = 127

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 50/122 (40%), Positives = 81/122 (66%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++  EL   +E+++GV+A+A V+V    A     AA+   + E  +  
Sbjct: 6   DEILDAIAEMSVMDVVELISAMEEKFGVTAAAAVAVAPAAAGGDAGAAAAAEQTEFDVIL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VRA+T LGLKEAK LV+ AP  +K G SKDEA ++KK++E+AG TVE
Sbjct: 66  TSGGEKKVNVIKVVRAVTGLGLKEAKGLVDGAPAPVKEGASKDEAEDIKKQIEEAGGTVE 125

Query: 125 LR 126
           L+
Sbjct: 126 LK 127


>gi|118411125|ref|YP_874519.1| 50S ribosomal protein L12 [Thalassiosira pseudonana]
 gi|125987531|sp|A0T0Q7|RK12_THAPS RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|116739872|gb|ABK20742.1| 50S ribosomal protein L12 [Thalassiosira pseudonana]
          Length = 128

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 79/125 (63%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEV 60
            I  IVE+L +LTL+EA+EL   +E+ +GV ASA       +A    +A     KTEF V
Sbjct: 4   KINQIVEELKTLTLLEASELVAAIEETFGVDASASTGGGVVMAVAPAAAEEVEEKTEFTV 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKIAV+K VR +T LGLKEAKELVES PK ++ GL KD A + KK++EDAG
Sbjct: 64  MLDEV-PADKKIAVLKVVRTLTGLGLKEAKELVESTPKMVQEGLGKDAAEDAKKQIEDAG 122

Query: 121 ATVEL 125
             V L
Sbjct: 123 GKVSL 127


>gi|85715145|ref|ZP_01046129.1| 50S ribosomal protein L7/L12 [Nitrobacter sp. Nb-311A]
 gi|85698060|gb|EAQ35933.1| 50S ribosomal protein L7/L12 [Nitrobacter sp. Nb-311A]
          Length = 126

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 94/126 (74%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ IV+ LS+LT++EAAEL+K LE++WGVSA+A V+V A   A  G+AA+ + + + 
Sbjct: 1   MADLQKIVDDLSALTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGGAAAAAEEKTDF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE AG
Sbjct: 61  TVVLAAAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKIKAQLEKAG 120

Query: 121 ATVELR 126
             VEL+
Sbjct: 121 GKVELK 126


>gi|146297204|ref|YP_001180975.1| ribosomal protein L7/L12 [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|312127424|ref|YP_003992298.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor hydrothermalis
           108]
 gi|145410780|gb|ABP67784.1| LSU ribosomal protein L12P [Caldicellulosiruptor saccharolyticus
           DSM 8903]
 gi|311777443|gb|ADQ06929.1| ribosomal protein L7/L12 [Caldicellulosiruptor hydrothermalis 108]
          Length = 129

 Score = 85.0 bits (209), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 66/127 (51%), Positives = 92/127 (72%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFE 59
            ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A +AA    EKTEF 
Sbjct: 5   KVQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQAAAPAAEEKTEFN 64

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIK VR IT LGLKEAK+LV+ APK +K  +SKDEA ++KKKLE+ 
Sbjct: 65  VILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDGAPKPIKENVSKDEAEQIKKKLEEV 122

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 123 GAKVELK 129


>gi|89513314|gb|ABD74516.1| ribosomal protein [Pteris vittata]
          Length = 216

 Score = 85.0 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 51/137 (37%), Positives = 74/137 (54%), Gaps = 15/137 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA--------------PVAAEA 48
            +  + ++++SL+  E A +S  L K  G+    P+  +                  A A
Sbjct: 80  KVLRLRDEIASLSDEELAAMSAGLRKVLGLPEPPPMGAMPMGGMAADWQEGGGDAGPAPA 139

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
              A EKT F V ++ F+    KI VIKEVRA +DLGLKEAKE VE  P  LK+GL+K+E
Sbjct: 140 EEKAPEKTSFSVKIEKFEA-ASKIKVIKEVRAASDLGLKEAKEFVEKVPAVLKSGLTKEE 198

Query: 109 ANEMKKKLEDAGATVEL 125
           A+++  KL+  GAT  +
Sbjct: 199 ASQLIDKLKAVGATAVM 215


>gi|325108565|ref|YP_004269633.1| 50S ribosomal protein L12P [Planctomyces brasiliensis DSM 5305]
 gi|324968833|gb|ADY59611.1| LSU ribosomal protein L12P [Planctomyces brasiliensis DSM 5305]
          Length = 138

 Score = 85.0 bits (209), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 80/126 (63%), Gaps = 6/126 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEFEV 60
           +++ +++  LTL++A  L+  L++  G+  +    V+A   A  G         KTEF+V
Sbjct: 15  KTLGDQIVGLTLLQAKNLADYLKEVHGIEPAGGGVVMAAGPAGGGDEGGAAAEEKTEFDV 74

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       +KI VIK VRAIT LGLKEAKELVE APK++K G+SK++A ++K  LE AG
Sbjct: 75  VLTAI--GDQKIGVIKAVRAITGLGLKEAKELVEGAPKAVKEGVSKEDAEKIKGDLEAAG 132

Query: 121 ATVELR 126
           AT E++
Sbjct: 133 ATAEIK 138


>gi|291334052|gb|ADD93725.1| ribosomal protein L7/L12 [uncultured marine bacterium
           MedDCM-OCT-S05-C114]
          Length = 130

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 76/132 (57%), Positives = 93/132 (70%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SE 54
           MS+I  + +VE LSS ++IE A+L K LE++WGVSA+AP +V     A  G A      E
Sbjct: 1   MSDITKDQVVEWLSSQSVIEVADLVKELEEKWGVSAAAPAAVAVAAPAGGGDAGGAAAEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           K+EF+VVL  F     KIAVIKEVRAIT LGLKEAKELVE APK +K G+SKDEA E+ K
Sbjct: 61  KSEFDVVLTEF--GGNKIAVIKEVRAITGLGLKEAKELVEGAPKPVKEGVSKDEAEEISK 118

Query: 115 KLEDAGATVELR 126
           KLE AGA  E++
Sbjct: 119 KLEAAGAKAEIK 130


>gi|226939178|ref|YP_002794249.1| RplL [Laribacter hongkongensis HLHK9]
 gi|254806378|sp|C1DAQ9|RL7_LARHH RecName: Full=50S ribosomal protein L7/L12
 gi|226714102|gb|ACO73240.1| RplL [Laribacter hongkongensis HLHK9]
          Length = 123

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + ++T++E  +L K  E+++GVSA+A        AA A +AA EKTEF+VVL  
Sbjct: 6   DDILEAVGAMTVMELNDLVKAFEEKFGVSAAAMAVAA--PAAGAAAAAEEKTEFDVVLTA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VRA+T LGLKEAK++V+ APK++K G+SK +A  M K+L +AGA  E
Sbjct: 64  --AGDNKVNVIKVVRALTGLGLKEAKDMVDGAPKTVKEGVSKADAEAMLKQLTEAGAKAE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|296131827|ref|YP_003639074.1| ribosomal protein L7/L12 [Thermincola sp. JR]
 gi|296030405|gb|ADG81173.1| ribosomal protein L7/L12 [Thermincola potens JR]
          Length = 128

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 71/130 (54%), Positives = 90/130 (69%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKT 56
           MS +  I+E +  LT++E AEL K  E+E+GV+A+APV+V A   A AG AA     EKT
Sbjct: 1   MSKVNEILEAVKGLTVLELAELVKAFEEEFGVTAAAPVAVAAAAPAAAGGAAAAAAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L       KKI VIK VR IT LGLKEAKELV+ APK +K  + K+EA  +K KL
Sbjct: 61  EFDVILAS--AGDKKINVIKVVREITGLGLKEAKELVDGAPKPVKEKVGKEEAESIKAKL 118

Query: 117 EDAGATVELR 126
           E+AGATVEL+
Sbjct: 119 EEAGATVELK 128


>gi|323137106|ref|ZP_08072185.1| ribosomal protein L7/L12 [Methylocystis sp. ATCC 49242]
 gi|322397464|gb|EFX99986.1| ribosomal protein L7/L12 [Methylocystis sp. ATCC 49242]
          Length = 126

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 69/126 (54%), Positives = 90/126 (71%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+A V+V A   A   +A + + + E 
Sbjct: 1   MANLEKIVEDLSALTVLEAAELAKMLEEKWGVSAAAAVAVAAAPGAGGAAAPAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK LK G SK+EA ++K  LE  G
Sbjct: 61  NVILASAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGASKEEAEKIKATLEKVG 120

Query: 121 ATVELR 126
           A +EL+
Sbjct: 121 AKIELK 126


>gi|119356079|ref|YP_910723.1| 50S ribosomal protein L7/L12 [Chlorobium phaeobacteroides DSM 266]
 gi|166222155|sp|A1BD22|RL7_CHLPD RecName: Full=50S ribosomal protein L7/L12
 gi|119353428|gb|ABL64299.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Chlorobium
           phaeobacteroides DSM 266]
          Length = 125

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 88/123 (71%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE++VE++  LTL EA+EL K LE+++GVSA+  +      AA AG A +++ + E  + 
Sbjct: 3   IETLVEEIGKLTLTEASELVKALEEKFGVSAAPAMMAGVMAAAPAGDAPAQEEKTEFDVV 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                + KI VIK VRA+T LGLKEAK+LV+ APK++K G+SKDEA ++ K+L+D GA+V
Sbjct: 63  LTAAGESKINVIKVVRALTGLGLKEAKDLVDGAPKTVKEGISKDEAEKVAKELKDVGASV 122

Query: 124 ELR 126
           EL+
Sbjct: 123 ELK 125


>gi|329118713|ref|ZP_08247413.1| 50S ribosomal protein L7/L12 [Neisseria bacilliformis ATCC
           BAA-1200]
 gi|327465148|gb|EGF11433.1| 50S ribosomal protein L7/L12 [Neisseria bacilliformis ATCC
           BAA-1200]
          Length = 123

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA   A   +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAAGPAAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRA+T LGLKEAK+LV+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAVTGLGLKEAKDLVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|212702085|ref|ZP_03310213.1| hypothetical protein DESPIG_00092 [Desulfovibrio piger ATCC 29098]
 gi|212674490|gb|EEB34973.1| hypothetical protein DESPIG_00092 [Desulfovibrio piger ATCC 29098]
          Length = 128

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 88/125 (70%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFEVV 61
           E +VE +S++T++E +E  K LE+++GVSA+AP + +   A   G AA    EKTEF+V+
Sbjct: 6   EQVVEFISNMTVLELSEFIKELEEKFGVSAAAPAAAMVMAAPADGGAAAAAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +    KI VIK VRA+T LGLKEAKE V+  P +LK G+SK+EA E KK+L +AGA
Sbjct: 66  LK--EAGANKIGVIKVVRALTSLGLKEAKEKVDGCPSTLKEGVSKEEAEEAKKQLTEAGA 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 VVEVK 128


>gi|222148356|ref|YP_002549313.1| 50S ribosomal protein L7/L12 [Agrobacterium vitis S4]
 gi|254806253|sp|B9JVM7|RL7_AGRVS RecName: Full=50S ribosomal protein L7/L12
 gi|221735344|gb|ACM36307.1| 50S ribosomal protein L7/L12 [Agrobacterium vitis S4]
          Length = 124

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 96/126 (76%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A     A     EKTEF+V
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGGAAAVVEEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDAG
Sbjct: 61  ILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDAG 118

Query: 121 ATVELR 126
           A V+++
Sbjct: 119 AKVDVK 124


>gi|51473338|ref|YP_067095.1| 50S ribosomal protein L7/L12 [Rickettsia typhi str. Wilmington]
 gi|81610830|sp|Q68XM9|RL7_RICTY RecName: Full=50S ribosomal protein L7/L12
 gi|51459650|gb|AAU03613.1| 50S ribosomal protein L7/L12 [Rickettsia typhi str. Wilmington]
          Length = 125

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 69/127 (54%), Positives = 88/127 (69%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFE 59
           M+++  I E+LSSLTL++AAEL K LE +WGVSA  P++V  A VA     A +EKTEFE
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKILEAKWGVSAVTPIAVASAGVADPVAEAVAEKTEFE 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KK+ VIK ++ IT LGL EAK+LV+ APK +K+ L K EA E+K KLE  
Sbjct: 61  VVLTAT--GDKKVEVIKIIKDITGLGLIEAKKLVDEAPKPIKSNLKKAEAEEIKNKLEAT 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|310659516|ref|YP_003937237.1| 50S ribosomal protein L7/l12 [Clostridium sticklandii DSM 519]
 gi|308826294|emb|CBH22332.1| 50S ribosomal subunit protein L7/L12 [Clostridium sticklandii]
          Length = 120

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 89/123 (72%), Gaps = 5/123 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E + ++ ++E  EL K  E+++GVSASAPV +     A AG+AA EKTEF+V+L 
Sbjct: 3   IEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMMA---GAAAGAAAEEKTEFDVILA 59

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    K+ VIK VR IT LGLKEAK+LV+ APK +K G +K+EA+++K+KLE AGA V
Sbjct: 60  --EAGSSKVGVIKVVREITGLGLKEAKDLVDGAPKPVKEGATKEEADQIKEKLEAAGAKV 117

Query: 124 ELR 126
           E++
Sbjct: 118 EVK 120


>gi|119899714|ref|YP_934927.1| 50S ribosomal protein L7/L12 [Azoarcus sp. BH72]
 gi|166222133|sp|A1KB35|RL7_AZOSB RecName: Full=50S ribosomal protein L7/L12
 gi|119672127|emb|CAL96041.1| 50S ribosomal subunit protein L7/L12 [Azoarcus sp. BH72]
          Length = 125

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + S+T++E  +L K  E+++GVSA+A           A  AA EKTEF+V+L  
Sbjct: 6   DDILEAVGSMTVMELNDLVKAFEEKFGVSAAALAVAAPGAGGAAAPAAEEKTEFDVILTA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VRA T LGLKEAK++V+ APK++K G++K +A  +KK+LEDAGA VE
Sbjct: 66  --AGEKKVEVIKVVRAATGLGLKEAKDVVDGAPKAVKEGIAKADAEALKKQLEDAGAKVE 123

Query: 125 LR 126
           ++
Sbjct: 124 IK 125


>gi|315499737|ref|YP_004088540.1| ribosomal protein l7/l12 [Asticcacaulis excentricus CB 48]
 gi|315417749|gb|ADU14389.1| ribosomal protein L7/L12 [Asticcacaulis excentricus CB 48]
          Length = 128

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 74/130 (56%), Positives = 94/130 (72%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EKTE 57
           MS +E +V  LS+LT++EAAELSK LE +WGVSA+APV+V A     A + A    E+TE
Sbjct: 1   MSKLEQLVADLSALTVLEAAELSKLLEDKWGVSAAAPVAVAAVAGGAAAAPAEAVEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITD-LGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F VVL   D   KKI VIKE+R I   LGLKEAK+LVE AP+++K  +SK EA ++KKKL
Sbjct: 61  FTVVL--VDGGDKKINVIKEIRGIRSELGLKEAKDLVEGAPQTVKENVSKQEAADIKKKL 118

Query: 117 EDAGATVELR 126
           EDAGA VE++
Sbjct: 119 EDAGAKVEVK 128


>gi|209884798|ref|YP_002288655.1| ribosomal protein L7/L12 [Oligotropha carboxidovorans OM5]
 gi|226733714|sp|B6JER8|RL7_OLICO RecName: Full=50S ribosomal protein L7/L12
 gi|209872994|gb|ACI92790.1| ribosomal protein L7/L12 [Oligotropha carboxidovorans OM5]
          Length = 125

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A AG A   EKTEF+
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAAAGGAPAEEKTEFQ 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK LK G++KDEA ++K  LE A
Sbjct: 61  VVLAA--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVAKDEAEKIKAALEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|325267350|ref|ZP_08134011.1| 50S ribosomal protein L7/L12 [Kingella denitrificans ATCC 33394]
 gi|324981145|gb|EGC16796.1| 50S ribosomal protein L7/L12 [Kingella denitrificans ATCC 33394]
          Length = 124

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +  LT++E  EL K  E+++   ++A V+V  P A  A  AA  KTEF+V+L  
Sbjct: 6   EDILNAVEQLTVMELNELVKAFEEKF-GVSAAAVAVAGPAAGGAAGAAEAKTEFDVILAA 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK+LV+ APK+LK G+S+ EA+++KK+LE+AGA VE
Sbjct: 65  --SGDQKVGVIKVVRAITGLGLKEAKDLVDGAPKTLKEGVSQAEADDIKKQLEEAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|317133012|ref|YP_004092326.1| ribosomal protein L7/L12 [Ethanoligenens harbinense YUAN-3]
 gi|315470991|gb|ADU27595.1| ribosomal protein L7/L12 [Ethanoligenens harbinense YUAN-3]
          Length = 126

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 73/124 (58%), Positives = 93/124 (75%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            +  ++E + +LT++E +EL K LE+E+GVSA+APV+V A  AA A  AA EKTEF+VVL
Sbjct: 5   KVTKLIEDVKALTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGAAPAAEEKTEFDVVL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIK VR IT LGLK+AKELVESAPK++K  + KDEA E+KKK+EDAGA 
Sbjct: 65  T--DIGGSKIGVIKVVREITGLGLKDAKELVESAPKAIKEKVGKDEAEELKKKIEDAGAK 122

Query: 123 VELR 126
           VEL+
Sbjct: 123 VELK 126


>gi|269121547|ref|YP_003309724.1| ribosomal protein L7/L12 [Sebaldella termitidis ATCC 33386]
 gi|268615425|gb|ACZ09793.1| ribosomal protein L7/L12 [Sebaldella termitidis ATCC 33386]
          Length = 123

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 84/124 (67%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N +  +E L ++T++E  E+ + +E+ +GVSA          A    +A  EK+EF+V+L
Sbjct: 4   NKDQFIEDLKNMTVLELKEVVEAIEETFGVSAQPVAVAA--GAGAGAAAVEEKSEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GF   +KK AVIKEVR IT LGLKEAK+LVE+  K++K G SKDEA ++K +LE AGAT
Sbjct: 62  TGF--GEKKTAVIKEVRTITGLGLKEAKDLVEAGGKAVKEGASKDEAEKIKAQLEAAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|160895958|ref|YP_001561540.1| 50S ribosomal protein L7/L12 [Delftia acidovorans SPH-1]
 gi|226733672|sp|A9BR97|RL7_DELAS RecName: Full=50S ribosomal protein L7/L12
 gi|160361542|gb|ABX33155.1| ribosomal protein L7/L12 [Delftia acidovorans SPH-1]
          Length = 125

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L  +T++E  +L K +E+++GVSA+A  +  A  AA   +AA EKTEF VVL
Sbjct: 4   DKDAFLTALDGMTVLELNDLVKAIEEKFGVSAAAMAAPAAGGAAGGAAAAEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K++VIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA 
Sbjct: 64  T--EAGANKVSVIKAVREITGLGLKEAKDLVDGAPKNVKEGVAKADAEAAVKKLVEAGAK 121

Query: 123 VELR 126
            EL+
Sbjct: 122 AELK 125


>gi|119196141|ref|XP_001248674.1| hypothetical protein CIMG_02445 [Coccidioides immitis RS]
 gi|303321914|ref|XP_003070951.1| 54S ribosomal protein L12, mitochondrial precursor, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240110648|gb|EER28806.1| 54S ribosomal protein L12, mitochondrial precursor, putative
           [Coccidioides posadasii C735 delta SOWgp]
 gi|320040472|gb|EFW22405.1| 50S ribosomal protein L12 [Coccidioides posadasii str. Silveira]
          Length = 189

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 43/136 (31%), Positives = 66/136 (48%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------------VVAPVAAEAG 49
            I  IV+++S LTL+E A+L   L+    +                      A    E  
Sbjct: 54  KIAQIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAMAAGGAAPGAAAPAAEEDEPA 113

Query: 50  SAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
            AA EKT F + L+ FD    K  VIKEV+++  L L ++K+ VES PK +K  + K+EA
Sbjct: 114 PAAQEKTLFNLKLESFDASA-KAKVIKEVKSLLGLSLVDSKKFVESVPKVMKESVPKEEA 172

Query: 110 NEMKKKLEDAGATVEL 125
            ++ + L+  GA   +
Sbjct: 173 EKIVETLKALGAKAVM 188


>gi|325133044|gb|EGC55716.1| ribosomal protein L7/L12 [Neisseria meningitidis M6190]
 gi|325139023|gb|EGC61569.1| ribosomal protein L7/L12 [Neisseria meningitidis ES14902]
          Length = 123

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A      A EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAVDAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|15676059|ref|NP_273189.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis MC58]
 gi|121634008|ref|YP_974253.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis FAM18]
 gi|161870924|ref|YP_001600104.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis 053442]
 gi|218767182|ref|YP_002341694.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis Z2491]
 gi|254805824|ref|YP_003084045.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha14]
 gi|304388931|ref|ZP_07370978.1| ribosomal protein L7/L12 [Neisseria meningitidis ATCC 13091]
 gi|60393725|sp|P0A0X0|RL7_NEIMA RecName: Full=50S ribosomal protein L7/L12
 gi|60393726|sp|P0A0X1|RL7_NEIMB RecName: Full=50S ribosomal protein L7/L12
 gi|166222184|sp|A1KRG5|RL7_NEIMF RecName: Full=50S ribosomal protein L7/L12
 gi|189043002|sp|A9M3X5|RL7_NEIM0 RecName: Full=50S ribosomal protein L7/L12
 gi|7225348|gb|AAF40590.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis MC58]
 gi|120865714|emb|CAM09441.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis FAM18]
 gi|121051190|emb|CAM07461.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis Z2491]
 gi|161596477|gb|ABX74137.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis 053442]
 gi|254669366|emb|CBA08475.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha14]
 gi|254671129|emb|CBA08147.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha153]
 gi|254672708|emb|CBA06635.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha275]
 gi|261391668|emb|CAX49116.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis 8013]
 gi|304337065|gb|EFM03252.1| ribosomal protein L7/L12 [Neisseria meningitidis ATCC 13091]
 gi|308388348|gb|ADO30668.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis alpha710]
 gi|316985973|gb|EFV64912.1| ribosomal protein L7/L12 [Neisseria meningitidis H44/76]
 gi|319411387|emb|CBY91798.1| 50S ribosomal protein L7/L12 [Neisseria meningitidis WUE 2594]
 gi|325127124|gb|EGC50078.1| ribosomal protein L7/L12 [Neisseria meningitidis N1568]
 gi|325131072|gb|EGC53795.1| ribosomal protein L7/L12 [Neisseria meningitidis OX99.30304]
 gi|325135136|gb|EGC57762.1| ribosomal protein L7/L12 [Neisseria meningitidis M13399]
 gi|325137189|gb|EGC59784.1| ribosomal protein L7/L12 [Neisseria meningitidis M0579]
 gi|325141145|gb|EGC63645.1| ribosomal protein L7/L12 [Neisseria meningitidis CU385]
 gi|325143223|gb|EGC65562.1| ribosomal protein L7/L12 [Neisseria meningitidis 961-5945]
 gi|325145328|gb|EGC67605.1| ribosomal protein L7/L12 [Neisseria meningitidis M01-240013]
 gi|325197419|gb|ADY92875.1| ribosomal protein L7/L12 [Neisseria meningitidis G2136]
 gi|325199344|gb|ADY94799.1| ribosomal protein L7/L12 [Neisseria meningitidis H44/76]
 gi|325203035|gb|ADY98489.1| ribosomal protein L7/L12 [Neisseria meningitidis M01-240149]
 gi|325203250|gb|ADY98703.1| ribosomal protein L7/L12 [Neisseria meningitidis M01-240355]
 gi|325205223|gb|ADZ00676.1| ribosomal protein L7/L12 [Neisseria meningitidis M04-240196]
 gi|325207166|gb|ADZ02618.1| ribosomal protein L7/L12 [Neisseria meningitidis NZ-05/33]
          Length = 123

 Score = 84.6 bits (208), Expect = 4e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    + A EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAADAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|52694916|gb|AAU85609.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     IE  +L   +E+++GV+A+         +  +   + E+TEF+V+L  
Sbjct: 6   EDILTWLEGAKTIEVVDLVTAIEEKFGVTAAIAAVGGGAASTGSTD-SEEQTEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|83854990|ref|ZP_00948520.1| ribosomal protein L7/L12 [Sulfitobacter sp. NAS-14.1]
 gi|83941512|ref|ZP_00953974.1| ribosomal protein L7/L12 [Sulfitobacter sp. EE-36]
 gi|83842833|gb|EAP82000.1| ribosomal protein L7/L12 [Sulfitobacter sp. NAS-14.1]
 gi|83847332|gb|EAP85207.1| ribosomal protein L7/L12 [Sulfitobacter sp. EE-36]
          Length = 123

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E +  LTL+EA EL   L+ E+G+  +A  +V+    A+AG+AA EKTEF+V
Sbjct: 1   MADLKKLAEDIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADAGAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA ++K KLE AG
Sbjct: 61  VLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGIDKAEAEDIKAKLEAAG 117

Query: 121 ATVEL 125
           A +EL
Sbjct: 118 AEIEL 122


>gi|67523201|ref|XP_659661.1| hypothetical protein AN2057.2 [Aspergillus nidulans FGSC A4]
 gi|40745733|gb|EAA64889.1| hypothetical protein AN2057.2 [Aspergillus nidulans FGSC A4]
 gi|259487425|tpe|CBF86093.1| TPA: 50S ribosomal protein L12 (AFU_orthologue; AFUA_4G09750)
           [Aspergillus nidulans FGSC A4]
          Length = 184

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 42/136 (30%), Positives = 64/136 (47%), Gaps = 14/136 (10%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I  IV+++S L L+E A+L   L+    +             A A  AA          
Sbjct: 49  KITQIVDQISQLNLLETADLVASLKSRLNIPDLPVGGFAMAPGAGAPGAAAAPAEEEEAA 108

Query: 53  ---SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEA 109
               EKT F + L+   D  +K  VIKEV+ +  L L ++K+ VES PK LK  + K+EA
Sbjct: 109 PPAQEKTLFNLKLESV-DAAQKAKVIKEVKTLLGLSLVDSKKFVESVPKVLKESVPKEEA 167

Query: 110 NEMKKKLEDAGATVEL 125
            ++ + L+  GA   +
Sbjct: 168 EKLIETLKAVGAKAVM 183


>gi|158336009|ref|YP_001517183.1| 50S ribosomal protein L7/L12 [Acaryochloris marina MBIC11017]
 gi|189042978|sp|B0CAD2|RL7_ACAM1 RecName: Full=50S ribosomal protein L7/L12
 gi|158306250|gb|ABW27867.1| 50S ribosomal protein L7/L12 [Acaryochloris marina MBIC11017]
          Length = 129

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 69/130 (53%), Positives = 89/130 (68%), Gaps = 5/130 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KT 56
           MS  E I+EKL SLTL+EAA+L K++E+ +GVSA+    V+       G+A  E    KT
Sbjct: 1   MSATEEILEKLKSLTLLEAADLVKQIEETFGVSAAPAAGVMMAAPGAGGAAGGEEAEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+VVL+      KKIAV+K VR +T LGLKEAKE+VES PKS+K G+SK++A E KK L
Sbjct: 61  EFDVVLEEV-PSDKKIAVLKVVRTLTGLGLKEAKEMVESTPKSIKEGVSKEDAEEAKKSL 119

Query: 117 EDAGATVELR 126
           EDAG    L+
Sbjct: 120 EDAGGKASLK 129


>gi|183979274|dbj|BAG30798.1| similar to CG5012-PA [Papilio xuthus]
          Length = 180

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 45/131 (34%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-------SVVAPVAAEAGSAASEK 55
            IE IV  +++L L+E +EL + L+K   +  +  +       +  A    E  +  + K
Sbjct: 50  KIEKIVADITNLNLLEVSELGQVLKKRLNLPDAPAMPIGGFAMAAPAAQDEEEAAPKAVK 109

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V +  FDD K+K+A+IKEV+++     L +AK+ VES P  +K  +SKDEA ++K+
Sbjct: 110 TSFTVKMTKFDD-KQKVALIKEVKSLLEGFNLVQAKKFVESVPTVVKADISKDEAEKLKE 168

Query: 115 KLEDAGATVEL 125
            L   GA +E+
Sbjct: 169 ALSKVGAVIEI 179


>gi|116748983|ref|YP_845670.1| 50S ribosomal protein L7/L12 [Syntrophobacter fumaroxidans MPOB]
 gi|166990989|sp|A0LII3|RL7_SYNFM RecName: Full=50S ribosomal protein L7/L12
 gi|116698047|gb|ABK17235.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P
           [Syntrophobacter fumaroxidans MPOB]
          Length = 127

 Score = 84.6 bits (208), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 61/123 (49%), Positives = 87/123 (70%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +++ + ++T++E +EL K LE+ +GVSA+APV++ A  A  A +A    +TEF VV+ 
Sbjct: 7   EDVIKFIENMTVLELSELVKELEERFGVSAAAPVAMAAMPAGAAEAAPVAEQTEFSVVIT 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           G     KKI VIKEVRAIT+LGLKEAK+LVE  P  +K  + KDEA  + K+L +AGATV
Sbjct: 67  GV--GDKKIQVIKEVRAITNLGLKEAKDLVEKVPGVVKEAIPKDEAEAIAKQLTEAGATV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EIK 127


>gi|319639541|ref|ZP_07994288.1| 50S ribosomal protein L7/L12 [Neisseria mucosa C102]
 gi|317399112|gb|EFV79786.1| 50S ribosomal protein L7/L12 [Neisseria mucosa C102]
          Length = 123

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAVAVAVAGPAGAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|261364717|ref|ZP_05977600.1| ribosomal protein L7/L12 [Neisseria mucosa ATCC 25996]
 gi|288567013|gb|EFC88573.1| ribosomal protein L7/L12 [Neisseria mucosa ATCC 25996]
          Length = 123

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGGGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|225076432|ref|ZP_03719631.1| hypothetical protein NEIFLAOT_01478 [Neisseria flavescens
           NRL30031/H210]
 gi|241760445|ref|ZP_04758539.1| ribosomal protein L7/L12 [Neisseria flavescens SK114]
 gi|255067808|ref|ZP_05319663.1| ribosomal protein L7/L12 [Neisseria sicca ATCC 29256]
 gi|261378967|ref|ZP_05983540.1| ribosomal protein L7/L12 [Neisseria cinerea ATCC 14685]
 gi|261381385|ref|ZP_05985958.1| ribosomal protein L7/L12 [Neisseria subflava NJ9703]
 gi|298370600|ref|ZP_06981915.1| ribosomal protein L7/L12 [Neisseria sp. oral taxon 014 str. F0314]
 gi|14195171|sp|Q9F5M1|RL7_NEIPE RecName: Full=50S ribosomal protein L7/L12
 gi|11321430|gb|AAG34165.1|AF312973_1 ribosomal protein L7/L12 [Neisseria perflava]
 gi|224952232|gb|EEG33441.1| hypothetical protein NEIFLAOT_01478 [Neisseria flavescens
           NRL30031/H210]
 gi|241319114|gb|EER55607.1| ribosomal protein L7/L12 [Neisseria flavescens SK114]
 gi|255047899|gb|EET43363.1| ribosomal protein L7/L12 [Neisseria sicca ATCC 29256]
 gi|269144582|gb|EEZ71000.1| ribosomal protein L7/L12 [Neisseria cinerea ATCC 14685]
 gi|284795632|gb|EFC50979.1| ribosomal protein L7/L12 [Neisseria subflava NJ9703]
 gi|298281210|gb|EFI22700.1| ribosomal protein L7/L12 [Neisseria sp. oral taxon 014 str. F0314]
          Length = 123

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|91215207|ref|ZP_01252179.1| 50S ribosomal protein L7/L12 [Psychroflexus torquis ATCC 700755]
 gi|91186812|gb|EAS73183.1| 50S ribosomal protein L7/L12 [Psychroflexus torquis ATCC 700755]
          Length = 123

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 80/126 (63%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+ ++   E+L +LT+ E  EL+  L+ E+G+  +A   VV    A       E+TEF+V
Sbjct: 1   MAELKDFAEQLVNLTVKEVNELADILKDEYGIEPAAAPVVVG-GGAAGAEEVEEQTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLK+AK LV+SAP  +K  +SKDEA  +K +LE+AG
Sbjct: 60  ILKA--PGGSKLAVVKLVKELTGLGLKDAKGLVDSAPAPVKEAVSKDEAEALKAQLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AEVELK 123


>gi|74316415|ref|YP_314155.1| 50S ribosomal protein L7/L12 [Thiobacillus denitrificans ATCC
           25259]
 gi|109893815|sp|Q3SLQ7|RL7_THIDA RecName: Full=50S ribosomal protein L7/L12
 gi|74055910|gb|AAZ96350.1| Ribosomal protein L7/L12 [Thiobacillus denitrificans ATCC 25259]
          Length = 127

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 56/121 (46%), Positives = 88/121 (72%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            I++ ++ +T++E +EL K +E ++GVSA+A    VA  AA AG+AA+ + + E  +   
Sbjct: 7   DILDAIAGMTVLELSELIKEMEDKFGVSAAAAAVAVAAPAAGAGAAAAAEEQTEFTVMLN 66

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
              +KK+ VIK VRA T LGLKEAK+LV+ APK++K G+SK +A+ +KK+LE+AGA+VE+
Sbjct: 67  SAGEKKVEVIKVVRAATGLGLKEAKDLVDGAPKAVKEGVSKADADALKKQLEEAGASVEV 126

Query: 126 R 126
           +
Sbjct: 127 K 127


>gi|153805949|ref|ZP_01958617.1| hypothetical protein BACCAC_00194 [Bacteroides caccae ATCC 43185]
 gi|160883074|ref|ZP_02064077.1| hypothetical protein BACOVA_01037 [Bacteroides ovatus ATCC 8483]
 gi|237717391|ref|ZP_04547872.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D1]
 gi|237718751|ref|ZP_04549232.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_2_4]
 gi|255692642|ref|ZP_05416317.1| ribosomal protein L7/L12 [Bacteroides finegoldii DSM 17565]
 gi|260175408|ref|ZP_05761820.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D2]
 gi|262406156|ref|ZP_06082706.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_22]
 gi|293372127|ref|ZP_06618518.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CMC 3f]
 gi|294644051|ref|ZP_06721828.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CC 2a]
 gi|294810203|ref|ZP_06768870.1| ribosomal protein L7/L12 [Bacteroides xylanisolvens SD CC 1b]
 gi|298483056|ref|ZP_07001237.1| ribosomal protein L7/L12 [Bacteroides sp. D22]
 gi|299144631|ref|ZP_07037699.1| ribosomal protein L7/L12 [Bacteroides sp. 3_1_23]
 gi|315923638|ref|ZP_07919878.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|149130626|gb|EDM21832.1| hypothetical protein BACCAC_00194 [Bacteroides caccae ATCC 43185]
 gi|156111546|gb|EDO13291.1| hypothetical protein BACOVA_01037 [Bacteroides ovatus ATCC 8483]
 gi|229443374|gb|EEO49165.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D1]
 gi|229451883|gb|EEO57674.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 2_2_4]
 gi|260621618|gb|EEX44489.1| ribosomal protein L7/L12 [Bacteroides finegoldii DSM 17565]
 gi|262357031|gb|EEZ06121.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_22]
 gi|292632919|gb|EFF51506.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CMC 3f]
 gi|292640575|gb|EFF58816.1| ribosomal protein L7/L12 [Bacteroides ovatus SD CC 2a]
 gi|294442615|gb|EFG11415.1| ribosomal protein L7/L12 [Bacteroides xylanisolvens SD CC 1b]
 gi|295085436|emb|CBK66959.1| LSU ribosomal protein L12P [Bacteroides xylanisolvens XB1A]
 gi|298270800|gb|EFI12380.1| ribosomal protein L7/L12 [Bacteroides sp. D22]
 gi|298515122|gb|EFI39003.1| ribosomal protein L7/L12 [Bacteroides sp. 3_1_23]
 gi|313697513|gb|EFS34348.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 124

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       K+ V+K V+    LGLKEAK+LV+ AP ++K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKS--AGAAKLQVVKAVKEACGLGLKEAKDLVDGAPSTVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|282857089|ref|ZP_06266335.1| ribosomal protein L7/L12 [Pyramidobacter piscolens W5455]
 gi|282585024|gb|EFB90346.1| ribosomal protein L7/L12 [Pyramidobacter piscolens W5455]
          Length = 125

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 49/125 (39%), Positives = 81/125 (64%), Gaps = 1/125 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+  + I+  + S+++++ A+L K LE+++GVSA+APV + A  AA   +A + + + E 
Sbjct: 1   MTK-DEIISAIESMSVLDLADLVKALEEKFGVSAAAPVMMAAGAAAPGAAAPAAEEKTEF 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +   +K+ VIK VR +T LGLK+AK+ VE+  K +K GLSK++A  + K+ E  G
Sbjct: 60  DVVLKEVGAQKLQVIKVVREVTGLGLKDAKDFVENPGKPIKEGLSKEDAEALVKQFEGTG 119

Query: 121 ATVEL 125
           ATV L
Sbjct: 120 ATVVL 124


>gi|283955899|ref|ZP_06373389.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 1336]
 gi|283792559|gb|EFC31338.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 1336]
          Length = 125

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +         A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAATGGAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|86151568|ref|ZP_01069782.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|121613176|ref|YP_001000184.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|148925856|ref|ZP_01809543.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157414770|ref|YP_001482026.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81116]
 gi|167005142|ref|ZP_02270900.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|315124020|ref|YP_004066024.1| hypothetical protein ICDCCJ07001_440 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|166222154|sp|A1VYJ3|RL7_CAMJJ RecName: Full=50S ribosomal protein L7/L12
 gi|172047074|sp|A8FKR2|RL7_CAMJ8 RecName: Full=50S ribosomal protein L7/L12
 gi|85841197|gb|EAQ58445.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           260.94]
 gi|87250007|gb|EAQ72965.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|107784840|gb|ABF83911.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. doylei]
 gi|145844842|gb|EDK21946.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8486]
 gi|157385734|gb|ABV52049.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 81116]
 gi|307747409|gb|ADN90679.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           M1]
 gi|315017742|gb|ADT65835.1| hypothetical protein ICDCCJ07001_440 [Campylobacter jejuni subsp.
           jejuni ICDCCJ07001]
 gi|315931082|gb|EFV10056.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 327]
          Length = 125

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAAAGGAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|58038862|ref|YP_190826.1| 50S ribosomal protein L7/L12 [Gluconobacter oxydans 621H]
 gi|81557180|sp|Q5FTX6|RL7_GLUOX RecName: Full=50S ribosomal protein L7/L12
 gi|58001276|gb|AAW60170.1| LSU ribosomal protein L12P (L7/L12) [Gluconobacter oxydans 621H]
          Length = 125

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 79/127 (62%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IVE+LS+LT++EAAELSK LE++WGVSA+APV+V A  A  A +A   E+TEF 
Sbjct: 1   MADLAKIVEELSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAAAGGAAAAPAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D   KKI VIKEVR IT LGLKEAK+LVE APK++K G SKDEA ++KK LEDA
Sbjct: 61  VVLA--DAGDKKINVIKEVRGITGLGLKEAKDLVEGAPKTVKEGASKDEAAKIKKALEDA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEVK 125


>gi|205372079|ref|ZP_03224896.1| 50S ribosomal protein L7/L12 [Bacillus coahuilensis m4-4]
          Length = 121

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 90/122 (73%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E  +L K +E+E+GV+A+APV+V+    A  G AA+E+TEF++VL+ 
Sbjct: 4   EQIIDAIKEMTVLELNDLVKAIEEEFGVTAAAPVAVM--GGAAGGDAAAEQTEFDLVLES 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAKELV++ PK+LK G++K+EA E+K KLE+ GA VE
Sbjct: 62  --AGASKIKVIKVVREITGLGLKEAKELVDNTPKALKEGIAKEEAEELKAKLEEVGAVVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|294790460|ref|ZP_06755618.1| ribosomal protein L7/L12 [Scardovia inopinata F0304]
 gi|294458357|gb|EFG26710.1| ribosomal protein L7/L12 [Scardovia inopinata F0304]
          Length = 126

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 86/128 (67%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + +++    +TL+E ++  K+ E+E+ V A+APV+ VA   A AG+A  E+TEF
Sbjct: 1   MAKLSTDELLDAFKEMTLVELSDFVKKFEEEFDVEAAAPVAAVAAAPAAAGAAEEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL       KKI VIK VRA+T LGL EAK LV+ AP ++   +SK++A++ K  LE+
Sbjct: 61  TVVLSAI--GDKKIQVIKAVRALTSLGLAEAKALVDGAPANVLENVSKEDADKAKASLEE 118

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 119 AGATVELK 126


>gi|309812284|ref|ZP_07706039.1| ribosomal protein L7/L12 [Dermacoccus sp. Ellin185]
 gi|308433589|gb|EFP57466.1| ribosomal protein L7/L12 [Dermacoccus sp. Ellin185]
          Length = 128

 Score = 84.2 bits (207), Expect = 5e-15,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 81/128 (63%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + ++E    +TLIE +E     E  + V+A+APV+  A  AA  G A + + + 
Sbjct: 1   MAKLSNDELLEAFKEMTLIELSEFVTLFEDTFNVTAAAPVAAAAAPAAGGGDAGAAEEKS 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +       KKI VIKEVRA+T LGLKEAK+LV+ APK +  G++KD A++ K+ LE 
Sbjct: 61  EFDVILASAGDKKIQVIKEVRALTSLGLKEAKDLVDGAPKPVLEGVAKDAADKAKEALEG 120

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 121 AGATVEVK 128


>gi|326495080|dbj|BAJ85636.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326511068|dbj|BAJ91881.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 176

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 75/126 (59%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFE 59
            +  + + ++ LTL EA  L   L++  GVSA++     A  A  A +A      KTEF+
Sbjct: 51  KVLELGDAIAGLTLEEARNLVDHLQERLGVSAASFAPAAAVAAPAAAAAEEAPVEKTEFD 110

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VV++       +IA IK VRA+T+L LKEAK+L+E  PK LK  +SKDEA E KK+LE  
Sbjct: 111 VVIEEV-PSSARIATIKVVRALTNLALKEAKDLIEGLPKKLKEAVSKDEAEEAKKQLEGV 169

Query: 120 GATVEL 125
           GA V +
Sbjct: 170 GAKVSI 175


>gi|291613228|ref|YP_003523385.1| ribosomal protein L7/L12 [Sideroxydans lithotrophicus ES-1]
 gi|291583340|gb|ADE10998.1| ribosomal protein L7/L12 [Sideroxydans lithotrophicus ES-1]
          Length = 126

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 57/125 (45%), Positives = 87/125 (69%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVV 61
           + ++ +  L S++++E  EL K +E+++GVSA+A  +  A  AA  G+AA+ E+TEF V 
Sbjct: 4   DKDAFLAALDSMSVLELNELVKAVEEKFGVSAAAMAAPAAGGAAAGGAAAAAEQTEFTVT 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK      +K+ VIK VR IT LGLKEAK+LV+ APK +K G+SK +A+ + K+L +AGA
Sbjct: 64  LKS--AGDQKVNVIKVVRTITGLGLKEAKDLVDGAPKVVKEGISKADADAIAKQLIEAGA 121

Query: 122 TVELR 126
           T E++
Sbjct: 122 TAEVK 126


>gi|213963187|ref|ZP_03391445.1| ribosomal protein L7/L12 [Capnocytophaga sputigena Capno]
 gi|213954271|gb|EEB65595.1| ribosomal protein L7/L12 [Capnocytophaga sputigena Capno]
          Length = 126

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L++E+G+  +A    VA   A  G+  +   + E 
Sbjct: 1   MADLKNFAEQLVNLTVKEVNELAQILKEEYGIEPAAAAVAVAAGPAAGGAGEAAAEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK+EA  +KK LE+AG
Sbjct: 61  DVFLKSAGANKLAVVKLVKDLTGLGLKEAKEVVDGAPSKVKEGVSKEEAEGLKKSLEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|153805629|ref|YP_001382214.1| ribosomal protein L12 [Leptosira terrestris]
 gi|134270160|gb|ABO69349.1| ribosomal protein L12 [Leptosira terrestris]
          Length = 133

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 79/127 (62%), Gaps = 8/127 (6%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-------APVAAEAGSAASEKTEF 58
            I+EKL S+TL+EAAEL   +EK +GV ASAPV+             A+A     EKT F
Sbjct: 7   EIIEKLKSMTLVEAAELVAEIEKTFGVDASAPVAGGFIGGPSFGAENAQATEVVEEKTTF 66

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+   D  K++ V+K +R +T+LGLKEAKE   S PK +K  +SK+EA   K++LE 
Sbjct: 67  DVILEQIPD-DKRVPVLKVIRTLTNLGLKEAKEFTTSLPKKIKESVSKEEAETAKQELEK 125

Query: 119 AGATVEL 125
           AG  V +
Sbjct: 126 AGGKVTI 132


>gi|72163054|ref|YP_290711.1| 50S ribosomal protein L7/L12 [Thermobifida fusca YX]
 gi|109893813|sp|Q47LI4|RL7_THEFY RecName: Full=50S ribosomal protein L7/L12
 gi|71916786|gb|AAZ56688.1| LSU ribosomal protein L12P [Thermobifida fusca YX]
          Length = 130

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 56/132 (42%), Positives = 84/132 (63%), Gaps = 8/132 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           M+ +  E ++     +TL+E +E  K  E+++ V+A+AP +VVA   A  G   +     
Sbjct: 1   MAKLSHEELLSAFEEMTLLELSEFVKLFEEKFDVTAAAPAAVVAAAPAGGGGGEAAVEEE 60

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           K EF+V+L+      KKI VIKEVR +T+LGLK+AK+LV+SAPK +  G++K+ A + K 
Sbjct: 61  KDEFDVILES--AGDKKIQVIKEVRGLTNLGLKDAKDLVDSAPKPVLEGVNKETAEKAKA 118

Query: 115 KLEDAGATVELR 126
            LE AGATV L+
Sbjct: 119 ALEGAGATVTLK 130


>gi|146422252|ref|XP_001487067.1| hypothetical protein PGUG_00444 [Meyerozyma guilliermondii ATCC
           6260]
 gi|146388188|gb|EDK36346.1| hypothetical protein PGUG_00444 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 176

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 51/131 (38%), Positives = 76/131 (58%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------- 55
            I SIV+++S+LTL+E + L   L+    +S  A  +  A   A A + A E+       
Sbjct: 46  KISSIVDQISTLTLLETSSLVSELKTRLNISDIALPAAGAAAPAAAAAPAEEEVKEEVEE 105

Query: 56  -TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
            T F + L+ F DPK K  VIKEV+++  L L E+K+ VE+APK LK  ++K++A ++K 
Sbjct: 106 KTIFAIKLESF-DPKSKPKVIKEVKSMLGLSLVESKKFVEAAPKVLKDNVAKEDAEKIKS 164

Query: 115 KLEDAGATVEL 125
            LE  GA V L
Sbjct: 165 TLEALGAKVVL 175


>gi|153951978|ref|YP_001398486.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. doylei
           269.97]
 gi|166222153|sp|A7H4Q6|RL7_CAMJD RecName: Full=50S ribosomal protein L7/L12
 gi|152939424|gb|ABS44165.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. doylei
           269.97]
          Length = 125

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA   +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAVPVMVAGGAAAGGAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|259047733|ref|ZP_05738134.1| ribosomal protein L7/L12 [Granulicatella adiacens ATCC 49175]
 gi|259035924|gb|EEW37179.1| ribosomal protein L7/L12 [Granulicatella adiacens ATCC 49175]
          Length = 122

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   T++E  +L K +E+E+GV+A+APV+VV   A  AG AA EKT+F V L
Sbjct: 4   NIEQIIADIKEATVLELNDLVKAIEEEFGVTAAAPVAVV---AGGAGEAAEEKTDFTVEL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR  T LGLKEAK LV+ AP  LK G++K+EA  +K +LE+ GA+
Sbjct: 61  TS--AGDQKIKVIKVVREATGLGLKEAKALVDGAPGVLKEGVAKEEAEALKAQLEEVGAS 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|86134001|ref|ZP_01052583.1| 50S ribosomal protein L7/L12 [Polaribacter sp. MED152]
 gi|85820864|gb|EAQ42011.1| 50S ribosomal protein L7/L12 [Polaribacter sp. MED152]
          Length = 125

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+ ++   E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA  G  A  E+TEF+
Sbjct: 1   MAELKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVAVAGPAAGGGDDAADEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L        K+AV+K V+ +T LGLK+AK +V+SAP  +K G+SKDEA  +KK LE+A
Sbjct: 61  VILTA--AGASKLAVVKLVKELTGLGLKDAKGIVDSAPAPIKEGVSKDEAEGLKKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|289548399|ref|YP_003473387.1| ribosomal protein L7/L12 [Thermocrinis albus DSM 14484]
 gi|289182016|gb|ADC89260.1| ribosomal protein L7/L12 [Thermocrinis albus DSM 14484]
          Length = 130

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 68/127 (53%), Positives = 91/127 (71%), Gaps = 6/127 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKTEFE 59
           I+ IVE + ++TL+E AEL K+LE+++GVSASA V+    VAA A +A      EKTEF+
Sbjct: 6   IDEIVEAIGNMTLLEVAELVKKLEEKFGVSASAMVAAAPAVAAGAPAAGAPAAEEKTEFD 65

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       KI VIK VR IT LGLKEAK+LVE APK +K G+SK+EA ++ +KL +A
Sbjct: 66  VILKS--AGANKINVIKVVREITGLGLKEAKDLVEGAPKPVKEGVSKEEAEKIAQKLREA 123

Query: 120 GATVELR 126
           GA VE++
Sbjct: 124 GAEVEIK 130


>gi|59802173|ref|YP_208885.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA 1090]
 gi|194099907|ref|YP_002003044.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae NCCP11945]
 gi|239997912|ref|ZP_04717836.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 35/02]
 gi|240015109|ref|ZP_04722022.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI18]
 gi|240017558|ref|ZP_04724098.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA6140]
 gi|240081701|ref|ZP_04726244.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA19]
 gi|240113977|ref|ZP_04728467.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae MS11]
 gi|240116713|ref|ZP_04730775.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID18]
 gi|240118935|ref|ZP_04732997.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID1]
 gi|240122180|ref|ZP_04735142.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID24-1]
 gi|240124473|ref|ZP_04737429.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID332]
 gi|240124659|ref|ZP_04737545.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-92-679]
 gi|240129147|ref|ZP_04741808.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-93-1035]
 gi|254494733|ref|ZP_05107904.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 1291]
 gi|260439528|ref|ZP_05793344.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI2]
 gi|268593763|ref|ZP_06127930.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 35/02]
 gi|268597798|ref|ZP_06131965.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA19]
 gi|268600041|ref|ZP_06134208.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae MS11]
 gi|268602383|ref|ZP_06136550.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID18]
 gi|268604645|ref|ZP_06138812.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID1]
 gi|268683103|ref|ZP_06149965.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID332]
 gi|268683234|ref|ZP_06150096.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-92-679]
 gi|268687530|ref|ZP_06154392.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-93-1035]
 gi|291042764|ref|ZP_06568505.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI2]
 gi|293398216|ref|ZP_06642421.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae F62]
 gi|75432354|sp|Q5F5R4|RL7_NEIG1 RecName: Full=50S ribosomal protein L7/L12
 gi|226733712|sp|B4RQW1|RL7_NEIG2 RecName: Full=50S ribosomal protein L7/L12
 gi|59719068|gb|AAW90473.1| putative 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA
           1090]
 gi|193935197|gb|ACF31021.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae NCCP11945]
 gi|226513773|gb|EEH63118.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 1291]
 gi|268547152|gb|EEZ42570.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae 35/02]
 gi|268551586|gb|EEZ46605.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae FA19]
 gi|268584172|gb|EEZ48848.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae MS11]
 gi|268586514|gb|EEZ51190.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID18]
 gi|268588776|gb|EEZ53452.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID1]
 gi|268623387|gb|EEZ55787.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae PID332]
 gi|268623518|gb|EEZ55918.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-92-679]
 gi|268627814|gb|EEZ60214.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae SK-93-1035]
 gi|291013198|gb|EFE05164.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae DGI2]
 gi|291611479|gb|EFF40549.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae F62]
 gi|317165364|gb|ADV08905.1| 50S ribosomal protein L7/L12 [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 123

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 82/122 (67%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    + A EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAADAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK++K G+SK EA +++K+LE AGA VE
Sbjct: 64  --AGDQKVGVIKVVRAITGLGLKEAKDIVDGAPKTIKEGVSKAEAEDIQKQLEAAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|254282147|ref|ZP_04957115.1| ribosomal protein L7/L12 [gamma proteobacterium NOR51-B]
 gi|219678350|gb|EED34699.1| ribosomal protein L7/L12 [gamma proteobacterium NOR51-B]
          Length = 126

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 55/123 (44%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           + I++ ++ +++++   L + +E+++GV+A+A V+       +AG  A+ EK EF+VVL 
Sbjct: 6   DEILDAIAEMSVMDIVSLIEAMEEKFGVTAAAAVAAAPAAGGDAGGEAAAEKDEFDVVLT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                +KK+ VIK VRAIT LGLKEAK LV+ AP  +K G SKDEA ++KK+LE+AG +V
Sbjct: 66  A--AGEKKVNVIKVVRAITGLGLKEAKGLVDGAPSPIKEGASKDEAEDIKKQLEEAGGSV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|14195176|sp|Q9L5W4|RL7_LIBAC RecName: Full=50S ribosomal protein L7/L12
 gi|7716607|gb|AAF68453.1| RplL [Candidatus Liberibacter africanus subsp. capensis]
          Length = 124

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 94/126 (74%), Positives = 107/126 (84%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+IESIVEKLSSLTLI+AAELSKRLE+EWGVSASAPV+ VAP      + A  KTEFEV
Sbjct: 1   MSDIESIVEKLSSLTLIQAAELSKRLEEEWGVSASAPVAAVAPAVXXDVAVAE-KTEFEV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L+ F D K KI+VIKEVR+ITDLGLKEAKELVE+  KSL+TG+SKDEANE+KKKLE AG
Sbjct: 60  FLESF-DAKSKISVIKEVRSITDLGLKEAKELVEALLKSLRTGVSKDEANELKKKLEAAG 118

Query: 121 ATVELR 126
           AT+ LR
Sbjct: 119 ATISLR 124


>gi|78776553|ref|YP_392868.1| 50S ribosomal protein L7/L12 [Sulfurimonas denitrificans DSM 1251]
 gi|109893816|sp|Q30TP8|RL7_SULDN RecName: Full=50S ribosomal protein L7/L12
 gi|78497093|gb|ABB43633.1| LSU ribosomal protein L12P [Sulfurimonas denitrificans DSM 1251]
          Length = 122

 Score = 84.2 bits (207), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 78/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E +S L+++E +EL K  E+++GVSA           A A  A  E+TEF V++  
Sbjct: 6   QDVLEFISGLSVLELSELVKEFEEKFGVSAQPVAVA---GGAVAAVAVEEQTEFNVIIT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+  E+ P ++K G+ K+ A   KK+LE+AGA VE
Sbjct: 62  -DAGDKKINVIKVVRALTGLGLKEAKDATENVPSTIKEGVDKETAMNAKKELEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|312622253|ref|YP_004023866.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312202720|gb|ADQ46047.1| ribosomal protein L7/L12 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 129

 Score = 83.8 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 67/127 (52%), Positives = 93/127 (73%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFE 59
            ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A +AA    EKTEF 
Sbjct: 5   KVQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQAAAPAAEEKTEFN 64

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIK VR IT LGLKEAK+LV+SAPK +K  +SKDEA ++KKKLE+ 
Sbjct: 65  VILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDSAPKPIKENVSKDEAEQIKKKLEEV 122

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 123 GAKVELK 129


>gi|114053275|ref|NP_001040523.1| mitochondrial ribosomal protein L12 precursor [Bombyx mori]
 gi|95102806|gb|ABF51344.1| 60S ribosomal protein L7/l12 precursor [Bombyx mori]
          Length = 179

 Score = 83.8 bits (206), Expect = 6e-15,   Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-------ASEK 55
            IE IV ++++L L+E +ELS+ L+K   +  +  + +     A A +         + K
Sbjct: 49  KIEKIVFEITNLNLLEVSELSQVLKKRLNLPDAPIMPMGGFAMAPAAAVDEEEAAPKAVK 108

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V +  FDD K+K+A+IKEV+ +     L +AK+ VES P  +K  +SKDEA ++K+
Sbjct: 109 TSFTVKMTKFDD-KQKVALIKEVKGLLEGFNLVQAKKFVESVPTVVKADISKDEAEKLKE 167

Query: 115 KLEDAGATVEL 125
            L   GA +E+
Sbjct: 168 ALTKVGAIIEI 178


>gi|18314326|sp|P02397|RL7_RHOSH RecName: Full=50S ribosomal protein L7/L12; Short=RA
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 1/126 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  + E +  LTL+EA EL   L+ ++G+  +A  +V+    A   +A +E+ + E 
Sbjct: 1   MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGPAAGAAAPAEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K  ++K +A  MKKKLE+AG
Sbjct: 61  DVGLTDAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAVAKADAEAMKKKLEEAG 119

Query: 121 ATVELR 126
           A VEL+
Sbjct: 120 AKVELK 125


>gi|320581589|gb|EFW95809.1| 60S ribosomal protein L7/L12 [Pichia angusta DL-1]
          Length = 174

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 50/133 (37%), Positives = 74/133 (55%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA----------SAPVSVVAPVAAEAGSAA 52
            I  IV+++S+LTL+E + L + L+ +  +             AP +     AAEA    
Sbjct: 42  KIAQIVDQISTLTLLETSYLIQELKSKLNIPDIAFPAAGAAAPAPAAAAEAEAAEAKEEV 101

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F V L+ F D K K  +IKEV+++  L L E+K+ VE APK +K  +SK++A +M
Sbjct: 102 QEKTIFNVKLESF-DAKAKPKIIKEVKSLLGLSLVESKKFVEGAPKVIKENVSKEDAEQM 160

Query: 113 KKKLEDAGATVEL 125
           K  LE  GA + L
Sbjct: 161 KATLEGLGAKIVL 173


>gi|327404145|ref|YP_004344983.1| 50S ribosomal protein L12P [Fluviicola taffensis DSM 16823]
 gi|327319653|gb|AEA44145.1| LSU ribosomal protein L12P [Fluviicola taffensis DSM 16823]
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 52/127 (40%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ I E L +LT+ E  EL+  L+ E+G+  +A  +V+          A+  +TEF+
Sbjct: 1   MADLKQIAETLVNLTVKEVNELATILKDEYGIEPAAAAAVMVAGGGAGAGEAAAEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T  GLKE+K+LV+ AP +LK G+SKDEA  +K +LE+A
Sbjct: 61  VILKA--GGANKLAVVKLVKELTGNGLKESKDLVDGAPATLKEGVSKDEAAALKTQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAEVEIK 125


>gi|126663351|ref|ZP_01734349.1| 50S ribosomal protein L7/L12 [Flavobacteria bacterium BAL38]
 gi|126625009|gb|EAZ95699.1| 50S ribosomal protein L7/L12 [Flavobacteria bacterium BAL38]
          Length = 123

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 88/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A   VVA    +AG+AA  +TEF V
Sbjct: 1   MADLKQFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVVVAAGGGDAGAAAE-QTEFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK  +    K+ V+K V+ +T LGLKEAK+LV++AP ++K G+SKDEA  +KK LE+AG
Sbjct: 60  VLK--EAGASKLGVVKAVKELTGLGLKEAKDLVDAAPTNVKEGVSKDEAEGLKKALEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AVVELK 123


>gi|302871677|ref|YP_003840313.1| ribosomal protein L7/L12 [Caldicellulosiruptor obsidiansis OB47]
 gi|312135323|ref|YP_004002661.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor owensensis OL]
 gi|312793741|ref|YP_004026664.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312876860|ref|ZP_07736837.1| ribosomal protein L7/L12 [Caldicellulosiruptor lactoaceticus 6A]
 gi|302574536|gb|ADL42327.1| ribosomal protein L7/L12 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775374|gb|ADQ04861.1| ribosomal protein L7/L12 [Caldicellulosiruptor owensensis OL]
 gi|311796375|gb|EFR12727.1| ribosomal protein L7/L12 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180881|gb|ADQ41051.1| ribosomal protein L7/L12 [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 129

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 92/127 (72%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFE 59
            ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A +AA    EKTEF 
Sbjct: 5   KVQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQAAAPAAEEKTEFN 64

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA ++KKKLE+ 
Sbjct: 65  VILA--DAGSDKIKVIKVVREITGLGLKEAKDLVDGAPKPIKENVSKEEAEQIKKKLEEV 122

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 123 GAKVELK 129


>gi|311693263|gb|ADP96136.1| ribosomal protein L7/L12 [marine bacterium HP15]
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++   L + +E+++GVSA+A V+     A    +AA E+TEF+VVL G
Sbjct: 6   EDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAAAPAAAGGGEAAAEEQTEFDVVLTG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VR +T LGLKEAKE+V+SAP  +K   SKD+A E KKKLE+AGA+VE
Sbjct: 66  --PGEKKVNVIKAVRELTGLGLKEAKEMVDSAPSVIKEAASKDDAEEAKKKLEEAGASVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|149376694|ref|ZP_01894453.1| ribosomal protein L7/L12 [Marinobacter algicola DG893]
 gi|149359067|gb|EDM47532.1| ribosomal protein L7/L12 [Marinobacter algicola DG893]
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++   L + +E+++GVSA+A V+     A    +AA E+TEF+VVL G
Sbjct: 6   EDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAAAPAAAGGEAAAAEEQTEFDVVLTG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VR +T LGLKEAKE+V+SAP  +K   SKD+A E KKKLE+AGA+VE
Sbjct: 66  --PGEKKVNVIKAVRELTGLGLKEAKEMVDSAPSVIKEAASKDDAEEAKKKLEEAGASVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|30468132|ref|NP_849019.1| ribosomal protein L12 [Cyanidioschyzon merolae strain 10D]
 gi|68053206|sp|Q85G10|RK12_CYAME RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|30409232|dbj|BAC76181.1| 50S ribosomal protein L12 [Cyanidioschyzon merolae strain 10D]
          Length = 124

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           + I S++E++ SLTL+EAAEL K++E  +G+ ASA  +     A +  +   EKTEF +V
Sbjct: 3   TKINSLLEEIKSLTLLEAAELVKQMETTFGIDASAVATAA--PAVQVETKKEEKTEFALV 60

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L       KKI V+K VR IT LGLKEAKELV+S PK+LK GLS  EA ++K +L +AGA
Sbjct: 61  LSQV-PADKKINVLKVVRTITGLGLKEAKELVDSVPKTLKEGLSASEAEQLKTQLTEAGA 119

Query: 122 TVELR 126
            VEL+
Sbjct: 120 QVELK 124


>gi|39997955|ref|NP_953906.1| 50S ribosomal protein L7/L12 [Geobacter sulfurreducens PCA]
 gi|81701324|sp|Q748Y5|RL7_GEOSL RecName: Full=50S ribosomal protein L7/L12
 gi|39984900|gb|AAR36256.1| ribosomal protein L7/L12 [Geobacter sulfurreducens PCA]
 gi|298506896|gb|ADI85619.1| ribosomal protein L7/L12 [Geobacter sulfurreducens KN400]
          Length = 127

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLKG 64
            ++  + ++T++E AEL K LE ++GVSA+APV+V A  A  A + A+ EKTEF+V+LK 
Sbjct: 8   DVISFIENMTVLELAELVKELEDKFGVSAAAPVAVAAAAAPAAAAEAAEEKTEFDVILKS 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VRA+T LGLKEAK+LV+ APK +K G+SK+EA E KK+L ++GA VE
Sbjct: 68  --AGANKIGVIKVVRALTGLGLKEAKDLVDGAPKPVKNGVSKEEAEEAKKQLVESGAEVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|1587848|prf||2207312A 3alpha hydroxysteroid dehydrogenase
          Length = 231

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 50/120 (41%), Positives = 72/120 (60%), Gaps = 4/120 (3%)

Query: 1   MS-NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFE 59
           M+ + ++ +  L S+T++E  +L K +E+++GV      S     AA   +A  EKTEF 
Sbjct: 111 MAFDKDAFLTALDSMTVLELNDLVKAIEEKFGVRRCYGCSAAG-GAAGGAAAVEEKTEFN 169

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    K++VIK VR IT LGLKEAK+LV+ APK++K    K +A    KKL +A
Sbjct: 170 VVLT--DAGANKVSVIKAVREITGLGLKEAKDLVDGAPKTVKEAAPKADAEAAVKKLVEA 227


>gi|296810346|ref|XP_002845511.1| 54S ribosomal protein L12 [Arthroderma otae CBS 113480]
 gi|238842899|gb|EEQ32561.1| 54S ribosomal protein L12 [Arthroderma otae CBS 113480]
          Length = 192

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I  IV+++S LTL+E A+L   L+    +         A     A + A          
Sbjct: 58  KITKIVDQISQLTLLETADLVASLKTRLNIPDLPVGGFAAAAPGGAAAPAAAVEEEEAAP 117

Query: 53  --SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
              EKT F + L+ F D   K  +IKEV+++  L L E+K+ VES PK +K  + K+EA 
Sbjct: 118 AAQEKTLFNLKLESF-DAASKAKIIKEVKSMLGLSLVESKKFVESVPKVIKESVPKEEAE 176

Query: 111 EMKKKLEDAGATVEL 125
           ++   L+  GA   +
Sbjct: 177 KIVATLKALGAVASM 191


>gi|255079016|ref|XP_002503088.1| predicted protein [Micromonas sp. RCC299]
 gi|226518354|gb|ACO64346.1| predicted protein [Micromonas sp. RCC299]
          Length = 231

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 54/133 (40%), Positives = 76/133 (57%), Gaps = 14/133 (10%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----------- 54
            + + +  LTL+E  +L++ L+K  G++A   + +        G+AA+            
Sbjct: 99  RLADDICGLTLLEVHDLTEILKKRLGLAAMPMMGMPMGGVPMGGAAAAGGAAAAAPEEAA 158

Query: 55  --KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
             KTEF+V L  F D   KI VIKEVRAIT+LGLKEAK+LVE AP  LK G+ K+EA  +
Sbjct: 159 AEKTEFDVKLASF-DAASKIKVIKEVRAITELGLKEAKDLVEGAPAVLKKGIKKEEAEAI 217

Query: 113 KKKLEDAGATVEL 125
           K+KL   G  V +
Sbjct: 218 KEKLAKVGGVVTV 230


>gi|78221838|ref|YP_383585.1| 50S ribosomal protein L7/L12 [Geobacter metallireducens GS-15]
 gi|109893765|sp|Q39Y14|RL7_GEOMG RecName: Full=50S ribosomal protein L7/L12
 gi|78193093|gb|ABB30860.1| LSU ribosomal protein L12P [Geobacter metallireducens GS-15]
          Length = 127

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 92/122 (75%), Gaps = 3/122 (2%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLKG 64
            +V  + ++T++E +EL K LE+++GVSA+APV+V A  A  A + A+ EKTEF+++LK 
Sbjct: 8   DVVSFIENMTVLELSELVKELEEKFGVSAAAPVAVAAAAAPAAAAEAAEEKTEFDIILKS 67

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VRA+T LGLKEAK+LV+ APKS+KTG+SK+EA + KK+L ++GA VE
Sbjct: 68  --AGANKIGVIKVVRALTGLGLKEAKDLVDGAPKSVKTGVSKEEAEDAKKQLVESGAEVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|172035139|ref|YP_001801640.1| 50S ribosomal protein L7/L12 [Cyanothece sp. ATCC 51142]
 gi|254806367|sp|B1X073|RL7_CYAA5 RecName: Full=50S ribosomal protein L7/L12
 gi|171696593|gb|ACB49574.1| 50S ribosomal protein L7/L12 [Cyanothece sp. ATCC 51142]
          Length = 133

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 89/132 (67%), Gaps = 8/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-------VSVVAPVAAEAGSAASE 54
           +  + I+EKL SLTL+EA+EL K++E+ +GVSA+AP           A   A A     E
Sbjct: 3   AATDEILEKLKSLTLLEASELVKQIEEAFGVSAAAPSGGMMMMAPGAAAPGAAAAEPEEE 62

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L+      KKIA++K VR IT LGLKEAK++VES PK +K G  K++A ++KK
Sbjct: 63  KTEFDVILEEV-PGDKKIAILKVVRGITGLGLKEAKDMVESTPKPIKEGTGKEDAEDIKK 121

Query: 115 KLEDAGATVELR 126
           KLE+AGA V ++
Sbjct: 122 KLEEAGAKVSVK 133


>gi|148244879|ref|YP_001219573.1| 50S ribosomal protein L7/L12 [Candidatus Vesicomyosocius okutanii
           HA]
 gi|166222225|sp|A5CW26|RL7_VESOH RecName: Full=50S ribosomal protein L7/L12
 gi|146326706|dbj|BAF61849.1| 50S ribosomal protein L7/L12 [Candidatus Vesicomyosocius okutanii
           HA]
          Length = 124

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 88/128 (68%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E I+  ++ +++I+  EL   +E+++GVSA+A   V   V A+  +   EK EF
Sbjct: 1   MAKLTNEDILNAIADMSVIDVVELVSAMEEKFGVSATAVTPVA--VVADVDNTVVEKDEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +++L  F   +KK+AVIK VR+IT LGLKE+K++VESAP  +K   SK EA +++++L++
Sbjct: 59  DIMLTSF--GEKKVAVIKAVRSITGLGLKESKDMVESAPVVIKESASKIEAEDIERQLKE 116

Query: 119 AGATVELR 126
            GA+VEL+
Sbjct: 117 VGASVELK 124


>gi|57237531|ref|YP_178545.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni RM1221]
 gi|205355350|ref|ZP_03222121.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|81557565|sp|Q5HVZ0|RL7_CAMJR RecName: Full=50S ribosomal protein L7/L12
 gi|57166335|gb|AAW35114.1| ribosomal protein L7/L12 [Campylobacter jejuni RM1221]
 gi|205346584|gb|EDZ33216.1| 50S ribosomal protein L7 /L12 [Campylobacter jejuni subsp. jejuni
           CG8421]
 gi|315057897|gb|ADT72226.1| LSU ribosomal protein L7/L12 (L23e) [Campylobacter jejuni subsp.
           jejuni S3]
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMIAGGAAAGGAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|86153900|ref|ZP_01072103.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           HB93-13]
 gi|85842861|gb|EAQ60073.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           HB93-13]
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +      A  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMIAGGAAAGSAAAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|189424402|ref|YP_001951579.1| 50S ribosomal protein L7/L12 [Geobacter lovleyi SZ]
 gi|226733692|sp|B3E7S7|RL7_GEOLS RecName: Full=50S ribosomal protein L7/L12
 gi|189420661|gb|ACD95059.1| ribosomal protein L7/L12 [Geobacter lovleyi SZ]
          Length = 126

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 64/121 (52%), Positives = 86/121 (71%), Gaps = 2/121 (1%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            +V  +  +T++E AEL K LE+++GVSA+APV+V A   A A  AA EKTEF+V+LK  
Sbjct: 8   DVVAFIEKMTVLELAELVKELEEKFGVSAAAPVAVAAAAPAAAAEAAEEKTEFDVILKS- 66

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                KI VIK VR +T LGLKEAK+LV+ AP  +KTG+SK EA E +K+L +AGA VE+
Sbjct: 67  -AGANKINVIKVVRTLTSLGLKEAKDLVDGAPSPVKTGISKAEAEEAQKQLVEAGAEVEI 125

Query: 126 R 126
           +
Sbjct: 126 K 126


>gi|150396198|ref|YP_001326665.1| 50S ribosomal protein L7/L12 [Sinorhizobium medicae WSM419]
 gi|166222213|sp|A6U850|RL7_SINMW RecName: Full=50S ribosomal protein L7/L12
 gi|150027713|gb|ABR59830.1| ribosomal protein L7/L12 [Sinorhizobium medicae WSM419]
          Length = 125

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A A +    EKTEF+
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAAAAPVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VILT--EAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|238752788|ref|ZP_04614256.1| 50S ribosomal protein L7/L12 [Yersinia rohdei ATCC 43380]
 gi|238708986|gb|EEQ01236.1| 50S ribosomal protein L7/L12 [Yersinia rohdei ATCC 43380]
          Length = 122

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  AA E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AAAAEAAEEQTEFNVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   + K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA+ +KK LE+AGA+VE
Sbjct: 63  F--GENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEADSLKKSLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|78358035|ref|YP_389484.1| 50S ribosomal protein L7/L12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|109893762|sp|Q30X07|RL7_DESDG RecName: Full=50S ribosomal protein L7/L12
 gi|78220440|gb|ABB39789.1| LSU ribosomal protein L12P [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 127

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 66/129 (51%), Positives = 93/129 (72%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           MS+I  E +VE ++ +T++E +E  K LE+++GVSA+APV+ +A   AEA + A E KTE
Sbjct: 1   MSDITKEQVVEFIAGMTVLELSEFIKELEEKFGVSAAAPVAAMAAAPAEAAAPAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       KIAVIK VRA+T LGLKEAKE V+  P +LK  +SKD+A E  K+L+
Sbjct: 61  FDVILKS--PGANKIAVIKVVRALTGLGLKEAKEKVDGTPSTLKEAVSKDDAEEAAKQLK 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAEVEVK 127


>gi|86149002|ref|ZP_01067234.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88597039|ref|ZP_01100275.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|218562132|ref|YP_002343911.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|14195178|sp|Q9PI32|RL7_CAMJE RecName: Full=50S ribosomal protein L7/L12
 gi|85840360|gb|EAQ57617.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           CF93-6]
 gi|88190728|gb|EAQ94701.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 84-25]
 gi|112359838|emb|CAL34625.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|284925744|gb|ADC28096.1| 50S ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           IA3902]
 gi|315928194|gb|EFV07511.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni
           DFVF1099]
 gi|315929769|gb|EFV08939.1| ribosomal protein L7/L12 [Campylobacter jejuni subsp. jejuni 305]
          Length = 125

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+  +     VA  A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAAPVMVAGGAVAGGAVAAAEEKTEFDIVLT- 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAK+ VE  P +LK G++K EA E KK+LE+AGA VE
Sbjct: 65  -DGGAKKIEVIKIVRALTGLGLKEAKDAVEQTPSTLKEGVAKAEAEEAKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|113474157|ref|YP_720218.1| 50S ribosomal protein L12P [Trichodesmium erythraeum IMS101]
 gi|123057155|sp|Q119S9|RL7_TRIEI RecName: Full=50S ribosomal protein L7/L12
 gi|110165205|gb|ABG49745.1| LSU ribosomal protein L12P [Trichodesmium erythraeum IMS101]
          Length = 133

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 62/132 (46%), Positives = 91/132 (68%), Gaps = 8/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------- 54
           +  + I+E+L SL+L+EA+EL K++E  +GVSA+AP   +    A  G+  +        
Sbjct: 3   AKTDEILEQLKSLSLLEASELVKQIEDAFGVSAAAPAGGMMMPMAMPGAPGAAAAEPEEE 62

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +TEF+ +L  F    KKIA++K VR+IT LGLKEAKELVES PK LK G++K+ A ++KK
Sbjct: 63  QTEFDAILTEF-PSDKKIAILKVVRSITGLGLKEAKELVESVPKPLKEGIAKEAAEDIKK 121

Query: 115 KLEDAGATVELR 126
           +LE+AGA VE++
Sbjct: 122 QLEEAGAKVEIK 133


>gi|328788786|ref|XP_393417.3| PREDICTED: 39S ribosomal protein L12, mitochondrial [Apis
           mellifera]
          Length = 182

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 6/129 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTE 57
           S IE I  ++  L LIE A+LS+ L+K+  +  + P+S       +      E    +T 
Sbjct: 54  SKIEQIANQIVCLNLIEVAQLSELLKKKLNLPDAMPMSNFVAAPVKGEEEVEEAAAVQTA 113

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V LK F++ K+KIA+IKE++ I  +  L +AK+ VESAP  +K+ LSK +A+E+   +
Sbjct: 114 FSVKLKSFNE-KQKIALIKELKNILPNCNLVQAKKFVESAPNIIKSDLSKHDADELADLI 172

Query: 117 EDAGATVEL 125
              G  VE+
Sbjct: 173 TKVGGIVEI 181


>gi|154149202|ref|YP_001407181.1| 50S ribosomal protein L7/L12 [Campylobacter hominis ATCC BAA-381]
 gi|166222152|sp|A7I3U0|RL7_CAMHC RecName: Full=50S ribosomal protein L7/L12
 gi|153805211|gb|ABS52218.1| ribosomal protein L7/L12 [Campylobacter hominis ATCC BAA-381]
          Length = 124

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S+L+++E +EL K  E+++GVSA+ PV V     A A +AA EKTEF++VL  
Sbjct: 6   EDVLEYISNLSVLELSELVKEFEEKFGVSAA-PVMVAGGAGAGAAAAAEEKTEFDLVLT- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VRAIT LGLKEAK+ VE  P  LK G++K++A + K  LE AGA VE
Sbjct: 64  -DTGAEKIKVIKAVRAITGLGLKEAKDAVEKTPSVLKEGMNKEDAEKAKADLEAAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|85000587|ref|XP_955012.1| 50S ribosomal protein L12 [Theileria annulata strain Ankara]
 gi|65303158|emb|CAI75536.1| 50S ribosomal protein L12, putative [Theileria annulata]
          Length = 275

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 36/138 (26%), Positives = 64/138 (46%), Gaps = 14/138 (10%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--------- 52
           + ++ I+E L  LTL+E +EL K++E+ +GVSA     +     A A             
Sbjct: 137 TKVDEILENLKELTLLETSELVKKIEEVFGVSAQPQGPLALRPQAIAPEEPYKEEEEDDE 196

Query: 53  -----SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKD 107
                 ++ +  VV+K  +  K+  +         D    E K++++S P  +KT  S+ 
Sbjct: 197 KERERDKRRKHNVVIKEIEKDKRIDSFKTLKEYFPDRSASEIKKIMDSLPFVVKTVTSQR 256

Query: 108 EANEMKKKLEDAGATVEL 125
           EA ++ KKL   G  +E+
Sbjct: 257 EAEDIIKKLTTDGMKIEI 274


>gi|307243165|ref|ZP_07525338.1| ribosomal protein L7/L12 [Peptostreptococcus stomatis DSM 17678]
 gi|306493426|gb|EFM65406.1| ribosomal protein L7/L12 [Peptostreptococcus stomatis DSM 17678]
          Length = 122

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 65/123 (52%), Positives = 90/123 (73%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E + ++ ++E  EL K  E+++GVSASAPV V    A  A +   EK+EF+V+L 
Sbjct: 3   IEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVAG-AAGGAAAGGEEKSEFDVILA 61

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  K+ VIKEVRAIT LGLKEAKE+V++APKS+K G+SK+EA ++K+KLE AGATV
Sbjct: 62  S--AGSSKVGVIKEVRAITGLGLKEAKEVVDNAPKSVKEGVSKEEAEQIKEKLEAAGATV 119

Query: 124 ELR 126
           E++
Sbjct: 120 EVK 122


>gi|126697631|ref|YP_001086528.1| 50S ribosomal protein L7/L12 [Clostridium difficile 630]
 gi|254973722|ref|ZP_05270194.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-66c26]
 gi|255091112|ref|ZP_05320590.1| 50S ribosomal protein L7/L12 [Clostridium difficile CIP 107932]
 gi|255099224|ref|ZP_05328201.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-63q42]
 gi|255305006|ref|ZP_05349178.1| 50S ribosomal protein L7/L12 [Clostridium difficile ATCC 43255]
 gi|255312766|ref|ZP_05354349.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-76w55]
 gi|255515526|ref|ZP_05383202.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-97b34]
 gi|255648620|ref|ZP_05395522.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-37x79]
 gi|255654153|ref|ZP_05399562.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-23m63]
 gi|260681837|ref|YP_003213122.1| 50S ribosomal protein L7/L12 [Clostridium difficile CD196]
 gi|260685435|ref|YP_003216568.1| 50S ribosomal protein L7/L12 [Clostridium difficile R20291]
 gi|296449808|ref|ZP_06891576.1| ribosomal protein L7/L12 [Clostridium difficile NAP08]
 gi|296877872|ref|ZP_06901893.1| ribosomal protein L7/L12 [Clostridium difficile NAP07]
 gi|306518743|ref|ZP_07405090.1| 50S ribosomal protein L7/L12 [Clostridium difficile QCD-32g58]
 gi|123067150|sp|Q18CE7|RL7_CLOD6 RecName: Full=50S ribosomal protein L7/L12
 gi|115249068|emb|CAJ66879.1| 50S ribosomal protein L7/L12 [Clostridium difficile]
 gi|260208000|emb|CBA60170.1| 50S ribosomal protein L7/L12 [Clostridium difficile CD196]
 gi|260211451|emb|CBE01563.1| 50S ribosomal protein L7/L12 [Clostridium difficile R20291]
 gi|296261352|gb|EFH08179.1| ribosomal protein L7/L12 [Clostridium difficile NAP08]
 gi|296431126|gb|EFH16952.1| ribosomal protein L7/L12 [Clostridium difficile NAP07]
          Length = 121

 Score = 83.8 bits (206), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E + ++ ++E  EL K  E+++GVSASAPV V    AA  G AA EKTEF+VVL 
Sbjct: 3   IEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVA--GAAAGGPAAEEKTEFDVVLT 60

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    K+ VIK VR IT LGLKEAKE+V++APK++K G SK+EA+++K+KLE AGA V
Sbjct: 61  --DVGSSKVGVIKAVREITGLGLKEAKEVVDNAPKTVKEGASKEEADQIKEKLEAAGAKV 118

Query: 124 ELR 126
           E++
Sbjct: 119 EVK 121


>gi|307565730|ref|ZP_07628199.1| 50S ribosomal protein L7/L12 [Prevotella amnii CRIS 21A-A]
 gi|307345556|gb|EFN90924.1| 50S ribosomal protein L7/L12 [Prevotella amnii CRIS 21A-A]
          Length = 124

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA   +AA EKT F+V
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAGPAAGGAAAAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   +    K+ V+K V+    LGLKEAK+LV+ AP +LK GLSKDEA  +KK +E  G
Sbjct: 61  VLT--EAGPNKLKVVKAVKEACGLGLKEAKDLVDGAPSTLKEGLSKDEAENLKKAIEAEG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|323446614|gb|EGB02714.1| hypothetical protein AURANDRAFT_59709 [Aureococcus anophagefferens]
 gi|323447257|gb|EGB03188.1| hypothetical protein AURANDRAFT_59664 [Aureococcus anophagefferens]
 gi|323449070|gb|EGB04961.1| hypothetical protein AURANDRAFT_59434 [Aureococcus anophagefferens]
          Length = 131

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 61/130 (46%), Positives = 85/130 (65%), Gaps = 6/130 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KT 56
           + ++ I+E + SLTL+EA+EL  ++E+ +GV ASA       +AA   +         K 
Sbjct: 3   AKVDDILEDIKSLTLVEASELVSKIEETFGVDASAAPMAGMMMAAPGAAGGGAEAAEEKD 62

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+L       KKIAV+K VR IT LGLKEAK +VESAP +LK G SKDEA ++KK++
Sbjct: 63  EFDVMLTEV-PADKKIAVLKIVRTITGLGLKEAKTMVESAPIALKEGASKDEAEDIKKQI 121

Query: 117 EDAGATVELR 126
           E+ GA VEL+
Sbjct: 122 EEGGAKVELK 131


>gi|302834611|ref|XP_002948868.1| plastid/chloroplast ribosomal protein L7/L12 [Volvox carteri f.
           nagariensis]
 gi|300266059|gb|EFJ50248.1| plastid/chloroplast ribosomal protein L7/L12 [Volvox carteri f.
           nagariensis]
          Length = 162

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 51/125 (40%), Positives = 74/125 (59%), Gaps = 4/125 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFEV 60
           +  IV+KL +LTL+EA+EL   +EK +GV ASA   V       A +AA    EKT F+V
Sbjct: 38  VSEIVDKLKTLTLLEASELVSEIEKTFGVDASAAAPVAVAAMPAAAAAAPVVEEKTTFDV 97

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL+      KK+ + K VR I ++ + + KE   + PK LK GLSK++A   K +L +AG
Sbjct: 98  VLEDI-PADKKVGIYKVVRNIANIAVNQVKEFTATLPKVLKEGLSKEDAEAAKTQLLEAG 156

Query: 121 ATVEL 125
           A  ++
Sbjct: 157 AKAKV 161


>gi|162448679|ref|YP_001611046.1| 50S ribosomal protein L7/L12 [Sorangium cellulosum 'So ce 56']
 gi|259491656|sp|A9GRA8|RL7_SORC5 RecName: Full=50S ribosomal protein L7/L12
 gi|161159261|emb|CAN90566.1| 50S ribosomal protein L7/L12 [Sorangium cellulosum 'So ce 56']
          Length = 128

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 62/128 (48%), Positives = 82/128 (64%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ I  E +V+ LS+L +I+ AEL K LE +WGV A+     VA   A A  A     + 
Sbjct: 1   MAEITREQVVDYLSNLPVIQIAELIKDLENKWGVKAAPAAVAVAAGPAAAAPAEKAPEQT 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +   +    KI VIK +R IT LGLKEAK+LVE+APK++K  +SK +A EMKKKL +
Sbjct: 61  EFDVVLANAGSNKIGVIKAIREITGLGLKEAKDLVEAAPKTVKEQVSKADAEEMKKKLVE 120

Query: 119 AGATVELR 126
           AGATVEL+
Sbjct: 121 AGATVELK 128


>gi|108773072|ref|YP_635981.1| ribosomal protein L12 [Scenedesmus obliquus]
 gi|122231587|sp|Q1KVU3|RK12_SCEOB RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|88696638|gb|ABD48264.1| ribosomal protein L12 [Scenedesmus obliquus]
          Length = 132

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 54/132 (40%), Positives = 81/132 (61%), Gaps = 8/132 (6%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-------AAS 53
           MS +  I+EKL +LTL+EA+EL  ++E+ +GV ASAPV     +AA   +          
Sbjct: 1   MSTVNEIIEKLKTLTLLEASELVSQIEETFGVDASAPVGGGVMMAAMPAAGGADAAPKEE 60

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F+VVL+      KK+ + K VR I ++ + + KE   + PK+LK  +SK+EA   K
Sbjct: 61  EKTLFDVVLEEI-PADKKVGIYKVVRNIANIAVNQVKEFTGTLPKALKESVSKEEAEAAK 119

Query: 114 KKLEDAGATVEL 125
           ++LEDAGA V++
Sbjct: 120 QQLEDAGAKVKI 131


>gi|268574702|ref|XP_002642330.1| Hypothetical protein CBG18325 [Caenorhabditis briggsae]
 gi|268574794|ref|XP_002642376.1| Hypothetical protein CBG18380 [Caenorhabditis briggsae]
          Length = 174

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 72/129 (55%), Gaps = 6/129 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA------SEKT 56
            + ++VE++++L+L++ ++L+  L+K   +     ++  A   A A + A       +K 
Sbjct: 45  KVSALVEEIANLSLLDVSDLNWALKKRLNIPDQPFMAAAAFAPAAAAAPAAQASDVPQKM 104

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F V L  FDD KK   + +   AI  L L +AK+ VE+AP ++K  L K EA E+K  L
Sbjct: 105 TFTVKLTKFDDTKKIAIIKEIRNAIPGLNLVQAKKFVETAPVNVKEDLGKAEAEELKGIL 164

Query: 117 EDAGATVEL 125
           E AGA +E+
Sbjct: 165 EKAGAVIEI 173


>gi|150003396|ref|YP_001298140.1| 50S ribosomal protein L7/L12 [Bacteroides vulgatus ATCC 8482]
 gi|212695313|ref|ZP_03303441.1| hypothetical protein BACDOR_04853 [Bacteroides dorei DSM 17855]
 gi|237711665|ref|ZP_04542146.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 9_1_42FAA]
 gi|237725893|ref|ZP_04556374.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D4]
 gi|254881314|ref|ZP_05254024.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 4_3_47FAA]
 gi|265753085|ref|ZP_06088654.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_33FAA]
 gi|294777814|ref|ZP_06743258.1| ribosomal protein L7/L12 [Bacteroides vulgatus PC510]
 gi|319640316|ref|ZP_07995041.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_40A]
 gi|166222136|sp|A6KYK4|RL7_BACV8 RecName: Full=50S ribosomal protein L7/L12
 gi|149931820|gb|ABR38518.1| 50S ribosomal protein L7/L12 [Bacteroides vulgatus ATCC 8482]
 gi|212662223|gb|EEB22797.1| hypothetical protein BACDOR_04853 [Bacteroides dorei DSM 17855]
 gi|229435701|gb|EEO45778.1| 50S ribosomal protein L7/L12 [Bacteroides dorei 5_1_36/D4]
 gi|229454360|gb|EEO60081.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 9_1_42FAA]
 gi|254834107|gb|EET14416.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 4_3_47FAA]
 gi|263236271|gb|EEZ21766.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_33FAA]
 gi|294448268|gb|EFG16824.1| ribosomal protein L7/L12 [Bacteroides vulgatus PC510]
 gi|317388091|gb|EFV68945.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_1_40A]
          Length = 124

 Score = 83.4 bits (205), Expect = 8e-15,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       K+ V+K V+    LGLKEAK++V+ AP ++K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKS--AGAAKLQVVKAVKEACGLGLKEAKDMVDGAPSTVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|260584405|ref|ZP_05852152.1| 50S ribosomal protein L7/L12 [Granulicatella elegans ATCC 700633]
 gi|260157923|gb|EEW92992.1| 50S ribosomal protein L7/L12 [Granulicatella elegans ATCC 700633]
          Length = 122

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE I+  +   T++E  +L K +E+E+GV+A+APV+VV   A  AG AA EK++F+V L
Sbjct: 4   NIEQIIADIKEATVLELNDLVKAIEEEFGVTAAAPVAVV---AGGAGEAAEEKSDFDVEL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR  T LGLKEAK LV+ AP  LK G++K+EA  +K +LE+ GA+
Sbjct: 61  TS--AGDNKIKVIKVVREATGLGLKEAKALVDGAPGILKEGVAKEEAEALKAQLEEVGAS 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|293399721|ref|ZP_06643867.1| ribosomal protein L7/L12 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291306121|gb|EFE47364.1| ribosomal protein L7/L12 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 124

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 80/128 (62%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E I+  L   T++E  EL K +E+++GV+A+APV+V A   A A +    +   
Sbjct: 1   MAKLNQEDILAYLEEATILELNELVKAIEEKFGVTAAAPVAVAAAADAGAAAEGPSE--- 57

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V +   D    K+AVIK VR IT LGL +AK LV+ AP  +K  +S +EA E+KKKL D
Sbjct: 58  -VTVTLTDIGGTKVAVIKAVREITGLGLVDAKGLVDKAPSVIKENVSPEEAEEIKKKLMD 116

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 117 AGASVEVK 124


>gi|116074055|ref|ZP_01471317.1| ribosomal protein L7/L12 [Synechococcus sp. RS9916]
 gi|116069360|gb|EAU75112.1| ribosomal protein L7/L12 [Synechococcus sp. RS9916]
          Length = 129

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 60/128 (46%), Positives = 85/128 (66%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEF 58
           +  + I+E+L +L+L+EA+EL K++E+ +GVSA+A   VV      AG        KTEF
Sbjct: 3   ATTDQILEQLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAPGAAGGGGEAAEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+ FD    KI V+K VR  T LGL +AK LVE+APK++K G SKD+A  +KK +E+
Sbjct: 63  DVVLESFDASA-KIKVLKAVREATGLGLGDAKALVEAAPKAVKEGASKDDAEALKKAIEE 121

Query: 119 AGATVELR 126
           AG  V L+
Sbjct: 122 AGGKVTLK 129


>gi|50306471|ref|XP_453209.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49642343|emb|CAH00305.1| KLLA0D03212p [Kluyveromyces lactis]
          Length = 170

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 48/131 (36%), Positives = 72/131 (54%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------- 55
            I  IV+ +S LTL+E + L + L+ +  +   +  +  A  AA A  A   K       
Sbjct: 40  KISQIVQDISKLTLLETSALIQELKTQLNIPDISFPAAGAGSAAPAAPAEEAKEEEVVEE 99

Query: 56  -TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
            T F + L+ F D K K  +IKEV+ +  L L EAK+ VESAPK LK  ++K++A+++K 
Sbjct: 100 KTIFSIKLESF-DAKSKPKIIKEVKNLLGLSLVEAKKFVESAPKVLKENVAKEDADKVKA 158

Query: 115 KLEDAGATVEL 125
            LE  GA + L
Sbjct: 159 ALEGLGAKIVL 169


>gi|225026466|ref|ZP_03715658.1| hypothetical protein EUBHAL_00715 [Eubacterium hallii DSM 3353]
 gi|224956205|gb|EEG37414.1| hypothetical protein EUBHAL_00715 [Eubacterium hallii DSM 3353]
          Length = 126

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  L+++E  +L K  E+E+GVSA+A V V     A AG AA EKTEF+V L  
Sbjct: 9   QEIIEVIKGLSVLELNDLVKACEEEFGVSAAAGVVVA--AGAGAGEAAEEKTEFDVELTE 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VR IT LGLKEAK +V+ APK++K  +SK+EA ++KK+LE+ GA V 
Sbjct: 67  V--GGQKVKVIKVVREITGLGLKEAKAVVDGAPKAIKEAVSKEEAEDIKKQLEEVGAKVT 124

Query: 125 LR 126
           ++
Sbjct: 125 VK 126


>gi|197122677|ref|YP_002134628.1| 50S ribosomal protein L7/L12 [Anaeromyxobacter sp. K]
 gi|220917460|ref|YP_002492764.1| ribosomal protein L7/L12 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|226733636|sp|B4UDT3|RL7_ANASK RecName: Full=50S ribosomal protein L7/L12
 gi|254806254|sp|B8JB71|RL7_ANAD2 RecName: Full=50S ribosomal protein L7/L12
 gi|196172526|gb|ACG73499.1| ribosomal protein L7/L12 [Anaeromyxobacter sp. K]
 gi|219955314|gb|ACL65698.1| ribosomal protein L7/L12 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 125

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS-AASEKTEFE 59
           M+++ +IVE+LS LT++EAAEL K+LE++WGVSA+A   +VA     A +    EKTEF 
Sbjct: 1   MADLNAIVEQLSGLTIMEAAELVKQLEEKWGVSAAAAPVMVAAGGGAAAAAPVEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE APK +K G++K E+ E+KKKLE A
Sbjct: 61  VVL--VDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKEVKAGVAKAESEELKKKLEAA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAKVEVK 125


>gi|194333131|ref|YP_002014991.1| 50S ribosomal protein L7/L12 [Prosthecochloris aestuarii DSM 271]
 gi|226733720|sp|B4S496|RL7_PROA2 RecName: Full=50S ribosomal protein L7/L12
 gi|194310949|gb|ACF45344.1| ribosomal protein L7/L12 [Prosthecochloris aestuarii DSM 271]
          Length = 126

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 90/126 (71%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++IE++VE++  L+L EA+EL K LE+++GVSA+  V      AA AG AA+++ + E 
Sbjct: 1   MASIETLVEEIGKLSLTEASELVKALEEKFGVSAAPAVIAGGMAAAPAGDAAAQEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            ++       KI VIK VR+IT LGLKEAKE+V+ APK +K  +SK+EA ++ K+L+DAG
Sbjct: 61  DVELKAAGANKINVIKVVRSITGLGLKEAKEVVDGAPKVVKEAVSKEEAEKIAKELKDAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|317126846|ref|YP_004093128.1| ribosomal protein L7/L12 [Bacillus cellulosilyticus DSM 2522]
 gi|315471794|gb|ADU28397.1| ribosomal protein L7/L12 [Bacillus cellulosilyticus DSM 2522]
          Length = 120

 Score = 83.4 bits (205), Expect = 9e-15,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 79/122 (64%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +  ++++E  +L K +E+E+        + VA     A  AA EKTEF+V+L+ 
Sbjct: 4   EQMIEAIKEMSVLELNDLVKAIEEEF---GVTAAAPVAVAGGGAAEAAEEKTEFDVILES 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLK+AK LV+ AP  +K G+SK++A EMK KLE+AGA+VE
Sbjct: 61  --PGGSKINVIKVVREITGLGLKDAKALVDGAPAPVKEGVSKEDAEEMKAKLEEAGASVE 118

Query: 125 LR 126
           ++
Sbjct: 119 VK 120


>gi|307152576|ref|YP_003887960.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 7822]
 gi|306982804|gb|ADN14685.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 7822]
          Length = 129

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 87/127 (68%), Gaps = 2/127 (1%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFE 59
           +  + I+EKL SLTL+EAAEL K++E+ +GVSA+APV   V+A   A A +   E+    
Sbjct: 3   AATDEILEKLKSLTLLEAAELVKQIEEAFGVSAAAPVGGVVMAAPTAAAAAEPEEEKTEF 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
            V+       KKIA++K VR IT LGLKEAK+LVES PK +K G +KD+A + KKKLE+A
Sbjct: 63  DVILEEVPADKKIAILKVVRTITGLGLKEAKDLVESTPKPIKEGTNKDDAEDTKKKLEEA 122

Query: 120 GATVELR 126
           GA V ++
Sbjct: 123 GAKVSVK 129


>gi|268316667|ref|YP_003290386.1| 50S ribosomal protein L7/L12 [Rhodothermus marinus DSM 4252]
 gi|262334201|gb|ACY47998.1| ribosomal protein L7/L12 [Rhodothermus marinus DSM 4252]
          Length = 126

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 89/126 (70%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++++ E+L +LT+ EA EL+K LE+E+G+  +A    VA   A    AA+ + + E 
Sbjct: 1   MADLKALAEQLVNLTIKEANELAKILEEEYGIKPAAAAVAVAAGPAGGDGAAAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KIAVIKEVRAIT LGLKEAKELV+SAPK +K G+SK+EA ++K KLE+AG
Sbjct: 61  DVILKAAGGNKIAVIKEVRAITGLGLKEAKELVDSAPKPIKEGVSKEEAEQIKAKLEEAG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AEVEIK 126


>gi|77462250|ref|YP_351754.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides 2.4.1]
 gi|126461112|ref|YP_001042226.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides ATCC 17029]
 gi|126461126|ref|YP_001042240.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides ATCC 17029]
 gi|221638104|ref|YP_002524366.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides KD131]
 gi|109893795|sp|Q3J5T1|RL7_RHOS4 RecName: Full=50S ribosomal protein L7/L12
 gi|254806391|sp|B9KL82|RL7_RHOSK RecName: Full=50S ribosomal protein L7/L12
 gi|77386668|gb|ABA77853.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides 2.4.1]
 gi|126102776|gb|ABN75454.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides ATCC 17029]
 gi|126102790|gb|ABN75468.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides ATCC 17029]
 gi|221158885|gb|ACL99864.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides KD131]
          Length = 125

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 1/126 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  + E +  LTL+EA EL   L+ ++G+  +A  +V+    A   +A +E+ + E 
Sbjct: 1   MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGPAAGAAAPAEEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K  ++K +A  MKKKLE+AG
Sbjct: 61  DVVLTDAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAVAKADAEAMKKKLEEAG 119

Query: 121 ATVELR 126
           A VEL+
Sbjct: 120 AKVELK 125


>gi|313673489|ref|YP_004051600.1| LSU ribosomal protein l12p [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312940245|gb|ADR19437.1| LSU ribosomal protein L12P [Calditerrivibrio nitroreducens DSM
           19672]
          Length = 127

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 83/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E + ++T+IE A   K LE+++GVSA+APV+++A  AA A +A +   + E  +  
Sbjct: 6   EQVIEFIENMTVIELANFVKELEEKFGVSAAAPVAMMAAPAAAAAAAEAPAEKTEFDVIL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +K+ VIK VR +T LGLKEAK LV+ APK +K G+ KDEA ++K  L + GATVE
Sbjct: 66  TNAGAQKVQVIKVVRELTGLGLKEAKALVDEAPKPVKEGVKKDEAEKIKAALAEVGATVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|118591194|ref|ZP_01548593.1| 50S ribosomal protein L7/L12 [Stappia aggregata IAM 12614]
 gi|118436270|gb|EAV42912.1| 50S ribosomal protein L7/L12 [Stappia aggregata IAM 12614]
          Length = 125

 Score = 83.4 bits (205), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 80/127 (62%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++E +V++LS+LT++EAAELSK LE++WGVSA+APV+V A  A    +AA  EKTEF+
Sbjct: 1   MADLEKLVDELSALTVMEAAELSKLLEEKWGVSAAAPVAVAAVAAGGGDAAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L       KKI VIKEVRAIT LGLKEAKELVE APK +K G+ KDEA E+KKKLE+A
Sbjct: 61  VILAS--AGDKKINVIKEVRAITGLGLKEAKELVEGAPKPVKEGVGKDEAEELKKKLEEA 118

Query: 120 GATVELR 126
           GA+VEL+
Sbjct: 119 GASVELK 125


>gi|464517|sp|Q06030|RK121_SECCE RecName: Full=50S ribosomal protein L12-1, chloroplastic; AltName:
           Full=CL12-1; Flags: Precursor
          Length = 174

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 75/124 (60%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA-GSAASEKTEFEVV 61
            +  + + ++ LTL EA  L   L++   VSA++     A + A A   A  E+TEF+VV
Sbjct: 51  KVLELGDAIAGLTLEEARNLVDHLQERLCVSAASFPPAAAGLRAAAVEEAPVEQTEFDVV 110

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           ++       +IA IK VRA+T+L LKEAK+L+E  PK LK  +SKDEA E KK+LE  GA
Sbjct: 111 IEEVPSSA-RIATIKIVRALTNLALKEAKDLIEGLPKKLKEAVSKDEAEEAKKQLEGVGA 169

Query: 122 TVEL 125
            V +
Sbjct: 170 KVSI 173


>gi|94312266|ref|YP_585476.1| 50S ribosomal protein L7/L12 [Cupriavidus metallidurans CH34]
 gi|123383585|sp|Q1LI19|RL7_RALME RecName: Full=50S ribosomal protein L7/L12
 gi|93356118|gb|ABF10207.1| 50S ribosomal subunit protein L7/L12 [Cupriavidus metallidurans
           CH34]
          Length = 124

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 81/122 (66%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + +++++E  +L K  E+++GVSA+A     A   A   +AA EKTEF V+L  
Sbjct: 6   DDILEAVGAMSVMELNDLVKAFEEKFGVSAAAMAVAAA-PGAGGAAAAEEKTEFNVILAE 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR IT LGLKEAK+LV+ APK +K G+ K  A++ KKKLEDAGA V+
Sbjct: 65  V--GSNKVGVIKAVREITGLGLKEAKDLVDGAPKPVKEGVDKATADDAKKKLEDAGAKVD 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|29348144|ref|NP_811647.1| 50S ribosomal protein L7/L12 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253569582|ref|ZP_04846992.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 1_1_6]
 gi|298386173|ref|ZP_06995730.1| ribosomal protein L7/L12 [Bacteroides sp. 1_1_14]
 gi|81586838|sp|Q8A468|RL7_BACTN RecName: Full=50S ribosomal protein L7/L12
 gi|29340047|gb|AAO77841.1| 50S ribosomal protein L7/L12 [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|251841601|gb|EES69682.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 1_1_6]
 gi|298261401|gb|EFI04268.1| ribosomal protein L7/L12 [Bacteroides sp. 1_1_14]
          Length = 124

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 82/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +A  EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAVEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       K+ V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKS--AGAAKLQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|326501736|dbj|BAK02657.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 196

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 14/133 (10%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS------------ 53
            +V+ +S+LTL EAAELS  L +   + ++ P++++   A   G  A+            
Sbjct: 64  RLVDDVSALTLAEAAELSALLLRRLDIPSAPPIAILNSAAGLGGGGAAAAGAAGDKPAAA 123

Query: 54  -EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT FE+ L  F D   KI VIKE+R  TDLGLKEAKELVE AP  +K GLSK+EA ++
Sbjct: 124 AEKTVFELRLDSF-DAASKIKVIKEIRTFTDLGLKEAKELVEKAPAVIKGGLSKEEAEKI 182

Query: 113 KKKLEDAGATVEL 125
            ++++  GA V +
Sbjct: 183 VERMKALGAKVVM 195


>gi|323149181|ref|YP_004222010.1| ribosomal protein L12 [Coccomyxa sp. C-169]
 gi|317467237|gb|ADV29858.1| ribosomal protein L12 [Coccomyxa sp. C-169]
          Length = 129

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 83/124 (66%), Gaps = 4/124 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE---FEVV 61
           E I+EKL ++TL EAAEL  R+E+ +GV ASAP    A     AG AA  + E   F+V+
Sbjct: 6   EEIIEKLKTITLFEAAELVSRIEETFGVDASAPSGGFASAPLAAGEAAEAQEEKTAFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      K++AV+K +R +T LGLKEAKE   S PK++K G+SK+EA + K++LE+AG 
Sbjct: 66  LEDV-ASDKRVAVLKVIRNLTSLGLKEAKEFTSSLPKAVKEGVSKEEAEQAKQQLEEAGG 124

Query: 122 TVEL 125
            V++
Sbjct: 125 KVKI 128


>gi|307691685|ref|ZP_07633922.1| 50S ribosomal protein L12P [Ruminococcaceae bacterium D16]
          Length = 125

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 87/124 (70%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I +++E++  LT++E +EL   LE+E+GVSA+A  +        A  AA EKTEF+V+L
Sbjct: 5   KITALIEEVKGLTVLELSELVHALEEEFGVSAAAMAAPA--AGGAAAPAAEEKTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            GFD    KI VIK VR IT LGL EAK +VE  PK+LK G+SKDEA E+KKKLE+AGA 
Sbjct: 63  AGFDAAA-KIKVIKAVREITGLGLAEAKGMVEGTPKALKEGVSKDEAEELKKKLEEAGAK 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|313896756|ref|ZP_07830304.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320530082|ref|ZP_08031152.1| ribosomal protein L7/L12 [Selenomonas artemidis F0399]
 gi|312974673|gb|EFR40140.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 137 str.
           F0430]
 gi|320137515|gb|EFW29427.1| ribosomal protein L7/L12 [Selenomonas artemidis F0399]
          Length = 124

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A  AA AG AA  EKTEF VV
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGAAPAGGAAAEEKTEFTVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L       KKI VIK VR  T LGLKEAKELV+ APK +K  ++K EA E+K KLE+AGA
Sbjct: 62  LAS--AGDKKINVIKAVREATGLGLKEAKELVDGAPKPVKENIAKAEAEELKGKLEEAGA 119

Query: 122 TVELR 126
           TVEL+
Sbjct: 120 TVELK 124


>gi|312131289|ref|YP_003998629.1| lsu ribosomal protein l12p [Leadbetterella byssophila DSM 17132]
 gi|311907835|gb|ADQ18276.1| LSU ribosomal protein L12P [Leadbetterella byssophila DSM 17132]
          Length = 126

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 83/126 (65%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++  E+L +LT+ E  EL++ L+ E+G+  +A  +VV    A    A + + +   
Sbjct: 1   MADIKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAGGAVVVAGPAAGADAPAAEEKTSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        K+ V+K V+ +T LGLKEAKE+V+ APK+LK G++KDEA+ +KK+LE+AG
Sbjct: 61  DVILKSGGANKLQVVKLVKDLTGLGLKEAKEVVDGAPKALKEGVAKDEADALKKQLEEAG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AEVEIK 126


>gi|297179998|gb|ADI16223.1| hypothetical protein [uncultured bacterium HF0010_16H03]
          Length = 125

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +++++  +L   +E+++GV+A+A V+     A+    AA EK  F+VVL  
Sbjct: 6   EDILKTIEEMSVMDLVDLISDIEEKFGVTAAAAVAAAPAAASGDAPAAEEKDAFDVVLNA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ AP ++K G SKD+A  M  +L +AGAT E
Sbjct: 66  --AGDQKVQVIKAVRAITGLGLKEAKDMVDGAPSTVKEGASKDDAEAMVAQLTEAGATAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|289422421|ref|ZP_06424264.1| ribosomal protein L7/L12 [Peptostreptococcus anaerobius 653-L]
 gi|289156993|gb|EFD05615.1| ribosomal protein L7/L12 [Peptostreptococcus anaerobius 653-L]
          Length = 121

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 66/123 (53%), Positives = 91/123 (73%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E + ++ ++E  EL K  E+++GVSASAPV V     A  G+A  EKTEF+V+L 
Sbjct: 3   IEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVA--GGAAGGAAGEEKTEFDVILA 60

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  K+ VIKEVRAIT LGLKEAKE+V++APK++K G+SK+EA ++K+KLE AGATV
Sbjct: 61  S--AGSSKVGVIKEVRAITGLGLKEAKEVVDNAPKAVKEGVSKEEAEQIKEKLEAAGATV 118

Query: 124 ELR 126
           E++
Sbjct: 119 EVK 121


>gi|270160337|ref|ZP_06188990.1| ribosomal protein L7/L12 [Legionella longbeachae D-4968]
 gi|289163822|ref|YP_003453960.1| 50S ribosomal subunit protein L7/L12 [Legionella longbeachae
           NSW150]
 gi|269987149|gb|EEZ93407.1| ribosomal protein L7/L12 [Legionella longbeachae D-4968]
 gi|288856995|emb|CBJ10809.1| 50S ribosomal subunit protein L7/L12 [Legionella longbeachae
           NSW150]
          Length = 124

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 85/122 (69%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
             I+E +++++++E  EL + +E+++ VSA+A    VA   A A +A  E+TEF VV+  
Sbjct: 6   NDILETIANMSVMEVVELIEAMEEKFNVSAAAAAVAVA-APAAAAAAVEEQTEFTVVMTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK VR IT LGLKEAK+LVE AP ++K  +SKDEA  +KK+LE+AGA+VE
Sbjct: 65  F--GANKVNVIKAVRGITGLGLKEAKDLVEGAPSTIKEAVSKDEAANIKKELEEAGASVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|164686519|ref|ZP_02210547.1| hypothetical protein CLOBAR_00086 [Clostridium bartlettii DSM
           16795]
 gi|164604388|gb|EDQ97853.1| hypothetical protein CLOBAR_00086 [Clostridium bartlettii DSM
           16795]
          Length = 121

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 88/123 (71%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E +  + + E  EL K  E+++GVSASAPV V    AA   +AA EKTEF+V+L 
Sbjct: 3   IEQILEAIEQMKVTELNELVKAAEEKFGVSASAPVMVA--GAAGGAAAAEEKTEFDVILA 60

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    K+ VIK VR +T LGLK+AK+LV++APK+LK G SK+EA ++K+KLE AGA+V
Sbjct: 61  --NAGASKVGVIKAVREVTGLGLKDAKDLVDNAPKALKEGASKEEAEQIKEKLEAAGASV 118

Query: 124 ELR 126
           EL+
Sbjct: 119 ELK 121


>gi|169771715|ref|XP_001820327.1| 54S ribosomal protein L12 [Aspergillus oryzae RIB40]
 gi|238485696|ref|XP_002374086.1| 50S ribosomal protein L12 [Aspergillus flavus NRRL3357]
 gi|83768186|dbj|BAE58325.1| unnamed protein product [Aspergillus oryzae]
 gi|220698965|gb|EED55304.1| 50S ribosomal protein L12 [Aspergillus flavus NRRL3357]
          Length = 184

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 39/133 (29%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            I  IV+++S+LTL+E A+L   L+    +             A   +A           
Sbjct: 52  KISQIVDQISTLTLLETADLVATLKTRLNIPDLPVGGFAMAGGAAPAAAPAEEEEAAPAA 111

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F + L+   D   K  VIKE++++  L L ++K+ VES PK LK  + K++A ++
Sbjct: 112 QEKTLFNLKLESI-DAASKAKVIKEIKSLLGLSLVDSKKFVESVPKVLKESVPKEDAEKI 170

Query: 113 KKKLEDAGATVEL 125
            + L+  GA   +
Sbjct: 171 IETLKAVGAKAIM 183


>gi|83949808|ref|ZP_00958541.1| ribosomal protein L7/L12 [Roseovarius nubinhibens ISM]
 gi|83837707|gb|EAP77003.1| ribosomal protein L7/L12 [Roseovarius nubinhibens ISM]
          Length = 126

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+   A      A+ + + E 
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMVAAAGGDAGGAAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIKEVRAIT LGLKEAKELVE+  K++K  +SKDEA ++K KLE AG
Sbjct: 61  DVILKSAGASKINVIKEVRAITGLGLKEAKELVEAGGKAVKEQVSKDEAEDIKGKLEAAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|210623169|ref|ZP_03293619.1| hypothetical protein CLOHIR_01569 [Clostridium hiranonis DSM 13275]
 gi|210153782|gb|EEA84788.1| hypothetical protein CLOHIR_01569 [Clostridium hiranonis DSM 13275]
          Length = 121

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I+E + ++ ++E  EL K  E+++GVSASAPV V    AA   +AA EKTEF+VVL 
Sbjct: 3   IEQILEAIENMKVLELNELVKAAEEKFGVSASAPVMVA--GAAGGAAAAEEKTEFDVVL- 59

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR IT LGLKEAKE+V++APK++K G SK+EA ++K+KLE AGA V
Sbjct: 60  -ADAGSSKIGVIKVVREITGLGLKEAKEVVDNAPKTVKEGASKEEAEQIKEKLEAAGAKV 118

Query: 124 ELR 126
           E++
Sbjct: 119 EVK 121


>gi|225682972|gb|EEH21256.1| 50S ribosomal protein L12 [Paracoccidioides brasiliensis Pb03]
          Length = 199

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 17/139 (12%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA----------------PVSVVAPVAA 46
            I  IV+++S LTL+E A+L   L+    +                         A    
Sbjct: 61  KITQIVDQISQLTLLETADLVSSLKSRLNIPDLPIGGFAAGAAAGTAAGGAAPAAAVEEE 120

Query: 47  EAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSK 106
           +A  AA EKT F + L+ F D   K  VIKE++++  L L ++K+ VESAPK +K  + K
Sbjct: 121 DAAPAAQEKTLFNLKLESF-DAASKPKVIKEIKSLLSLSLVDSKKFVESAPKVMKESVPK 179

Query: 107 DEANEMKKKLEDAGATVEL 125
           ++A ++ K ++D GA V +
Sbjct: 180 EQAEKIVKTMKDLGAKVVM 198


>gi|56961922|ref|YP_173644.1| 50S ribosomal protein L7/L12 [Bacillus clausii KSM-K16]
 gi|81601108|sp|Q5WLS2|RL7_BACSK RecName: Full=50S ribosomal protein L7/L12
 gi|56908156|dbj|BAD62683.1| 50S ribosomal protein L7/L12 [Bacillus clausii KSM-K16]
          Length = 120

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 79/122 (64%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  +T++E  +L K +E+E+        + VA     A   A+E+TEF+VVL+ 
Sbjct: 4   DQIIEAIKEMTVLELNDLVKAIEEEF---GVTAAAPVAVAGGAAEGGAAEQTEFDVVLES 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAK LV+ AP  +K G++K+EA E+K KLE+AGA+VE
Sbjct: 61  --AGSSKIGVIKVVREITGLGLKEAKALVDGAPAPIKEGVAKEEAEEIKGKLEEAGASVE 118

Query: 125 LR 126
           L+
Sbjct: 119 LK 120


>gi|323333683|gb|EGA75076.1| Mnp1p [Saccharomyces cerevisiae AWRI796]
 gi|323337606|gb|EGA78851.1| Mnp1p [Saccharomyces cerevisiae Vin13]
 gi|323348663|gb|EGA82906.1| Mnp1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 180

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 51/142 (35%), Positives = 68/142 (47%), Gaps = 20/142 (14%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-------------------SAPVSVVAP 43
            I  IV+ +S LTL+E + L   L+    +                         +  A 
Sbjct: 39  KISKIVQDISQLTLLETSSLINELKTVLNIPEISMPMGGFMAGAAGAGAGNVPSSTGEAG 98

Query: 44  VAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
             AE  +    KT F V L  F D K K  VIKEV+ +  L L EAK+ VE+APK LK  
Sbjct: 99  SGAEEEAKPEAKTVFTVKLDSF-DTKTKAKVIKEVKGLLGLSLVEAKKFVEAAPKVLKEN 157

Query: 104 LSKDEANEMKKKLEDAGATVEL 125
           ++KD+A ++KK LED GA V L
Sbjct: 158 VAKDDAEKIKKTLEDLGAKVSL 179


>gi|319953898|ref|YP_004165165.1| lsu ribosomal protein l12p [Cellulophaga algicola DSM 14237]
 gi|319422558|gb|ADV49667.1| LSU ribosomal protein L12P [Cellulophaga algicola DSM 14237]
          Length = 123

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 56/126 (44%), Positives = 85/126 (67%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA       + A E+TEF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELANILKDEYGIEPAAAAVAVA-AGGGDAAVAEEQTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T LGLKEAK++V+SAPK++K G+SKDEA  + K LE+AG
Sbjct: 60  ILKA--AGASKLAVVKLVKELTGLGLKEAKDIVDSAPKAIKEGISKDEAEGILKSLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AEVELK 123


>gi|294668293|ref|ZP_06733397.1| hypothetical protein NEIELOOT_00206 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291309747|gb|EFE50990.1| hypothetical protein NEIELOOT_00206 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 123

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEKTEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               ++K+ VIK VRAIT LGLKEAK++V+ APK+LK G+SK EA +++K+LE+AGA VE
Sbjct: 64  --AGEQKVGVIKVVRAITGLGLKEAKDIVDGAPKTLKEGVSKAEAEDIQKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|170581217|ref|XP_001895588.1| 60S ribosomal protein L12, mitochondrial precursor [Brugia malayi]
 gi|158597404|gb|EDP35561.1| 60S ribosomal protein L12, mitochondrial precursor, putative
           [Brugia malayi]
          Length = 256

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 42/132 (31%), Positives = 63/132 (47%), Gaps = 10/132 (7%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP----------VSVVAPVAAEAGSAAS 53
           I  +  ++ SLT+ E A+L+  L+K+  +  +             S     A       S
Sbjct: 124 ILRLANEIVSLTIFEVADLNSTLKKKLNLPDAPVFSQSFAASGITSAAEEGAKMEKPQPS 183

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           +KT F V L   DD KK   + +    +    L +AK+ VE+ P ++K  LSK EA E+K
Sbjct: 184 QKTFFSVKLTKVDDSKKIPLIKEVRAIVEGFNLVQAKKFVEALPATVKEDLSKKEAEELK 243

Query: 114 KKLEDAGATVEL 125
            KLE  GAT E+
Sbjct: 244 TKLEKLGATCEI 255


>gi|71021953|ref|XP_761207.1| hypothetical protein UM05060.1 [Ustilago maydis 521]
 gi|46100687|gb|EAK85920.1| hypothetical protein UM05060.1 [Ustilago maydis 521]
          Length = 184

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 49/137 (35%), Positives = 78/137 (56%), Gaps = 13/137 (9%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------- 54
           + I +IV+++  LTL+EAA+L   L+    ++  A  +  A  A  A ++ +        
Sbjct: 47  AKISTIVDQIEKLTLLEAADLVSHLKTRLNITEIAMPAASAAPAGAAAASGAAEEPAEEA 106

Query: 55  -----KTEFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDE 108
                K+ F + L G  DP  K  VI+EV+A  +++ L EAK+ VES P+ LK GL+K++
Sbjct: 107 AKPKEKSVFTLKLTGLKDPTAKAKVIREVKAANSNMNLVEAKKFVESTPQVLKEGLNKED 166

Query: 109 ANEMKKKLEDAGATVEL 125
           A ++K  +E AG TVEL
Sbjct: 167 AEKLKTAIEAAGGTVEL 183


>gi|189184702|ref|YP_001938487.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Ikeda]
 gi|189181473|dbj|BAG41253.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Ikeda]
          Length = 129

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N++  V+ LS+ ++IE  EL+K LE+EWGVS+      VA   A    +  EK EF+V+L
Sbjct: 8   NVKKAVDMLSTFSVIELLELTKVLEEEWGVSSIPSNIPVATAIAPVQESEEEKNEFDVIL 67

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                P+KK+ VIK V+ IT L LKEAKE+V+SAPK +K  +SK EA ++K +LE+ GA 
Sbjct: 68  ATV--PEKKVDVIKIVKNITGLALKEAKEMVDSAPKVIKASISKAEAEDIKSQLENVGAK 125

Query: 123 VELR 126
           VEL+
Sbjct: 126 VELK 129


>gi|227825219|ref|ZP_03990051.1| 50S ribosomal protein L7/L12 [Acidaminococcus sp. D21]
 gi|226905718|gb|EEH91636.1| 50S ribosomal protein L7/L12 [Acidaminococcus sp. D21]
          Length = 122

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ + S+T++E A+L K +E+++GVSA+APV+V A  AA   +AA  KTEF+VVL  
Sbjct: 4   EEIMQAIESMTVLELADLVKAMEEKFGVSAAAPVAVAAAPAAGGAAAAE-KTEFDVVLT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KI VIK VR +T LGLKEAK  V+SAP +LK G+SK +A  MK KLE+AGA VE
Sbjct: 62  -DCGASKINVIKVVRELTGLGLKEAKAAVDSAPNTLKEGVSKADAEAMKAKLEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|88704392|ref|ZP_01102106.1| 50S ribosomal protein L7/L12 [Congregibacter litoralis KT71]
 gi|88701443|gb|EAQ98548.1| 50S ribosomal protein L7/L12 [Congregibacter litoralis KT71]
          Length = 126

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 83/123 (67%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           + I+  ++ ++++E  EL   +E+++GV+A+A V+     A      A  E+TEF+V+L 
Sbjct: 6   DDILTAIAEMSVMEVVELIDAMEEKFGVTAAAAVAAAPAAAGGDAGGAAEEQTEFDVMLT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                +KK+ VIK VRA+T LGLKEAK LV+ AP ++K G SK+EA ++KK+LE+AG + 
Sbjct: 66  A--AGEKKVNVIKVVRAVTGLGLKEAKGLVDGAPSAIKEGASKEEAEDIKKQLEEAGGSA 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|226290422|gb|EEH45906.1| 50S ribosomal protein L12 [Paracoccidioides brasiliensis Pb18]
          Length = 199

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 44/139 (31%), Positives = 70/139 (50%), Gaps = 17/139 (12%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASA----------------PVSVVAPVAA 46
            I  IV+++S LTL+E A+L   L+    +                         A    
Sbjct: 61  KITQIVDQISQLTLLETADLVSSLKSRLNIPDLPIGGFAAGAAAGTAAGGAAPAAAVEEE 120

Query: 47  EAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSK 106
           +A  AA EKT F + L+ F D   K  VIKE++++  L L ++K+ VESAPK +K  + K
Sbjct: 121 DAAPAAQEKTLFNLKLESF-DAASKPKVIKEIKSLLSLSLVDSKKFVESAPKVMKESVPK 179

Query: 107 DEANEMKKKLEDAGATVEL 125
           ++A ++ K ++D GA V +
Sbjct: 180 EQAEKIVKTMKDLGAKVVM 198


>gi|183601915|ref|ZP_02963284.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219682829|ref|YP_002469212.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis AD011]
 gi|241190405|ref|YP_002967799.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|241195811|ref|YP_002969366.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|254806261|sp|B8DVY5|RL7_BIFA0 RecName: Full=50S ribosomal protein L7/L12
 gi|183218800|gb|EDT89442.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis HN019]
 gi|219620479|gb|ACL28636.1| ribosomal protein L7/L12 [Bifidobacterium animalis subsp. lactis
           AD011]
 gi|240248797|gb|ACS45737.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis Bl-04]
 gi|240250365|gb|ACS47304.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis DSM 10140]
 gi|289178127|gb|ADC85373.1| LSU ribosomal protein L12P (L7/L12) [Bifidobacterium animalis
           subsp. lactis BB-12]
 gi|295793392|gb|ADG32927.1| 50S ribosomal protein L7/L12 [Bifidobacterium animalis subsp.
           lactis V9]
          Length = 126

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 78/122 (63%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E ++  K  E+++ V A+APV+ VA  A  A  A  EK EF VVL  
Sbjct: 7   DELLEAFGEMTLVELSDFVKAFEEKFDVEAAAPVAAVAAAAPGAAPAEEEKDEFTVVLSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT+LGL EAK LV+ APK +     K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRAITNLGLAEAKALVDGAPKPVLENAKKEDAEKAKAQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|149278891|ref|ZP_01885026.1| 50S ribosomal protein L7/L12 [Pedobacter sp. BAL39]
 gi|255530760|ref|YP_003091132.1| 50S ribosomal protein L7/L12 [Pedobacter heparinus DSM 2366]
 gi|149230510|gb|EDM35894.1| 50S ribosomal protein L7/L12 [Pedobacter sp. BAL39]
 gi|255343744|gb|ACU03070.1| ribosomal protein L7/L12 [Pedobacter heparinus DSM 2366]
          Length = 124

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 91/126 (72%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  A +A  AA EK+ F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAGPAGDAAPAAEEKSTFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK  +   +K+AV+K V+ +T LGLKEAK+LV+ APK LK G++KDEA  +KK+LE+AG
Sbjct: 61  ILK--EAGGQKLAVVKLVKDLTGLGLKEAKDLVDGAPKELKAGVAKDEAEALKKQLEEAG 118

Query: 121 ATVELR 126
           A VE++
Sbjct: 119 AVVEIK 124


>gi|323490604|ref|ZP_08095809.1| 50S ribosomal protein L7/L12 [Planococcus donghaensis MPA1U2]
 gi|323395696|gb|EGA88537.1| 50S ribosomal protein L7/L12 [Planococcus donghaensis MPA1U2]
          Length = 119

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T+++  +L K +E+E+GV+A+APV+      A  G+A +E+TEF+VVL  
Sbjct: 4   EQILESIKEMTVLQLNDLVKAIEEEFGVTAAAPVAAA----AAGGAAEAEQTEFDVVLAS 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR +T LGLKEAK LV+ APK++K G+SK++A E+K KLE+ GA+VE
Sbjct: 60  --AGDSKIKVIKAVREVTGLGLKEAKALVDEAPKAIKEGVSKEDAEEIKGKLEEVGASVE 117

Query: 125 LR 126
           ++
Sbjct: 118 VK 119


>gi|237749508|ref|ZP_04579988.1| large subunit ribosomal protein L7/L12 [Oxalobacter formigenes
           OXCC13]
 gi|229380870|gb|EEO30961.1| large subunit ribosomal protein L7/L12 [Oxalobacter formigenes
           OXCC13]
          Length = 126

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 60/123 (48%), Positives = 85/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I+E + +++++E  +L K  E+++GVSA+A        A  AG AA  E+TEF +VL 
Sbjct: 6   EDILEAVGAMSVMELNDLVKAFEEKFGVSAAAMAVAGPAGAGAAGGAAAEEQTEFTIVLA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K++VIK VR IT LGLKEAK++V+SAPK +K G+SK +A E KKKLE+AGA V
Sbjct: 66  EF--GANKVSVIKAVREITGLGLKEAKDMVDSAPKPIKEGVSKADAEEAKKKLEEAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|227879341|ref|ZP_03997205.1| ribosomal protein L7/L12 [Lactobacillus crispatus JV-V01]
 gi|256844516|ref|ZP_05550002.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 125-2-CHN]
 gi|256849095|ref|ZP_05554528.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-1A-US]
 gi|262047577|ref|ZP_06020532.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-3A-US]
 gi|293381051|ref|ZP_06627072.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 214-1]
 gi|295692233|ref|YP_003600843.1| 50S ribosomal protein l7/l12 [Lactobacillus crispatus ST1]
 gi|312977930|ref|ZP_07789676.1| ribosomal protein L7/L12 [Lactobacillus crispatus CTV-05]
 gi|227861062|gb|EEJ68717.1| ribosomal protein L7/L12 [Lactobacillus crispatus JV-V01]
 gi|256613594|gb|EEU18797.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 125-2-CHN]
 gi|256713871|gb|EEU28859.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-1A-US]
 gi|260572153|gb|EEX28718.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus MV-3A-US]
 gi|290922351|gb|EFD99332.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus 214-1]
 gi|295030339|emb|CBL49818.1| 50S ribosomal protein L7/L12 [Lactobacillus crispatus ST1]
 gi|310895237|gb|EFQ44305.1| ribosomal protein L7/L12 [Lactobacillus crispatus CTV-05]
          Length = 120

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 87/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + + I+E+L   T++E  +L K +E E+ V+A+APV      AA A  A + K+EF+V L
Sbjct: 4   DTDKIIEELKGATILELNDLVKAIEDEFDVTAAAPV-----AAAGAADAGAAKSEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V L+
Sbjct: 117 VTLK 120


>gi|67924345|ref|ZP_00517777.1| Ribosomal protein L7/L12 [Crocosphaera watsonii WH 8501]
 gi|67853801|gb|EAM49128.1| Ribosomal protein L7/L12 [Crocosphaera watsonii WH 8501]
          Length = 133

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 70/132 (53%), Positives = 91/132 (68%), Gaps = 8/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP-------VSVVAPVAAEAGSAASE 54
           +  + I+EKL SLTL+EA+EL K++E+ +GVSASAP           A     A  A  E
Sbjct: 3   AATDEILEKLKSLTLLEASELVKQIEEAFGVSASAPSGGMMMMAPGGAAPGGAAAEAEEE 62

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+VVL+      KKIA++K VRAIT LGLKEAK++VESAPK +K G  KD+A E+KK
Sbjct: 63  KTEFDVVLEEV-PGDKKIAILKVVRAITGLGLKEAKDMVESAPKPIKEGTGKDDAEEIKK 121

Query: 115 KLEDAGATVELR 126
           KLE+AGA V ++
Sbjct: 122 KLEEAGAKVSVK 133


>gi|298372781|ref|ZP_06982771.1| ribosomal protein L7/L12 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275685|gb|EFI17236.1| ribosomal protein L7/L12 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 126

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 48/126 (38%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA   A A  A + + +   
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAEILKNEYGIEPAAAAVAVAAGPAAAAGAPAAEEKTSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        K+AV+K V+ +T LGLKEAK++V++AP  +K G+SK+EA E++K+L  AG
Sbjct: 61  DVMLKSAGANKLAVVKLVKELTGLGLKEAKDIVDAAPSKVKEGVSKEEAEELQKQLTGAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|224534639|ref|ZP_03675213.1| ribosomal protein L7/L12 [Borrelia spielmanii A14S]
 gi|224514108|gb|EEF84428.1| ribosomal protein L7/L12 [Borrelia spielmanii A14S]
          Length = 124

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 79/124 (63%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  L     +E  +L   +E+++GV+A         V+A +   + E+TEF+V+L
Sbjct: 4   NKEDILTWLEGAKTMEVVDLVTAIEEKFGVTAVVTAGGGGAVSAGSTD-SEEQTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA 
Sbjct: 63  MSF--GDSKINVIKEVRSITGLGLGEAKALVESAPKAVKEGLSKSDAEELKKKLEAVGAK 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|167644756|ref|YP_001682419.1| 50S ribosomal protein L7/L12 [Caulobacter sp. K31]
 gi|189042984|sp|B0SUP3|RL7_CAUSK RecName: Full=50S ribosomal protein L7/L12
 gi|167347186|gb|ABZ69921.1| ribosomal protein L7/L12 [Caulobacter sp. K31]
          Length = 126

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 66/128 (51%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           MS +E +VE+LS+L+++EAA+LSK LE++WGVS A+   +     AA    AA E+TEF 
Sbjct: 1   MSKLEKLVEELSALSVLEAADLSKLLEEKWGVSAAAPVAAAGPAAAAAPAEAAEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           VVL       KKI VIKEVR +  DLGLKEAK+LVE AP+++   +SK  A E+ KKL +
Sbjct: 61  VVLTA--GGDKKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVVENVSKQVAEEIAKKLTE 118

Query: 119 AGATVELR 126
           AGATV+++
Sbjct: 119 AGATVQVK 126


>gi|15235649|ref|NP_195481.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|4468991|emb|CAB38305.1| ribosomal-like protein [Arabidopsis thaliana]
 gi|7270748|emb|CAB80431.1| ribosomal-like protein [Arabidopsis thaliana]
 gi|18377872|gb|AAL67122.1| AT4g37660/F19F18_150 [Arabidopsis thaliana]
 gi|20334824|gb|AAM16168.1| AT4g37660/F19F18_150 [Arabidopsis thaliana]
 gi|21593662|gb|AAM65629.1| ribosomal-like protein [Arabidopsis thaliana]
          Length = 167

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 54/127 (42%), Positives = 73/127 (57%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGV----SASAPVSVVAPVAAEAGSAASEKTEF 58
            +E I + L  L  IE  + S     + G+    SA A    V   +A   +  +EKT F
Sbjct: 41  KLERIADDLLKLNRIELYDYSLLFSHKIGLNRYGSAVAVTGSVGDASASTETKTAEKTTF 100

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L+ F+    KI VIKE+RA TDLGLKEAK LVE AP  +K GL+K+EA ++ +KL+ 
Sbjct: 101 DVKLEKFEA-ASKIKVIKEIRAFTDLGLKEAKALVEKAPVIVKNGLTKEEAEKIMEKLKA 159

Query: 119 AGATVEL 125
            GA V L
Sbjct: 160 VGAIVAL 166


>gi|126138240|ref|XP_001385643.1| 60S ribosomal protein L7/L12 [Scheffersomyces stipitis CBS 6054]
 gi|126092921|gb|ABN67614.1| 60S ribosomal protein L7/L12 [Scheffersomyces stipitis CBS 6054]
          Length = 171

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 52/130 (40%), Positives = 78/130 (60%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-------SAPVSVVAPVAAEAGSAASEK 55
            I +IV+++S+LTL+E + L   L++   +S        +AP +  APV  E      EK
Sbjct: 42  KISAIVDQISTLTLLETSALVTELKQRLNISDIALPAAGAAPAAQAAPVEEEVKEVVEEK 101

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           T F + L+ F D K K  +IKEV+A+  L L E+K+ VESAPK LK  ++K++A+++K  
Sbjct: 102 TIFSIKLESF-DAKSKPKIIKEVKAMLGLSLVESKKFVESAPKVLKENVAKEDADKIKAT 160

Query: 116 LEDAGATVEL 125
           LE  GA V L
Sbjct: 161 LEGLGAKVSL 170


>gi|323703911|ref|ZP_08115543.1| ribosomal protein L7/L12 [Desulfotomaculum nigrificans DSM 574]
 gi|323531127|gb|EGB21034.1| ribosomal protein L7/L12 [Desulfotomaculum nigrificans DSM 574]
          Length = 127

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 68/129 (52%), Positives = 90/129 (69%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           MS +  ++E +  LT++E AEL K  E+E+GVSA+APV+V A  AA A +A     EKTE
Sbjct: 1   MSKVAEVLEIVKGLTVLELAELVKAFEEEFGVSAAAPVAVAAAPAAGAAAAGAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L       KKI VIK VR IT LGLKEAK+LV+ APK +K  +SK+EA  +K KL 
Sbjct: 61  FDVILAS--AGDKKINVIKVVREITGLGLKEAKDLVDGAPKPVKEKVSKEEAESIKAKLT 118

Query: 118 DAGATVELR 126
           +AGATVE++
Sbjct: 119 EAGATVEVK 127


>gi|220930956|ref|YP_002507864.1| ribosomal protein L7/L12 [Halothermothrix orenii H 168]
 gi|254806377|sp|B8D0B5|RL7_HALOH RecName: Full=50S ribosomal protein L7/L12
 gi|219992266|gb|ACL68869.1| ribosomal protein L7/L12 [Halothermothrix orenii H 168]
          Length = 123

 Score = 82.7 bits (203), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E AEL + LE+++GVSA+APV++ A   A+ G    EKTEF+V L  
Sbjct: 4   EEIIEAIENMTVLELAELVEELEEKFGVSAAAPVAMAAVPGAQGGEQQEEKTEFDVHLAE 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR +T LGLK+AK LV+ AP ++K G+SK+EA E+K KLEDAGATVE
Sbjct: 64  I--GGKKINVIKVVREVTGLGLKDAKALVDDAPTNVKEGVSKEEAEEIKSKLEDAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|313204191|ref|YP_004042848.1| LSU ribosomal protein l12p [Paludibacter propionicigenes WB4]
 gi|312443507|gb|ADQ79863.1| LSU ribosomal protein L12P [Paludibacter propionicigenes WB4]
          Length = 124

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA   A A     EKT F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAGPAAAAEVVEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       K+A++K V+ +T LGLKEAK++V++AP  +K G SKDEA  +KK+L + G
Sbjct: 61  VLKA--AGANKLAIVKLVKELTGLGLKEAKDMVDAAPSVIKEGASKDEAEALKKQLVEGG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|260437413|ref|ZP_05791229.1| ribosomal protein L7/L12 [Butyrivibrio crossotus DSM 2876]
 gi|292810045|gb|EFF69250.1| ribosomal protein L7/L12 [Butyrivibrio crossotus DSM 2876]
          Length = 119

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 80/122 (65%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  LT++E  +L K  E+E+GVSA+A V V    A    +A  EKTEF+V L  
Sbjct: 4   QEIIEVIKGLTVLELNDLVKACEEEFGVSAAAGVVVA--AAGAGAAAEEEKTEFDVELTE 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                  + VIK VR IT LGLKEAK+LV +APK +K G+SK+EA ++KKKLE+AGA   
Sbjct: 62  GSG----VPVIKVVREITGLGLKEAKDLVTAAPKVVKEGVSKEEAEDIKKKLEEAGAKAT 117

Query: 125 LR 126
           ++
Sbjct: 118 IK 119


>gi|162419344|ref|YP_001607195.1| 50S ribosomal protein L7/L12 [Yersinia pestis Angola]
 gi|229839430|ref|ZP_04459589.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|226734499|sp|A9R0H7|RL7_YERPG RecName: Full=50S ribosomal protein L7/L12
 gi|162352159|gb|ABX86107.1| ribosomal protein L7/L12 [Yersinia pestis Angola]
 gi|229695796|gb|EEO85843.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. PEXU2]
          Length = 130

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 88/126 (69%), Gaps = 6/126 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEFEV 60
           + I+E +++L+++E  EL   +E+++GVSA+A  +  A   A   +AA E    +TEF+V
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGPAAAVAAGPAAAVEAAEEQTEFDV 66

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL  F   + K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AG
Sbjct: 67  VLASF--GENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKKSLEEAG 124

Query: 121 ATVELR 126
           A+VE++
Sbjct: 125 ASVEIK 130


>gi|294786494|ref|ZP_06751748.1| ribosomal protein L7/L12 [Parascardovia denticolens F0305]
 gi|294485327|gb|EFG32961.1| ribosomal protein L7/L12 [Parascardovia denticolens F0305]
          Length = 126

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 82/128 (64%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + +++    +TL+E +E  K+ E+E+ V A+APV+ VA   A   +A  E+TEF
Sbjct: 1   MAKLSTDELLDAFKEMTLVELSEFVKKFEEEFDVEAAAPVAAVAAAPAAVAAAEEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VVL       KKI VIK VRA+T LGL EAK LV+ AP ++   +SK++A + K  LE+
Sbjct: 61  TVVLSAV--GDKKIQVIKAVRALTKLGLAEAKGLVDGAPANVLENVSKEDAEKAKADLEE 118

Query: 119 AGATVELR 126
           AGATV L+
Sbjct: 119 AGATVTLK 126


>gi|85084674|ref|XP_957360.1| hypothetical protein NCU06469 [Neurospora crassa OR74A]
 gi|28918450|gb|EAA28124.1| predicted protein [Neurospora crassa OR74A]
          Length = 176

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 45/134 (33%), Positives = 71/134 (52%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----------VVAPVAAEAGSA 51
            I +IV+++S+LTL+E +EL   L+    +                         EA  A
Sbjct: 43  KIAAIVDQISTLTLLETSELVSSLKSRLNIPDLPVGGFAAAAPAAAPAAAPAEEEEAAPA 102

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           A+EKT F + L+ FD    K  VIKEV+ +  L L E+K+ VESAPK +K  + K++A +
Sbjct: 103 AAEKTLFTLKLEKFDAAA-KPKVIKEVKNLLGLSLVESKKFVESAPKVMKESVPKEDAEK 161

Query: 112 MKKKLEDAGATVEL 125
           +   +++ GATV +
Sbjct: 162 IVAAMKELGATVTM 175


>gi|254428263|ref|ZP_05041970.1| ribosomal protein L7/L12 [Alcanivorax sp. DG881]
 gi|196194432|gb|EDX89391.1| ribosomal protein L7/L12 [Alcanivorax sp. DG881]
          Length = 125

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  EL + +E+++GV+A+A V+     A    +AA E+TEF+VVL G
Sbjct: 6   EDILGAIADMSVMDLVELIEAMEEKFGVTAAAAVAAAPAAAGGEAAAAEEQTEFDVVLTG 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F    KK+ VIK VR +T LGLKEAKELVE AP  +K G +KDEA E+KKK+E+AG T E
Sbjct: 66  F--GDKKVGVIKAVREVTGLGLKEAKELVEGAPAPVKEGAAKDEAEEIKKKIEEAGGTAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|148284107|ref|YP_001248197.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Boryong]
 gi|146739546|emb|CAM79275.1| 50S ribosomal protein L7/L12 [Orientia tsutsugamushi str. Boryong]
          Length = 129

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N++  V+ LS+ ++IE  EL+K LE+EWGVS+      VA   A    +  EK EF+V+L
Sbjct: 8   NVKKAVDVLSTFSVIELLELTKVLEEEWGVSSIPSNIPVATAMAPVQESEEEKNEFDVIL 67

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                P+KK+ VIK V+ IT L LKEAKE+VESAPK +K  +SK EA ++K +LE+ GA 
Sbjct: 68  ATV--PEKKVDVIKIVKNITGLALKEAKEMVESAPKVIKASISKAEAEDIKSQLENVGAK 125

Query: 123 VELR 126
           VEL+
Sbjct: 126 VELK 129


>gi|260940056|ref|XP_002614328.1| hypothetical protein CLUG_05814 [Clavispora lusitaniae ATCC 42720]
 gi|238852222|gb|EEQ41686.1| hypothetical protein CLUG_05814 [Clavispora lusitaniae ATCC 42720]
          Length = 166

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 49/130 (37%), Positives = 74/130 (56%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------K 55
            I  IV+++S+LTL+E + L   L+    +S  A  +  A  AA A     E       K
Sbjct: 37  KISQIVDQISTLTLLETSALITELKTRLNISDIALPAAGAGPAAPAAPVEEEVQEVVEEK 96

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           T F + L+ F D K K  +IKEV+++  L L E+K+ VE+APK LK  ++K++A+++K  
Sbjct: 97  TIFSIKLESF-DAKAKPKIIKEVKSLLGLSLVESKKFVEAAPKVLKENVAKEDADKIKAT 155

Query: 116 LEDAGATVEL 125
           LE  GA V L
Sbjct: 156 LEGLGAKVSL 165


>gi|11467025|ref|NP_041932.1| ribosomal protein L12 [Euglena gracilis]
 gi|400984|sp|P31915|RK12_EUGGR RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|415775|emb|CAA50119.1| ribosomal protein L12 [Euglena gracilis]
          Length = 131

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 52/130 (40%), Positives = 82/130 (63%), Gaps = 6/130 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA-----EAGSAASEKT 56
           +  + I+E+L  +TL+EA EL K++E  +GV A+  +S      +        +   EKT
Sbjct: 3   TETDEILERLKKITLLEAYELVKQIENTFGVDATIALSASNTNPSILPSKADETVVEEKT 62

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V+++      K+I VIK VR++T LGLKEAK+L+ES PK +   +SK+ A E KK L
Sbjct: 63  EFDVIIQEV-PSAKRINVIKTVRSLTTLGLKEAKDLIESVPKVVCEAVSKEVAEETKKLL 121

Query: 117 EDAGATVELR 126
           E+AGA++ ++
Sbjct: 122 EEAGASIIIK 131


>gi|313206999|ref|YP_004046176.1| LSU ribosomal protein l12p [Riemerella anatipestifer DSM 15868]
 gi|312446315|gb|ADQ82670.1| LSU ribosomal protein L12P [Riemerella anatipestifer DSM 15868]
 gi|325335567|gb|ADZ11841.1| Ribosomal protein L7/L12 [Riemerella anatipestifer RA-GD]
          Length = 122

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL++ L+ E+G+  +A   V    A  AG AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELAQILKDEYGIEPAAATVVA--AAGGAGEAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+A++K V+ +T  GLKEAK++V+ AP  +K G+SKDEA  +KK+LE+AG
Sbjct: 59  ILKS--AGASKLAIVKLVKDLTGAGLKEAKDIVDGAPAPIKEGVSKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|332169096|gb|AEE18351.1| ribosomal protein L7/L12 [Krokinobacter diaphorus 4H-3-7-5]
          Length = 123

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 83/126 (65%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A   V    A     AA EK+EF+V
Sbjct: 1   MADLKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAVVAG-PAGAGAEAAEEKSEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLK+AKELV++AP  +K G+SKDEA  +K +LE+AG
Sbjct: 60  ILKA--AGSSKLAVVKLVKELTGAGLKDAKELVDNAPSPIKEGVSKDEAEALKAQLEEAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AEVELK 123


>gi|197104683|ref|YP_002130060.1| 50S ribosomal protein L7/L12 [Phenylobacterium zucineum HLK1]
 gi|226733717|sp|B4R8K4|RL7_PHEZH RecName: Full=50S ribosomal protein L7/L12
 gi|196478103|gb|ACG77631.1| 50S ribosomal protein L7/L12 [Phenylobacterium zucineum HLK1]
          Length = 128

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           M+N+E +VE LS+LT++EAAELSK LE++WGVSA+APV+V A  AA  G AA     +TE
Sbjct: 1   MANLEKLVEDLSALTVLEAAELSKMLEEKWGVSAAAPVAVAAAPAAGGGEAAPAGEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F VVL       KKI VIKEVR +  DLGLKEAK+LVE AP+++K  +SK EA E+KKKL
Sbjct: 61  FTVVLTA--GGDKKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVKENVSKQEAEEIKKKL 118

Query: 117 EDAGATVELR 126
           E+AGA+V+++
Sbjct: 119 EEAGASVQIK 128


>gi|58336708|ref|YP_193293.1| 50S ribosomal protein L7/L12 [Lactobacillus acidophilus NCFM]
 gi|75433027|sp|Q5FM12|RL7_LACAC RecName: Full=50S ribosomal protein L7/L12
 gi|58254025|gb|AAV42262.1| 50S ribosomal protein L7-L12 [Lactobacillus acidophilus NCFM]
          Length = 120

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 86/124 (69%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E+L   +++E  +L K +E E+ V+A+APV      AA A  AA  K+ F+V L
Sbjct: 4   DTEKIIEELKGASILELNDLVKAIEDEFDVTAAAPV-----AAAGAAGAAEAKSSFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKVVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V L+
Sbjct: 117 VTLK 120


>gi|218886549|ref|YP_002435870.1| 50S ribosomal protein L7/L12 [Desulfovibrio vulgaris str. 'Miyazaki
           F']
 gi|226693629|sp|P02393|RL7_DESVM RecName: Full=50S ribosomal protein L7/L12
 gi|218757503|gb|ACL08402.1| ribosomal protein L7/L12 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 127

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +VE ++++T++E +E  K LE+++GVSA+AP   +        + A E KTEF+V+LK
Sbjct: 7   EQVVEFIANMTVLELSEFIKELEEKFGVSAAAPAMAMVAAGPAEAAPAEEEKTEFDVILK 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+ V+ AP +LK  +SK+EA E KK+L +AGA V
Sbjct: 67  A--AGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAVSKEEAEEAKKQLVEAGAEV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|118602789|ref|YP_904004.1| 50S ribosomal protein L7/L12 [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
 gi|166222205|sp|A1AX76|RL7_RUTMC RecName: Full=50S ribosomal protein L7/L12
 gi|118567728|gb|ABL02533.1| LSU ribosomal protein L12P [Candidatus Ruthia magnifica str. Cm
           (Calyptogena magnifica)]
          Length = 125

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 85/128 (66%), Gaps = 5/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E I+  ++ ++++   EL   +E+++GVSA+   +    VA        EK EF
Sbjct: 1   MAKLTNEDILNAIADMSVMNVVELVSAMEEKFGVSAAPVAAPPV-VADTIDDVVVEKDEF 59

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L  F   KKK+AVIK  R+IT LGLKEAK++VESAP  +K G SK EA +++K+LE+
Sbjct: 60  DVMLTSF--GKKKVAVIKMARSITGLGLKEAKDMVESAPVVIKEGASKVEAEDIQKQLEE 117

Query: 119 AGATVELR 126
           AGA+VEL+
Sbjct: 118 AGASVELK 125


>gi|325182047|emb|CCA16500.1| 50S ribosomal protein L7/L12 putative [Albugo laibachii Nc14]
          Length = 183

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 47/121 (38%), Positives = 65/121 (53%), Gaps = 5/121 (4%)

Query: 9   EKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA----AEAGSAASEKTEFEVVLKG 64
           + +  +  +E AELS  ++   G+S  A             A A     EKT F+V L  
Sbjct: 63  DMILQMNQLEIAELSWAIQDRLGISDDAFAMGSGDSEMQTDAPAEEKKEEKTTFDVKLAS 122

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F D K KI VIKE+R +T LGLKEAKELVE AP  +K  ++K+EA  +  KL++ G    
Sbjct: 123 F-DAKSKIKVIKEIRTLTGLGLKEAKELVEGAPSVVKKNVTKEEAESILAKLKECGGVAA 181

Query: 125 L 125
           +
Sbjct: 182 M 182


>gi|295401930|ref|ZP_06811893.1| ribosomal protein L7/L12 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312109251|ref|YP_003987567.1| ribosomal protein L7/L12 [Geobacillus sp. Y4.1MC1]
 gi|294976060|gb|EFG51675.1| ribosomal protein L7/L12 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311214352|gb|ADP72956.1| ribosomal protein L7/L12 [Geobacillus sp. Y4.1MC1]
          Length = 122

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 65/122 (53%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA   +AA  KTEF+V+L  
Sbjct: 4   EQIIEAIKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGGDAAAE-KTEFDVILA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+LV++ PK LK G+SK+EA E+K KLE+ GA+VE
Sbjct: 62  -DAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEGVSKEEAEEIKAKLEEVGASVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|225850727|ref|YP_002730961.1| 50S ribosomal protein L7/L12 [Persephonella marina EX-H1]
 gi|254806387|sp|C0QQL5|RL7_PERMH RecName: Full=50S ribosomal protein L7/L12
 gi|225646362|gb|ACO04548.1| ribosomal protein L7/L12 [Persephonella marina EX-H1]
          Length = 127

 Score = 82.7 bits (203), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 68/123 (55%), Positives = 89/123 (72%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I E + ++T++E AEL K LE+E+GVSA+A V+        A  AA  EKTEF+V+L+
Sbjct: 7   EEIKEAIKNMTVLELAELVKELEEEFGVSAAAMVAAAPAAGGAAAGAAAEEKTEFDVILQ 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                 KKI VIK VR IT LGLKEAKELV+SAPK++K G+SK+EA + K KLE+AGATV
Sbjct: 67  S--PGDKKINVIKVVREITGLGLKEAKELVDSAPKAIKEGVSKEEAEQFKAKLEEAGATV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|148653834|ref|YP_001280927.1| 50S ribosomal protein L7/L12 [Psychrobacter sp. PRwf-1]
 gi|172048570|sp|A5WH36|RL7_PSYWF RecName: Full=50S ribosomal protein L7/L12
 gi|148572918|gb|ABQ94977.1| LSU ribosomal protein L12P [Psychrobacter sp. PRwf-1]
          Length = 125

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++  ++ +++++  EL   +E+++GV+A+A V+     AA   +AA EK EF+V+L  
Sbjct: 6   EDVLNAIAEMSVMDIVELISEMEEKFGVTAAAAVAAAPAAAAAGAAAAEEKDEFDVILAS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F    KK+ VIK VR  T LGLKEAKELVE AP  +K G +K EA E+KKKLE+AGATVE
Sbjct: 66  F--GDKKVGVIKAVREATGLGLKEAKELVEGAPAPIKEGANKVEAEELKKKLEEAGATVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|242209089|ref|XP_002470393.1| candidate 60S ribosomal protein L7/L12-like protein [Postia
           placenta Mad-698-R]
 gi|220730563|gb|EED84418.1| candidate 60S ribosomal protein L7/L12-like protein [Postia
           placenta Mad-698-R]
          Length = 189

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 49/133 (36%), Positives = 73/133 (54%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS---------ASAPVSVVAPVAAEAGSAAS 53
            +  IV+++S LTL++AA+L   L+    +          A A  +     A EA     
Sbjct: 57  KLNKIVDEISGLTLLQAADLVTLLKSRLNIQEIAMPAAAPAPAAGASAGGEAEEAQEKPK 116

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
           EKT F V L+ FD    K  +I+EV+A+  +L L EAK+ VES P+ LK  LSK++A ++
Sbjct: 117 EKTIFNVKLESFDATA-KPKIIREVKAMVPNLTLIEAKKFVESLPQILKENLSKEDAEKL 175

Query: 113 KKKLEDAGATVEL 125
           +K   D GA V+L
Sbjct: 176 QKTFTDLGAVVKL 188


>gi|291541519|emb|CBL14629.1| LSU ribosomal protein L12P [Ruminococcus bromii L2-63]
          Length = 125

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I +I+E+L  LT++E +EL   +E E+GVSA+A V+V  P A    +AA  +TEF+VVL
Sbjct: 5   KITAIIEELKGLTVLELSELVHAVEDEFGVSAAAAVAVAGPAADGGAAAAE-QTEFDVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K       KIAVIK VR +T LGLKEAK LV+ APK+LK G+SK++A  +K KLE+AGA 
Sbjct: 64  KA--AGGNKIAVIKVVREVTGLGLKEAKALVDGAPKALKEGVSKEDAEAIKTKLEEAGAE 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|282899207|ref|ZP_06307181.1| Ribosomal protein L7/L12 [Cylindrospermopsis raciborskii CS-505]
 gi|281195890|gb|EFA70813.1| Ribosomal protein L7/L12 [Cylindrospermopsis raciborskii CS-505]
          Length = 130

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 64/126 (50%), Positives = 90/126 (71%), Gaps = 5/126 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA----PVAAEAGSAASEKTEFEV 60
           + I+E+L SLTL+EAAEL K++E+ +GVSA+APV  +A    P  A A     E+TEF+V
Sbjct: 6   DQILEQLKSLTLLEAAELVKQIEEAFGVSAAAPVGGMAVIAAPGGAAAAEVVEEQTEFDV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+      KKIAV+K VR IT LGLKEAKELVES PK++K G++K+ A ++ KK+ +AG
Sbjct: 66  ILQEV-PADKKIAVLKIVREITGLGLKEAKELVESTPKAVKEGVNKEAAEDISKKITEAG 124

Query: 121 ATVELR 126
             V ++
Sbjct: 125 GKVAIK 130


>gi|225164278|ref|ZP_03726549.1| ribosomal protein L7/L12 [Opitutaceae bacterium TAV2]
 gi|224801120|gb|EEG19445.1| ribosomal protein L7/L12 [Opitutaceae bacterium TAV2]
          Length = 124

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 72/128 (56%), Positives = 90/128 (70%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           MSNI  + ++E LS+  ++E A L K LE +WGVSA+A V+     AA A + A EKTEF
Sbjct: 1   MSNITKDQVIEWLSAQPVLELAALVKDLEAKWGVSAAAAVAAA--PAAAAAAPAEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L   +    KI VIKEVRAIT LGLKEAK+LVE APK +K G SK +A E+KKKLE 
Sbjct: 59  DVIL--ANAGANKIGVIKEVRAITGLGLKEAKDLVEGAPKPVKEGASKADAEEIKKKLEA 116

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 117 AGAKVELK 124


>gi|53715478|ref|YP_101470.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis YCH46]
 gi|60683451|ref|YP_213595.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis NCTC 9343]
 gi|253566657|ref|ZP_04844110.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_2_5]
 gi|255011634|ref|ZP_05283760.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis 3_1_12]
 gi|265767535|ref|ZP_06095201.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_16]
 gi|313149469|ref|ZP_07811662.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis 3_1_12]
 gi|81313501|sp|Q5L896|RL7_BACFN RecName: Full=50S ribosomal protein L7/L12
 gi|81608231|sp|Q64NJ6|RL7_BACFR RecName: Full=50S ribosomal protein L7/L12
 gi|52218343|dbj|BAD50936.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis YCH46]
 gi|60494885|emb|CAH09692.1| putative 50S ribosomal protein L7/L12 [Bacteroides fragilis NCTC
           9343]
 gi|251944829|gb|EES85304.1| 50S ribosomal protein L7/L12 [Bacteroides sp. 3_2_5]
 gi|263252840|gb|EEZ24352.1| ribosomal protein L7/L12 [Bacteroides sp. 2_1_16]
 gi|301164935|emb|CBW24496.1| putative 50S ribosomal protein L7/L12 [Bacteroides fragilis 638R]
 gi|313138236|gb|EFR55596.1| 50S ribosomal protein L7/L12 [Bacteroides fragilis 3_1_12]
          Length = 124

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 83/126 (65%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA EK+ F+V
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAEEKSSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK       K+ V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+AG
Sbjct: 61  VLKS--AGAAKLQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|238790615|ref|ZP_04634380.1| 50S ribosomal protein L7/L12 [Yersinia frederiksenii ATCC 33641]
 gi|238721284|gb|EEQ12959.1| 50S ribosomal protein L7/L12 [Yersinia frederiksenii ATCC 33641]
          Length = 122

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 85/122 (69%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  AA E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AVAAEAAEEQTEFNVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AGA+VE
Sbjct: 63  F--GDNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|238785549|ref|ZP_04629530.1| 50S ribosomal protein L7/L12 [Yersinia bercovieri ATCC 43970]
 gi|238794960|ref|ZP_04638557.1| 50S ribosomal protein L7/L12 [Yersinia intermedia ATCC 29909]
 gi|238798662|ref|ZP_04642136.1| 50S ribosomal protein L7/L12 [Yersinia mollaretii ATCC 43969]
 gi|238713534|gb|EEQ05565.1| 50S ribosomal protein L7/L12 [Yersinia bercovieri ATCC 43970]
 gi|238717480|gb|EEQ09322.1| 50S ribosomal protein L7/L12 [Yersinia mollaretii ATCC 43969]
 gi|238725718|gb|EEQ17275.1| 50S ribosomal protein L7/L12 [Yersinia intermedia ATCC 29909]
 gi|318607539|emb|CBY29037.1| LSU ribosomal protein L7/L12 (P1/P2) [Yersinia enterocolitica
           subsp. palearctica Y11]
 gi|330863590|emb|CBX73702.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica W22703]
          Length = 122

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  A  E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AAAAEAVEEQTEFNVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AGA+VE
Sbjct: 63  F--GDNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|224081|prf||1010169A protein L7/L12
          Length = 126

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +VE ++++T++E +E  K LE+++GVSA+AP  +         + A E KTEF+V+LK
Sbjct: 6   EQVVEFIANMTVLELSEFIKELEEKFGVSAAAPAMMAVAAGPAEAAPAEEEKTEFDVILK 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+ V+ AP +LK  +SK+EA E KK+L +AGA V
Sbjct: 66  A--AGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAVSKEEAEEAKKQLVEAGAEV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|289551660|ref|YP_003472564.1| LSU ribosomal protein L7/L12 (L23e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315659119|ref|ZP_07911984.1| ribosomal protein L7/L12 [Staphylococcus lugdunensis M23590]
 gi|289181191|gb|ADC88436.1| LSU ribosomal protein L7/L12 (L23e) [Staphylococcus lugdunensis
           HKU09-01]
 gi|315495843|gb|EFU84173.1| ribosomal protein L7/L12 [Staphylococcus lugdunensis M23590]
          Length = 122

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 90/126 (71%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K GL+KDEA ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEGLAKDEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|237747358|ref|ZP_04577838.1| LSU ribosomal protein L7/L12 [Oxalobacter formigenes HOxBLS]
 gi|229378709|gb|EEO28800.1| LSU ribosomal protein L7/L12 [Oxalobacter formigenes HOxBLS]
          Length = 126

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I+E + +++++E  +L K  E+++GVSA+A         A AG AA  E+TEF VVL 
Sbjct: 6   EDILEAVGAMSVMELNDLVKAFEEKFGVSAAAMAVAGPAGGAAAGGAAAEEQTEFTVVLA 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+AVIK VR IT LGLKEAK++V+SAPK +K G+SK +A E KKKLEDAGA V
Sbjct: 66  EF--GANKVAVIKAVREITGLGLKEAKDMVDSAPKPVKEGVSKADAEEAKKKLEDAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EIK 126


>gi|222056713|ref|YP_002539075.1| ribosomal protein L7/L12 [Geobacter sp. FRC-32]
 gi|254806375|sp|B9M6V3|RL7_GEOSF RecName: Full=50S ribosomal protein L7/L12
 gi|221566002|gb|ACM21974.1| ribosomal protein L7/L12 [Geobacter sp. FRC-32]
          Length = 126

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 63/121 (52%), Positives = 88/121 (72%), Gaps = 2/121 (1%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            ++  +  ++++E AE+ K LE+++GVSA+APV+V A     A  AA EKTEF+V+LK  
Sbjct: 8   DVISFIEKMSVLELAEMVKELEEKFGVSAAAPVAVAAVAGPAAAEAAEEKTEFDVILKA- 66

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                KI VIK VRA+T LGLKEAK+LV+ AP+ LKTG+SK+EA E KK+L +AGA VE+
Sbjct: 67  -AGANKIGVIKVVRALTSLGLKEAKDLVDGAPQPLKTGVSKEEAEEAKKQLVEAGAEVEI 125

Query: 126 R 126
           +
Sbjct: 126 K 126


>gi|320333431|ref|YP_004170142.1| 50S ribosomal protein L7/L12 [Deinococcus maricopensis DSM 21211]
 gi|319754720|gb|ADV66477.1| 50S ribosomal protein L7/L12 [Deinococcus maricopensis DSM 21211]
          Length = 120

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 82/124 (66%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++++++L  LT++E A+L   L++ WGV+A+         AA A +   EKTEF+VVL
Sbjct: 4   DKQALIDQLGQLTIMELADLIDGLKETWGVTAAVAA----GPAAAAAAPVEEKTEFDVVL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D   +KI VIKE+RAIT LGLKEAK+L E     +K G+SK++A + K +LE AGA 
Sbjct: 60  --VDAGAQKINVIKELRAITGLGLKEAKDLSEKGGN-VKEGVSKEDAEKFKAQLEGAGAR 116

Query: 123 VELR 126
           VEL+
Sbjct: 117 VELK 120


>gi|23004112|ref|ZP_00047613.1| COG0222: Ribosomal protein L7/L12 [Magnetospirillum magnetotacticum
           MS-1]
          Length = 126

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 70/126 (55%), Positives = 93/126 (73%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA  G+AA+ + + E 
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGGGAAAAAEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIKEVRAIT LGLKEAK+LVE APK +K  ++KDEA ++K +LE AG
Sbjct: 61  TVVLASAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEAVAKDEAEKIKAQLEKAG 120

Query: 121 ATVELR 126
             VEL+
Sbjct: 121 GKVELK 126


>gi|170077647|ref|YP_001734285.1| ribosomal protein L7/L12 [Synechococcus sp. PCC 7002]
 gi|226734484|sp|B1XJG9|RL7_SYNP2 RecName: Full=50S ribosomal protein L7/L12
 gi|169885316|gb|ACA99029.1| ribosomal protein L7/L12 [Synechococcus sp. PCC 7002]
          Length = 128

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 68/127 (53%), Positives = 89/127 (70%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFE 59
           +  + I+EKL SLTL+EAAEL K++E+ +GVSA+APV   V+A   A A     EKTEF+
Sbjct: 3   ATTDEILEKLQSLTLLEAAELVKQIEETFGVSAAAPVGGMVMAAPGAAAAEEVEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L       KKIAV+K VR IT LGLKEAKE+VESAPK +K    K++A  +KK+LEDA
Sbjct: 63  VILDEV-PADKKIAVLKVVRGITGLGLKEAKEMVESAPKPIKEATGKEDAEAIKKQLEDA 121

Query: 120 GATVELR 126
           GA   ++
Sbjct: 122 GAKASVK 128


>gi|255534438|ref|YP_003094809.1| 50S ribosomal protein L7/L12 [Flavobacteriaceae bacterium 3519-10]
 gi|255340634|gb|ACU06747.1| LSU ribosomal protein L7/L12 (L23e) [Flavobacteriaceae bacterium
           3519-10]
          Length = 122

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL+  L+ E+G+  +A   V++  A     AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELATILKDEYGIEPAAAAVVMS--AGGGAEAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLKEAK++V+SAP  +KTG+SKDEA  +KK+LE+AG
Sbjct: 59  ILKA--AGGSKLAVVKLVKDLTGAGLKEAKDMVDSAPAPIKTGISKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VE++
Sbjct: 117 AEVEVK 122


>gi|261338309|ref|ZP_05966193.1| ribosomal protein L7/L12 [Bifidobacterium gallicum DSM 20093]
 gi|270276976|gb|EFA22830.1| ribosomal protein L7/L12 [Bifidobacterium gallicum DSM 20093]
          Length = 126

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+APV+ VA     A  A  EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAAAPGAAAPAEEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR IT LGL EAK LV+ APK +     K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRGITSLGLAEAKALVDGAPKPVLEHAKKEDAEKAKAQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|254432037|ref|ZP_05045740.1| ribosomal protein L7/L12 [Cyanobium sp. PCC 7001]
 gi|197626490|gb|EDY39049.1| ribosomal protein L7/L12 [Cyanobium sp. PCC 7001]
          Length = 127

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 89/126 (70%), Gaps = 2/126 (1%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-SVVAPVAAEAGSAASEKTEFEV 60
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+A    V+A   A A  AA EKTEF+V
Sbjct: 3   ATTDQILEQLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAAAPAAAAEAAEEKTEFDV 62

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L+ FD    KI V+K VR  T LGL +AK LVE+APK++K G++K +A  +KK +E+AG
Sbjct: 63  ILESFDAAA-KIKVLKAVREATGLGLGDAKSLVEAAPKAVKEGIAKADAEALKKAIEEAG 121

Query: 121 ATVELR 126
             V ++
Sbjct: 122 GKVSIK 127


>gi|198435209|ref|XP_002130924.1| PREDICTED: similar to mitochondrial ribosomal protein L12 [Ciona
           intestinalis]
          Length = 187

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 73/129 (56%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-----SEKTE 57
            I ++V+ +SSLTL E A+L++ L+    +  +  ++      A A  A       EKTE
Sbjct: 59  KIVNLVDSISSLTLREVADLNELLKSTLNIKDTPMMAAQVAAPAAAAEAEEKQAVPEKTE 118

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V L  F     KI +IK ++A+  +  L +AK+ VES P+ +K   SK+EA EMKK L
Sbjct: 119 FGVKLLEFSPAD-KIKLIKAIKAVKENFNLVQAKKFVESLPQIVKDEASKEEAEEMKKIL 177

Query: 117 EDAGATVEL 125
           E+AG  V++
Sbjct: 178 EEAGGKVDI 186


>gi|86608700|ref|YP_477462.1| 50S ribosomal protein L7/L12 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|109893809|sp|Q2JM48|RL7_SYNJB RecName: Full=50S ribosomal protein L7/L12
 gi|86557242|gb|ABD02199.1| ribosomal protein L7/L12 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 136

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 61/132 (46%), Positives = 95/132 (71%), Gaps = 10/132 (7%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--------- 54
           +  I+E+L +L+L+EA+EL K +E+ +GVSA+AP   +   A  A +AA+          
Sbjct: 6   VAKILEELKALSLLEASELVKAIEETFGVSAAAPAGGMVMAAPVAAAAAAPAAAPEPVEE 65

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           +T F+V+L+      KKIA++K VR +T LGLK+AK+LVE+APK +K G++K+EAN++KK
Sbjct: 66  QTAFDVILEAV-PADKKIAILKVVRELTGLGLKDAKDLVEAAPKPVKEGVAKEEANDIKK 124

Query: 115 KLEDAGATVELR 126
           KLE+AGATV+++
Sbjct: 125 KLEEAGATVKIK 136


>gi|108804982|ref|YP_644919.1| 50S ribosomal protein L12P [Rubrobacter xylanophilus DSM 9941]
 gi|123368028|sp|Q1AU21|RL7_RUBXD RecName: Full=50S ribosomal protein L7/L12
 gi|108766225|gb|ABG05107.1| LSU ribosomal protein L12P [Rubrobacter xylanophilus DSM 9941]
          Length = 128

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 86/125 (68%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVV 61
           E ++E + ++T++E +EL K LE+ +GVSA+A  +  A   A    AA+    KTEF+V+
Sbjct: 6   EELIEAIENMTVLELSELVKALEERFGVSATAVAAAPAAAGAAGAEAAAAEEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+  D   KKI VIKEVRA T LGLKEAK LV+ AP  +K GL K+EA  +K KLE+AGA
Sbjct: 66  LQ--DAGAKKIQVIKEVRAATGLGLKEAKALVDEAPNPVKEGLPKEEAEALKAKLEEAGA 123

Query: 122 TVELR 126
           TVEL+
Sbjct: 124 TVELK 128


>gi|262038199|ref|ZP_06011593.1| ribosomal protein L7/L12 [Leptotrichia goodfellowii F0264]
 gi|261747780|gb|EEY35225.1| ribosomal protein L7/L12 [Leptotrichia goodfellowii F0264]
          Length = 124

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (66%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N +  +E L ++T++E  E+ + +E+ +GVSA           A AGSA  EK+EF+V+L
Sbjct: 4   NKDQFIEDLKNMTVLELKEVVEAIEETFGVSAQPVAVAGGAAGAGAGSA-EEKSEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+ VIKEVRAIT LGLKEAKELVE+  K++K G+SK+EA  +K +LE AGAT
Sbjct: 63  --VSAGAAKLGVIKEVRAITGLGLKEAKELVEAGGKAVKEGVSKEEAEALKAQLEGAGAT 120

Query: 123 VELR 126
           VEL+
Sbjct: 121 VELK 124


>gi|156848768|ref|XP_001647265.1| hypothetical protein Kpol_1002p54 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156117950|gb|EDO19407.1| hypothetical protein Kpol_1002p54 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 187

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS----------AA 52
            I  IVE++S LTL+E + L K L+ +  +   A        A   G+            
Sbjct: 55  KISKIVEEISKLTLLETSSLIKELKTQLDIPDIAMPVAGVAAAPAGGAAAEEAAAEEEKP 114

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EK+ F + L+ F D K K  +IKE++ +  L L EAK+ VE+APK LK  ++KDEA ++
Sbjct: 115 QEKSVFGIKLESF-DAKSKPKIIKEIKNLLGLSLVEAKKFVEAAPKLLKENVAKDEAEKI 173

Query: 113 KKKLEDAGATVEL 125
           K  LE  G  V L
Sbjct: 174 KTTLEGLGGKVTL 186


>gi|315452939|ref|YP_004073209.1| 50S ribosomal protein L7 /L12 [Helicobacter felis ATCC 49179]
 gi|315131991|emb|CBY82619.1| 50S ribosomal protein L7 /L12 [Helicobacter felis ATCC 49179]
          Length = 124

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 76/122 (62%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ +  L+++E +EL K  E+++GVSA+ P  V       A  A  EKTEF VVL  
Sbjct: 6   EELLDYIGGLSVLELSELVKAFEEKFGVSAA-PTVVAGAGGGVAAEAVEEKTEFSVVLAE 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR IT LGLKEAKE  E  P  LK G++K+EA  +KKKLE+ GA  E
Sbjct: 65  T--GAEKIKVIKVVREITGLGLKEAKEATEKTPHVLKEGVNKEEAESIKKKLEEVGAKAE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|307823433|ref|ZP_07653662.1| ribosomal protein L7/L12 [Methylobacter tundripaludum SV96]
 gi|307735418|gb|EFO06266.1| ribosomal protein L7/L12 [Methylobacter tundripaludum SV96]
          Length = 122

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +S++T++E  +L   +E+++GVSA+  V+      A + +A  E+TEF+V++  
Sbjct: 6   EDILEAVSNMTVMEIVDLISAMEEKFGVSAAVAVAAA---PAASAAAVEEQTEFDVIMTS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   + K+AVIK VR IT LGLKEAK+ VE  P ++K  +SK EA ++KK+L DAGATVE
Sbjct: 63  F--GENKVAVIKAVRGITGLGLKEAKDAVEGVPTTVKEAVSKAEAEDVKKQLVDAGATVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|196233595|ref|ZP_03132436.1| ribosomal protein L7/L12 [Chthoniobacter flavus Ellin428]
 gi|196222265|gb|EDY16794.1| ribosomal protein L7/L12 [Chthoniobacter flavus Ellin428]
          Length = 128

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 64/128 (50%), Positives = 91/128 (71%), Gaps = 2/128 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA--SEKTEF 58
           M++  ++VE+LS LT++E A+L K+LE++WGVSA+APV+V A     A  AA   EKT F
Sbjct: 1   MADTNTLVEQLSGLTVLEVADLVKQLEEKWGVSAAAPVAVAAVGGGAAAPAAAAEEKTSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+LK  D  KK   + +   A+  LGL EAK LVE APKSLK G++K+EA ++KKK+E 
Sbjct: 61  DVILKAADAAKKIAIIKEVRAAVPGLGLAEAKALVEGAPKSLKEGVTKEEAEDIKKKIEA 120

Query: 119 AGATVELR 126
           AG T+E++
Sbjct: 121 AGGTIEIK 128


>gi|161506945|ref|YP_001576899.1| 50S ribosomal protein L7/L12 [Lactobacillus helveticus DPC 4571]
 gi|260102432|ref|ZP_05752669.1| ribosomal protein L7/L12 [Lactobacillus helveticus DSM 20075]
 gi|172048177|sp|A8YTF2|RL7_LACH4 RecName: Full=50S ribosomal protein L7/L12
 gi|160347934|gb|ABX26608.1| 50S ribosomal protein L7-L12 [Lactobacillus helveticus DPC 4571]
 gi|260083752|gb|EEW67872.1| ribosomal protein L7/L12 [Lactobacillus helveticus DSM 20075]
 gi|328462869|gb|EGF34718.1| 50S ribosomal protein L7/L12 [Lactobacillus helveticus MTCC 5463]
          Length = 120

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 87/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + + I+E+L   +++E  +L K +E E+ V+A+APV      AA A  A + K+EF+V L
Sbjct: 4   DTDKIIEELKGASILELNDLVKAIEDEFDVTAAAPV-----AAAGAADAGAAKSEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V L+
Sbjct: 117 VTLK 120


>gi|260063558|ref|YP_003196638.1| 50S ribosomal protein L7/L12 [Robiginitalea biformata HTCC2501]
 gi|88783002|gb|EAR14176.1| 50S ribosomal protein L7/L12 [Robiginitalea biformata HTCC2501]
          Length = 127

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 57/129 (44%), Positives = 87/129 (67%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           M++++   E+L +LT+ E  EL+  L++E+G+  +A    VA  AA  G A      +TE
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELADILKEEYGIEPAAAAVAVAGGAAAGGDAGEAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       K+AV+K V+ +T LGLK+AK++V+SAPK++K  +SKDEA  +KK LE
Sbjct: 61  FDVILKA--AGGSKLAVVKLVKELTGLGLKDAKDIVDSAPKAVKEAVSKDEAEGIKKSLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAEVELK 127


>gi|332159911|ref|YP_004296488.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|325664141|gb|ADZ40785.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 121

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 7/122 (5%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A           A  A  E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVA-----AGPAAAEAVEEQTEFNVVLAS 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AGA+VE
Sbjct: 62  F--GDNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|307128567|ref|YP_003880597.1| 50S ribosomal protein L7/L12 [Candidatus Sulcia muelleri CARI]
 gi|306483029|gb|ADM89899.1| 50S ribosomal protein L7/L12 [Candidatus Sulcia muelleri CARI]
          Length = 124

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 50/125 (40%), Positives = 77/125 (61%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ +  KL +LT+ E  ELS  L+K++G+ ++   S       +      EKT F V
Sbjct: 1   MTDLKKLANKLVNLTVKEVNELSNLLKKDYGLVSNKISSEEQITNNKNLETKVEKTTFNV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K ++ IT  GLKE+KELV+S PK++K  L+K+EA  +KKK E  G
Sbjct: 61  ILKS--SGPSKLAVVKLIKEITGKGLKESKELVDSVPKTIKESLNKEEAELLKKKFEYIG 118

Query: 121 ATVEL 125
           A +EL
Sbjct: 119 AEIEL 123


>gi|303256440|ref|ZP_07342454.1| ribosomal protein L7/L12 [Burkholderiales bacterium 1_1_47]
 gi|331000381|ref|ZP_08324061.1| ribosomal protein L7/L12 [Parasutterella excrementihominis YIT
           11859]
 gi|302859931|gb|EFL83008.1| ribosomal protein L7/L12 [Burkholderiales bacterium 1_1_47]
 gi|329572087|gb|EGG53756.1| ribosomal protein L7/L12 [Parasutterella excrementihominis YIT
           11859]
          Length = 125

 Score = 82.3 bits (202), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++S++++E +EL K +E+++GVSA+A    VA  A  A + A EK+EF+VVLK 
Sbjct: 6   EEILDAIASMSVLEVSELIKMMEEKFGVSAAAAAVAVAAPAGGAAAPAEEKSEFDVVLKE 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR +T LGLKEAK+LV+ APK++K GL+K +A E +KKLE AGA VE
Sbjct: 66  I--GANKVQVIKAVRELTGLGLKEAKDLVDGAPKTVKEGLAKADAEEAQKKLEAAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|326334488|ref|ZP_08200699.1| 50S ribosomal protein L7/L12 [Capnocytophaga sp. oral taxon 338
           str. F0234]
 gi|325693257|gb|EGD35185.1| 50S ribosomal protein L7/L12 [Capnocytophaga sp. oral taxon 338
           str. F0234]
          Length = 125

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA   A  G  A+  KTEF+
Sbjct: 1   MADLKNFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAGPAAGGGEAAAEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK +A  +KK LE+A
Sbjct: 61  VILKS--AGANKLAVVKLVKDLTGLGLKEAKEMVDGAPSKVKEGVSKADAENLKKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|254505210|ref|ZP_05117361.1| ribosomal protein L7/L12 [Labrenzia alexandrii DFL-11]
 gi|222441281|gb|EEE47960.1| ribosomal protein L7/L12 [Labrenzia alexandrii DFL-11]
          Length = 124

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 82/126 (65%), Positives = 103/126 (81%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++E +VE+LS+LT++EAAELSK LE++WGVSA+APV+V A       +AA EKTEF+V
Sbjct: 1   MADLEKLVEELSALTVMEAAELSKLLEEKWGVSAAAPVAVAAAAGGGEAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KKI VIKEVRAIT LGLKEAKELVESAPK++K  +SKDEA E+KKKLE+AG
Sbjct: 61  VLAS--AGDKKINVIKEVRAITGLGLKEAKELVESAPKAVKEAVSKDEAEELKKKLEEAG 118

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 119 ASVELK 124


>gi|109940141|sp|O22386|RK12_ORYSJ RecName: Full=50S ribosomal protein L12, chloroplastic; AltName:
           Full=CL12; Flags: Precursor
 gi|4176424|dbj|BAA37171.1| ribosomal protein L12 [Oryza sativa Japonica Group]
          Length = 185

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 55/130 (42%), Positives = 78/130 (60%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-------EK 55
            +  + + ++ LTL EA  L   L++  GVSA+A        A  AG A +       EK
Sbjct: 56  KVLELGDAIAGLTLEEARGLVDHLQERLGVSAAAFAPAAVVAAPGAGGAGAAADEAPAEK 115

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+VV++       +IA IK VRA+T+L LKEAK+L+E  PK +K G+SKDEA + KK+
Sbjct: 116 TEFDVVIEEVPSSA-RIASIKVVRALTNLALKEAKDLIEGLPKKVKEGVSKDEAEDAKKQ 174

Query: 116 LEDAGATVEL 125
           LE+ GA V +
Sbjct: 175 LEEVGAKVSI 184


>gi|262197200|ref|YP_003268409.1| ribosomal protein L7/L12 [Haliangium ochraceum DSM 14365]
 gi|262080547|gb|ACY16516.1| ribosomal protein L7/L12 [Haliangium ochraceum DSM 14365]
          Length = 127

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 59/129 (45%), Positives = 87/129 (67%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTE 57
           M++I  + ++E LS LT+++  +L++ LE++WGV A+       P A   G+A   E+TE
Sbjct: 1   MADITQDQVIEYLSGLTVMDLVKLTESLEEKWGVKAAPVAVAGVPAADGGGAAAEEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V+LKG     +KI  IK VR IT LGLK+AK+LV+ APK +K  + KDEANE+ +KL+
Sbjct: 61  FTVILKG--AGAQKIQTIKAVREITGLGLKDAKDLVDGAPKEVKADIPKDEANEIAEKLK 118

Query: 118 DAGATVELR 126
            AGA VE++
Sbjct: 119 AAGAEVEVK 127


>gi|154253169|ref|YP_001413993.1| 50S ribosomal protein L7/L12 [Parvibaculum lavamentivorans DS-1]
 gi|171769621|sp|A7HWQ3|RL7_PARL1 RecName: Full=50S ribosomal protein L7/L12
 gi|154157119|gb|ABS64336.1| ribosomal protein L7/L12 [Parvibaculum lavamentivorans DS-1]
          Length = 123

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 76/126 (60%), Positives = 97/126 (76%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A   +AA E+TEF+V
Sbjct: 1   MTDLAKIVEDLSNLTVLEAAELSKMLEEKWGVSAAAPVAVAA-AGAAPAAAAEEQTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKI VIKEVRAIT LGLKEAK+LVE APK++K   SKDEA ++K +LE AG
Sbjct: 60  ILAA--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKTVKEAASKDEAAKIKAQLEKAG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|50425559|ref|XP_461375.1| DEHA2F23738p [Debaryomyces hansenii CBS767]
 gi|49657044|emb|CAG89781.1| DEHA2F23738p [Debaryomyces hansenii]
          Length = 170

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 46/130 (35%), Positives = 72/130 (55%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------K 55
            I +IV+++S+LTL+E + L   L++   +   +  +     AA A     E       K
Sbjct: 41  KISTIVDQISTLTLLETSALVTELKERLNIPDISFPAAGGAPAAPAAPVEEEVQEEVEEK 100

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           T F + L+ F D K K  +IKEV+ +  L L E+K+ VE+APK LK  ++K++A ++K  
Sbjct: 101 TIFSIKLESF-DAKSKPKIIKEVKGLLGLSLVESKKFVEAAPKVLKENVAKEDAEKIKAA 159

Query: 116 LEDAGATVEL 125
           LE  GA V L
Sbjct: 160 LEGLGAKVAL 169


>gi|254566743|ref|XP_002490482.1| Protein associated with the mitochondrial nucleoid [Pichia pastoris
           GS115]
 gi|238030278|emb|CAY68201.1| Protein associated with the mitochondrial nucleoid [Pichia pastoris
           GS115]
          Length = 160

 Score = 81.9 bits (201), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 49/132 (37%), Positives = 71/132 (53%), Gaps = 9/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSA--------SAPVSVVAPVAAEAGSAAS 53
           + I +IV++++ L L+E + L   L+    ++         +      APV  E      
Sbjct: 29  AKITNIVDQIAQLNLLETSALISELKTRLNIADIAFPAAGAAPAQQAAAPVEEEVKEEVE 88

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F V L+ F D K K  VIKEV+++  L L EAK+ VESAPK LK  + K++A ++K
Sbjct: 89  EKTIFAVKLESF-DTKSKAKVIKEVKSLLGLSLVEAKKFVESAPKVLKENVPKEDAEKIK 147

Query: 114 KKLEDAGATVEL 125
             LE  GA V L
Sbjct: 148 GVLEGLGAKVTL 159


>gi|260577193|ref|ZP_05845169.1| ribosomal protein L7/L12 [Rhodobacter sp. SW2]
 gi|259020573|gb|EEW23893.1| ribosomal protein L7/L12 [Rhodobacter sp. SW2]
          Length = 124

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 84/127 (66%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVS-ASAPVSVVAPVAAEAGSAASEKTEFE 59
           M+++  + E +  LTL++A EL   L+ ++G+  A+     VA  AA A +   E+TEF+
Sbjct: 1   MTDLNKLAESIVGLTLLQAQELKTILKDKYGIEPAAGAAVAVAGPAAAAAAPVEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   +    KI VIKEVRAIT LGLKEAK+LVE+  K +K G+SK +A   KKKLE+A
Sbjct: 61  VVLT--EAGPNKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEGVSKADAEGFKKKLEEA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|299135269|ref|ZP_07028460.1| ribosomal protein L7/L12 [Afipia sp. 1NLS2]
 gi|298590246|gb|EFI50450.1| ribosomal protein L7/L12 [Afipia sp. 1NLS2]
          Length = 125

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 77/127 (60%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ IV+ LSSLT++EAAEL+K LE++WGVSA+A V+V A   A  G+AA  EKTEF+
Sbjct: 1   MADLQKIVDDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPGAGGGAAAAEEKTEFQ 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK LK G++KDEA ++K  LE  
Sbjct: 61  VVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPLKEGVAKDEAEKIKATLEKV 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|260909711|ref|ZP_05916405.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 472 str. F0295]
 gi|260636136|gb|EEX54132.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 472 str. F0295]
          Length = 126

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 53/126 (42%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA  + +   
Sbjct: 1   MADIKAIAEELVNLTVKEVNELANVLKEEYGIEPAAAAVAVAAGPAAAGAAAGAEEKSSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    K+ V+K V+    LGLKEAK+LV+  P +LK G+SKDEA  +KK +E+AG
Sbjct: 61  DVVLVDAGAAKLQVVKAVKEACGLGLKEAKDLVDGVPSTLKEGMSKDEAENLKKAIEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|260905743|ref|ZP_05914065.1| 50S ribosomal protein L7/L12 [Brevibacterium linens BL2]
          Length = 126

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 60/128 (46%), Positives = 87/128 (67%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E ++E    LTLIE ++  K+ E+ + V A+AP + VA   A A  AA E+TEF
Sbjct: 1   MAKLTPEELIEGFKELTLIELSDFVKKFEEVFEVEAAAPAAAVAAAPAAAAEAAEEQTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+     +KK+ VIKEVR +T LGLKEAK+LV+ APK++  G+SKD A + K+ LE 
Sbjct: 61  DVILES--AGEKKVPVIKEVRGLTSLGLKEAKDLVDGAPKAVLEGVSKDAAEKAKETLEG 118

Query: 119 AGATVELR 126
           AGATV ++
Sbjct: 119 AGATVTVK 126


>gi|332022030|gb|EGI62356.1| 39S ribosomal protein L12, mitochondrial [Acromyrmex echinatior]
          Length = 186

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 50/130 (38%), Positives = 76/130 (58%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------KT 56
            I+ I   +++L LIE A+LS+ L+K   +  +  + V   VAA   S   E      +T
Sbjct: 57  KIDKIANDITALNLIEVAKLSELLKKRLNLPDAPVMPVGGFVAASQASEEEEVEQKRIQT 116

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           EF V L  FDD K+K+A+IKEV+ +     L +AK+ VESAP  +K  ++KDEA ++K  
Sbjct: 117 EFTVKLMAFDD-KQKVALIKEVKNLLPGTNLVQAKKFVESAPTIVKADIAKDEAEKLKDA 175

Query: 116 LEDAGATVEL 125
           L   GAT+++
Sbjct: 176 LTKVGATIQI 185


>gi|318040707|ref|ZP_07972663.1| 50S ribosomal protein L7/L12 [Synechococcus sp. CB0101]
          Length = 128

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 62/127 (48%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFE 59
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+A   VV    A  G+A +   KTEF+
Sbjct: 3   ATTDQILEQLKSLSLLEASELVKQIEEAFGVSAAASAGVVMAAPAAGGAAEAAEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL+ FD    KI V+K VR  T LGL EAK LVE AP ++K G SK +A  MKK +E+A
Sbjct: 63  VVLESFDAAA-KIKVLKAVREATGLGLGEAKALVEGAPCAVKEGASKADAEAMKKAIEEA 121

Query: 120 GATVELR 126
           G  V L+
Sbjct: 122 GGKVALK 128


>gi|158422510|ref|YP_001523802.1| 50S ribosomal protein L7/L12 [Azorhizobium caulinodans ORS 571]
 gi|172047837|sp|A8HTY4|RL7_AZOC5 RecName: Full=50S ribosomal protein L7/L12
 gi|158329399|dbj|BAF86884.1| ribosomal protein L7/L12 [Azorhizobium caulinodans ORS 571]
          Length = 125

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  +V++LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA   +AA  E+TEF 
Sbjct: 1   MADLTKLVDELSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAAPAAGGAAAAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   +   KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVL--ANAGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKLKAQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|315024075|gb|EFT37077.1| 50S ribosomal protein L7/L12 [Riemerella anatipestifer RA-YM]
          Length = 122

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL++ L+ E+G+  +A   V    A  AG AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELAQILKDEYGIEPAAATVVA--AAGGAGGAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+A++K V+ +T  GLKEAK++V+ AP  +K G+SKDEA  +KK+LE+AG
Sbjct: 59  ILKS--AGASKLAIVKLVKDLTGAGLKEAKDIVDGAPAPIKEGVSKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|254449092|ref|ZP_05062544.1| ribosomal protein L7/L12 [gamma proteobacterium HTCC5015]
 gi|198261284|gb|EDY85577.1| ribosomal protein L7/L12 [gamma proteobacterium HTCC5015]
          Length = 126

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-SVVAPVAAEAGSAASEKTEFEVVLK 63
           + I+E +++++++E  EL   +E+++GV A+A    VV       G+AA EKTEF+VV+ 
Sbjct: 6   DEILEAIANMSVMEVVELISDMEEKFGVEAAAAAAPVVMAGGDAGGAAAEEKTEFDVVMT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F     K+  IK VRAIT LGLKEAKE+VE AP ++K G SK++A E KK+LE+AGA+V
Sbjct: 66  SF--GDNKVGAIKAVRAITGLGLKEAKEMVEGAPATVKEGASKEDAEEAKKQLEEAGASV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|331268156|ref|YP_004347805.1| ribosomal protein L12 [Chlorella variabilis]
 gi|325296333|gb|ADZ05053.1| ribosomal protein L12 [Chlorella variabilis]
          Length = 130

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 57/125 (45%), Positives = 81/125 (64%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG----SAASEKTEFEV 60
             I+EKL S+TL+EAAEL  ++E+ +GV ASAPV      A  A         EKT F+V
Sbjct: 6   NEIIEKLKSITLLEAAELVSQIEETFGVDASAPVGGGFIAAPGAAGAAAEVVEEKTTFDV 65

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           V++      K++ V+K VR +T L LKEAKE + S PK+++ G+SKD+A   K++LEDAG
Sbjct: 66  VIEDV-PTDKRVPVLKVVRNLTSLDLKEAKEAITSLPKTIQQGVSKDDAEAAKQQLEDAG 124

Query: 121 ATVEL 125
           A V++
Sbjct: 125 AKVKI 129


>gi|212637944|ref|YP_002314464.1| 50S ribosomal protein L7/L12 [Anoxybacillus flavithermus WK1]
 gi|254806255|sp|B7GJ57|RL7_ANOFW RecName: Full=50S ribosomal protein L7/L12
 gi|212559424|gb|ACJ32479.1| Ribosomal protein L7/L12 [Anoxybacillus flavithermus WK1]
          Length = 121

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  +L K +E+E+    +A   VV    A AG+AA EKTEF+V+L  
Sbjct: 4   EQIIEAVKNMTVLELNDLVKAIEEEF--GVTAAAPVVVAGGAAAGAAAEEKTEFDVILA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR +T LGLKEAK+LV++ PK +K G+SK+EA E+K KLE+AGA VE
Sbjct: 61  -DGGAQKIKVIKVVRELTGLGLKEAKDLVDNTPKPVKEGVSKEEAEEIKAKLEEAGAKVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|221128025|ref|XP_002154945.1| PREDICTED: similar to chloroplast 50S ribosomal protein L7 [Hydra
           magnipapillata]
 gi|260222517|emb|CBA32159.1| 50S ribosomal protein L7/L12 [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 125

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +  A  AA   +AA EKTEF VVL
Sbjct: 4   DKDAFLSALDSMTVMELNDLVKAIEEKFGVSAAAMAAPAAGGAAGGAAAAEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K++VIK VR IT LGLKEAK+LV+ APK++K G+SK +A   KKKLE+AGA 
Sbjct: 64  T--EAGANKVSVIKAVREITGLGLKEAKDLVDGAPKAVKEGISKADAEAAKKKLEEAGAK 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|94984746|ref|YP_604110.1| 50S ribosomal protein L7/L12 [Deinococcus geothermalis DSM 11300]
 gi|123257274|sp|Q1J0P3|RL7_DEIGD RecName: Full=50S ribosomal protein L7/L12
 gi|94555027|gb|ABF44941.1| ribosomal protein L7/L12 [Deinococcus geothermalis DSM 11300]
          Length = 122

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 86/124 (69%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++++++LS+LT++E A+L   L+++WGV+A+  V+     A  A  AA EKTEF+V+L
Sbjct: 4   DKQALIDQLSTLTIMELADLIDGLKEQWGVTAAVAVAGP--GAGAAAPAAEEKTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIKE+RAIT LGLKEAK+L E     +K G+SK++A + K +LE AGA 
Sbjct: 62  --VDAGASKINVIKELRAITGLGLKEAKDLSEKGGA-IKEGVSKEDAEKFKAQLEGAGAK 118

Query: 123 VELR 126
           VE+R
Sbjct: 119 VEIR 122


>gi|291561995|emb|CBL40806.1| LSU ribosomal protein L12P [butyrate-producing bacterium SS3/4]
          Length = 124

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 80/128 (62%), Gaps = 6/128 (4%)

Query: 1   MSNIE--SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     +E +  L+++E  EL K  E+E+GVSA+A V V    A    +A  EKTEF
Sbjct: 1   MAKLTTAEFIEAIKELSVLELNELVKACEEEFGVSAAAGVVVA--AAGAGAAAEEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L        K+ VIK VR +T LGLKEAK++V+ APK LK G SKDEAN++K KLE 
Sbjct: 59  DVELTEV--GPNKVKVIKVVREVTGLGLKEAKDVVDGAPKVLKQGASKDEANDIKTKLEA 116

Query: 119 AGATVELR 126
            GA + L+
Sbjct: 117 EGAKITLK 124


>gi|256819270|ref|YP_003140549.1| 50S ribosomal protein L7/L12 [Capnocytophaga ochracea DSM 7271]
 gi|315224713|ref|ZP_07866536.1| ribosomal protein L7/L12 [Capnocytophaga ochracea F0287]
 gi|256580853|gb|ACU91988.1| ribosomal protein L7/L12 [Capnocytophaga ochracea DSM 7271]
 gi|314945341|gb|EFS97367.1| ribosomal protein L7/L12 [Capnocytophaga ochracea F0287]
          Length = 127

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/129 (45%), Positives = 85/129 (65%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTE 57
           M++++   E+L +LT+ E  EL++ L+ E+G+  +A    VA   A AG AA     KTE
Sbjct: 1   MADLKKFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAGGAVAGGAAEAGAEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V LK       K+AV+K V+ +T LGLKEAKE+V+ AP  +K G+SK+EA  +KK LE
Sbjct: 61  FDVFLKS--AGANKLAVVKLVKDLTGLGLKEAKEVVDGAPSKVKEGVSKEEAEGLKKSLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAEVELK 127


>gi|87300792|ref|ZP_01083634.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 5701]
 gi|87284663|gb|EAQ76615.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 5701]
          Length = 127

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 52/125 (41%), Positives = 80/125 (64%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           +  + I+E L +L+L+EA+EL K++E+ +GVSA+A   VV   A  A + A+E+     V
Sbjct: 3   TKTDDILESLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAAPAAAAEAAEEQTEFDV 62

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +    D   KI V+K VR  T LGL EAK LVE+APK++K G++K +A  +KK +E+ G 
Sbjct: 63  ILESFDAAAKIKVLKAVREATGLGLGEAKALVEAAPKAVKEGIAKGDAEALKKSIEEVGG 122

Query: 122 TVELR 126
            V ++
Sbjct: 123 KVTIK 127


>gi|258646903|ref|ZP_05734372.1| ribosomal protein L7/L12 [Dialister invisus DSM 15470]
 gi|260404343|gb|EEW97890.1| ribosomal protein L7/L12 [Dialister invisus DSM 15470]
          Length = 123

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 67/122 (54%), Positives = 93/122 (76%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +S ++++E +EL K +E+++GVSA+APV+V A   A   +AA EK+EF+V+LK 
Sbjct: 4   EEILNAISEMSVLELSELVKAIEEKFGVSAAAPVAVAAAAPAAGAAAAEEKSEFDVILK- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   +KI VIK VR IT LGLKEAK LV+ APK +KTG++K EA E+KKKLE+AGATVE
Sbjct: 63  -EAGAQKIQVIKAVREITALGLKEAKALVDGAPKEVKTGVAKAEAEEIKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|260887706|ref|ZP_05898969.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
 gi|330838622|ref|YP_004413202.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
 gi|260862586|gb|EEX77086.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
 gi|329746386|gb|AEB99742.1| ribosomal protein L7/L12 [Selenomonas sputigena ATCC 35185]
          Length = 123

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 67/122 (54%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E +EL K +E+++GVSA+APV+V A  AA A +A  EKTEF VVL  
Sbjct: 4   EEIMQAIEGMTVLELSELVKAMEEKFGVSAAAPVAVAAAGAAPAAAAGEEKTEFTVVLAA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR  T LGLKEAKELV+ AP  +K  ++K EA E+KKKLE+AGATVE
Sbjct: 64  --AGDKKINVIKAVREATGLGLKEAKELVDGAPAPIKENIAKAEAEELKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|195605180|gb|ACG24420.1| 50S ribosomal protein L12-2 [Zea mays]
          Length = 167

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 52/135 (38%), Positives = 78/135 (57%), Gaps = 14/135 (10%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA-------------EAGS 50
           + ++V+++  LTL+EA+ L+  L    GV    P++++   AA             E   
Sbjct: 33  VSALVDEICGLTLLEASSLADALRGRLGVDQLPPLAILTGGAAPLVGGGVGPGAAGEEAK 92

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           A  EK  F+V L+GFD    K+ +IKE+RA T+LGLKEAK+LVE AP  LK G+ K+EA 
Sbjct: 93  AKEEKMAFDVKLEGFDAAA-KLKIIKELRAFTNLGLKEAKDLVEKAPAVLKAGVPKEEAE 151

Query: 111 EMKKKLEDAGATVEL 125
            + +K+   GA + L
Sbjct: 152 SIAEKMRALGAKIVL 166


>gi|88809795|ref|ZP_01125301.1| ribosomal protein L7/L12 [Synechococcus sp. WH 7805]
 gi|88786179|gb|EAR17340.1| ribosomal protein L7/L12 [Synechococcus sp. WH 7805]
          Length = 129

 Score = 81.9 bits (201), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 57/128 (44%), Positives = 83/128 (64%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEF 58
           +  + I+E L +L+L+EA+EL K++E+ +GVSA+A   VV      A         KTEF
Sbjct: 3   AKTDEILESLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAPGAAAGGGEAAEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+ F+    KI V+K VR  T LGL +AK +VE+APK++K G+SKDEA  +KK +E+
Sbjct: 63  DVVLESFEASS-KIKVLKAVREATGLGLGDAKAMVEAAPKAIKEGVSKDEAEALKKAIEE 121

Query: 119 AGATVELR 126
            G  V L+
Sbjct: 122 VGGKVTLK 129


>gi|330850833|ref|YP_004376583.1| 50S ribosomal protein L12 [Fistulifera sp. JPCC DA0580]
 gi|328835653|dbj|BAK18949.1| 50S ribosomal protein L12 [Fistulifera sp. JPCC DA0580]
          Length = 128

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 3/126 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--VVAPVAAEAGSAASEKTEFEV 60
            I+ IVE L +LTL+EA+EL  ++E+ +GV ASA V   V+   A  A  A  E+TEF++
Sbjct: 4   KIDQIVEDLKTLTLLEASELVSKIEETFGVDASAAVGGGVIMAAAPVAEEAVEEQTEFDL 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKI+V+K VR +T LGLKEAKELVE+AP  ++TGL+K+ A + KK++E AG
Sbjct: 64  MLDEV-PADKKISVLKVVRGLTGLGLKEAKELVEAAPTKVQTGLAKEAAEDGKKQIEAAG 122

Query: 121 ATVELR 126
           A   L+
Sbjct: 123 AKASLK 128


>gi|309357460|emb|CAP35799.2| hypothetical protein CBG_18325 [Caenorhabditis briggsae AF16]
 gi|309357485|emb|CAP35846.2| hypothetical protein CBG_18380 [Caenorhabditis briggsae AF16]
          Length = 179

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/134 (32%), Positives = 72/134 (53%), Gaps = 11/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---------- 52
            + ++VE++++L+L++ ++L+  L+K   +     ++  A   A A + A          
Sbjct: 45  KVSALVEEIANLSLLDVSDLNWALKKRLNIPDQPFMAAAAFAPAAAAAPAAQAEAEAASD 104

Query: 53  -SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
             +K  F V L  FDD KK   + +   AI  L L +AK+ VE+AP ++K  L K EA E
Sbjct: 105 VPQKMTFTVKLTKFDDTKKIAIIKEIRNAIPGLNLVQAKKFVETAPVNVKEDLGKAEAEE 164

Query: 112 MKKKLEDAGATVEL 125
           +K  LE AGA +E+
Sbjct: 165 LKGILEKAGAVIEI 178


>gi|88802466|ref|ZP_01117993.1| 50S ribosomal protein L7/L12 [Polaribacter irgensii 23-P]
 gi|88781324|gb|EAR12502.1| 50S ribosomal protein L7/L12 [Polaribacter irgensii 23-P]
          Length = 124

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+ ++   E+L +LT+ E  EL+  L+ E+G+  +A  +VV   AA    AA E+TEF+V
Sbjct: 1   MAELKDFAEQLVNLTVKEVNELATILKDEYGIEPAAAAAVVVGPAAGGEEAAEEQTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L        K+AV+K V+ +T LGLKEAK +V+SAP ++K G+SKDEA  +K  LE+AG
Sbjct: 61  ILTA--AGASKLAVVKLVKELTGLGLKEAKGIVDSAPAAVKEGVSKDEAAALKASLEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|331247117|ref|XP_003336188.1| hypothetical protein PGTG_17769 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309315178|gb|EFP91769.1| hypothetical protein PGTG_17769 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 211

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 64/135 (47%), Gaps = 12/135 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA------------EAGS 50
            IE +V+ +S L+L+EAAEL   L+    ++  A        +                 
Sbjct: 76  KIEELVQTISQLSLLEAAELVDALKSRLKITEVAMPVQAPSSSGQSSDAGSAKEKKAEPE 135

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
              EKT F + L   D  +K   + +    + ++ L EAK+ VES PK LK   +KDE  
Sbjct: 136 KPKEKTVFSLTLTQIDATQKAKVIKEVKTIMPNMNLVEAKKFVESLPKQLKENGTKDEIE 195

Query: 111 EMKKKLEDAGATVEL 125
           ++KK LE  GATV++
Sbjct: 196 KLKKALESVGATVKV 210


>gi|110833238|ref|YP_692097.1| 50S ribosomal protein L7/L12 [Alcanivorax borkumensis SK2]
 gi|123345814|sp|Q0VSM3|RL7_ALCBS RecName: Full=50S ribosomal protein L7/L12
 gi|110646349|emb|CAL15825.1| 50S ribosomal protein L7/L12 [Alcanivorax borkumensis SK2]
          Length = 125

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  EL + +E+++GV+A+A V+     A    +AA E+TEF+VVL  
Sbjct: 6   EDILGAIADMSVMDLVELIEAMEEKFGVTAAAAVAAAPAAAGGDAAAAEEQTEFDVVLSS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F    KK+ VIK VR +T LGLKEAKELVESAP  +K G +KDEA E+KKK+E+AG T E
Sbjct: 66  F--GDKKVGVIKAVREVTGLGLKEAKELVESAPAPVKEGATKDEAEEIKKKIEEAGGTAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|116192025|ref|XP_001221825.1| hypothetical protein CHGG_05730 [Chaetomium globosum CBS 148.51]
 gi|88181643|gb|EAQ89111.1| hypothetical protein CHGG_05730 [Chaetomium globosum CBS 148.51]
          Length = 149

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 43/132 (32%), Positives = 68/132 (51%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            I +IV+++S LTL+E A+L   L+    +         A  A  A +   E        
Sbjct: 18  KISAIVDQISQLTLLETADLVSSLKTRLNIPDLPVGGFAAAPAGPAAAPVEEEEAAPAAA 77

Query: 55  -KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
            KT F V L+ F+    K  VIKE++ +  L L ++K+ VESAPK +K  + KDEA ++ 
Sbjct: 78  EKTLFTVKLQSFEAGS-KPKVIKEIKNLLGLSLVDSKKFVESAPKLMKESVPKDEAEKIL 136

Query: 114 KKLEDAGATVEL 125
             +++ GA V +
Sbjct: 137 ATMKELGAVVVI 148


>gi|307718199|ref|YP_003873731.1| 50S ribosomal protein L7/L12 [Spirochaeta thermophila DSM 6192]
 gi|306531924|gb|ADN01458.1| 50S ribosomal protein L7/L12 [Spirochaeta thermophila DSM 6192]
 gi|315186338|gb|EFU20099.1| LSU ribosomal protein L12P [Spirochaeta thermophila DSM 6578]
          Length = 128

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 87/128 (67%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E I++ +S +T++E AEL K +E+++GV+A+APV+V A  AA A +   E+   
Sbjct: 1   MAKLSTEEILDAISQMTVLEVAELVKAMEEKFGVTAAAPVAVAAAPAAGAAAPQEEEKSE 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
             V+       KKI VIK VR +  LGLKEAK+ VE+  K++K G+SK EA E+KKKLE+
Sbjct: 61  FDVILKGVADGKKIPVIKVVREVMGLGLKEAKDFVEAPGKAVKEGVSKQEAEELKKKLEE 120

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 121 AGAVVEIK 128


>gi|94676695|ref|YP_588936.1| ribosomal protein L7/L12 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
 gi|123081478|sp|Q1LSX8|RL7_BAUCH RecName: Full=50S ribosomal protein L7/L12
 gi|94219845|gb|ABF14004.1| ribosomal protein L7/L12 [Baumannia cicadellinicola str. Hc
           (Homalodisca coagulata)]
          Length = 121

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 81/122 (66%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++ +++++  EL   +E+++GVS+   +   +  A        EKTEF+VVL  
Sbjct: 6   EQILEAVAKMSILDITELISMMEQKFGVSSINTIVPTSSPA----ETVEEKTEFDVVLT- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KIAVIK VR +  LGLKEAK+LVESAP +LK  +SKDEA  +KK LEDAGA+VE
Sbjct: 61  -NIGANKIAVIKAVRGVISLGLKEAKDLVESAPITLKESISKDEAAALKKILEDAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|329850782|ref|ZP_08265627.1| ribosomal protein L7/L12 [Asticcacaulis biprosthecum C19]
 gi|328841097|gb|EGF90668.1| ribosomal protein L7/L12 [Asticcacaulis biprosthecum C19]
          Length = 126

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 76/128 (59%), Positives = 97/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG-SAASEKTEFE 59
           MS +E +VE LS+L+++EAAELSK LE +WGVSA+APV+V A     A   A  E+TEF 
Sbjct: 1   MSKLEKLVEDLSALSVLEAAELSKLLEDKWGVSAAAPVAVAAVGGPAAPVEAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           VVL   D   KKI VIKE+R+I TDLGLKEAK+LVE AP+++K  +SK EA ++KKKLED
Sbjct: 61  VVLT--DGGDKKINVIKEIRSIRTDLGLKEAKDLVEGAPQNVKENISKQEAADIKKKLED 118

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 119 AGAKVEVK 126


>gi|226355461|ref|YP_002785201.1| 50S ribosomal protein L7/L12 [Deinococcus deserti VCD115]
 gi|259491641|sp|C1D0S3|RL7_DEIDV RecName: Full=50S ribosomal protein L7/L12
 gi|226317451|gb|ACO45447.1| putative 50S ribosomal protein L7/L12 [Deinococcus deserti VCD115]
          Length = 121

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 83/124 (66%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++++++L  LT++E A+L   L++ WGV+A+         AA   +AA EKTEF+VVL
Sbjct: 4   DKQALIDQLGQLTIMELADLIDGLKETWGVTAAVAAGP---AAAGPAAAAEEKTEFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIKE+RAIT LGLKEAK++ E     LK G+SKD+A ++K +LE AGA 
Sbjct: 61  --VDAGASKINVIKEIRAITGLGLKEAKDMSEKGG-VLKEGISKDDAEKIKAQLEGAGAK 117

Query: 123 VELR 126
           VEL+
Sbjct: 118 VELK 121


>gi|124005811|ref|ZP_01690649.1| ribosomal protein L7/L12 [Microscilla marina ATCC 23134]
 gi|123988494|gb|EAY28135.1| ribosomal protein L7/L12 [Microscilla marina ATCC 23134]
          Length = 126

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 44/126 (34%), Positives = 72/126 (57%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++   E+L +L+L E  EL   L+ + G+  +A    VA  A    +   E+ +   
Sbjct: 1   MADLKEFAEQLVNLSLKEVNELVTILKDDHGIEPAAAAVAVAGPAGGGEAGGGEEEKTAF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        K+ V+K V+ +T LGLK+AK LV+ APK LK G+ K EA+ +K +LE+ G
Sbjct: 61  DVVLKSAGGAKLKVVKAVKELTGLGLKDAKALVDEAPKPLKEGVDKAEADALKAQLEELG 120

Query: 121 ATVELR 126
           A VE++
Sbjct: 121 AEVEIK 126


>gi|282896123|ref|ZP_06304149.1| Ribosomal protein L7/L12 [Raphidiopsis brookii D9]
 gi|281199041|gb|EFA73916.1| Ribosomal protein L7/L12 [Raphidiopsis brookii D9]
          Length = 129

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 88/125 (70%), Gaps = 4/125 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEFEVV 61
           + I+E+L  LTL+EAAEL K++E+ +GVSA+AP   + V+A   A A     E+TEF VV
Sbjct: 6   DQILEQLKVLTLLEAAELVKQIEEAFGVSAAAPAGGMMVMAAPGAAAAEPVEEQTEFNVV 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L+      KKIAV+K VR IT LGLKEAKELVES PK++K G++K+ A E+ KK+ +AG 
Sbjct: 66  LEEV-PADKKIAVLKIVREITGLGLKEAKELVESTPKAVKEGVNKESAEEISKKIAEAGG 124

Query: 122 TVELR 126
            V ++
Sbjct: 125 KVVIK 129


>gi|119500562|ref|XP_001267038.1| 50S ribosomal protein L12 [Neosartorya fischeri NRRL 181]
 gi|119415203|gb|EAW25141.1| 50S ribosomal protein L12 [Neosartorya fischeri NRRL 181]
          Length = 190

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 42/140 (30%), Positives = 66/140 (47%), Gaps = 18/140 (12%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEK----EWGVSASAPVSVVAPVAAEAGSAA------ 52
            I  IV+++S LTL+E A+L   L+        +            A   G+AA      
Sbjct: 51  KITQIVDQISQLTLLETADLVASLKSLVQSRLNIPDLPVGGFAVAAAPGGGAAAPAAAEE 110

Query: 53  -------SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLS 105
                   EKT F + L+   D   K  VIKE++ +  L L ++K+ VES PK +K  + 
Sbjct: 111 EEAAPAAQEKTLFNLKLETV-DAASKAKVIKEIKGLLGLSLVDSKKFVESVPKMMKESVP 169

Query: 106 KDEANEMKKKLEDAGATVEL 125
           K+EA ++ + L+  GA V +
Sbjct: 170 KEEAEKIIETLKAVGAKVVM 189


>gi|118411000|ref|YP_874395.1| 50S ribosomal protein L12 [Phaeodactylum tricornutum]
 gi|125987530|sp|A0T0C0|RK12_PHATC RecName: Full=50S ribosomal protein L12, chloroplastic
 gi|116739747|gb|ABK20618.1| 50S ribosomal protein L12 [Phaeodactylum tricornutum]
          Length = 128

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 80/125 (64%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFEV 60
            I+ IVE L +LTL+EA+EL  ++E+ +GV ASA  S    +AA          KTEF +
Sbjct: 4   KIDQIVEDLKTLTLLEASELVTKIEETFGVDASAAASGGVVMAAAPAVVEEVEEKTEFNL 63

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L       KKIAV+K VR++T LGLKEAKELVESAPK ++ GL KD A E KK++E AG
Sbjct: 64  MLDEV-PADKKIAVLKVVRSLTGLGLKEAKELVESAPKQIQEGLGKDAAEEAKKQIEAAG 122

Query: 121 ATVEL 125
               L
Sbjct: 123 GKASL 127


>gi|261254079|ref|ZP_05946652.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio orientalis CIP 102891]
 gi|260937470|gb|EEX93459.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio orientalis CIP 102891]
          Length = 122

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GV+A+A V       A AG AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVTAAAAVVAG---GAAAGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+SAP  LK G+ KDEA  +K +LE+AGATV 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKGLVDSAPAPLKEGIEKDEAEALKAQLEEAGATVV 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|307107194|gb|EFN55437.1| hypothetical protein CHLNCDRAFT_133731 [Chlorella variabilis]
          Length = 204

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 58/135 (42%), Positives = 83/135 (61%), Gaps = 14/135 (10%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----------- 52
           + ++ E++  L L++ A+L++ L+K+ G+ A   + +   +     +AA           
Sbjct: 70  VLALSEQILQLNLLQVADLTEILKKKLGIEAPPMMGMPMGMPMGGAAAAAPPAEAAAPAA 129

Query: 53  --SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
              EKTEF + L+G+D    KI VIKEVRAIT LGLKEAKELVE+APK +K GL K+EA 
Sbjct: 130 PVEEKTEFTLKLEGYDAAA-KIKVIKEVRAITGLGLKEAKELVEAAPKVVKEGLKKEEAE 188

Query: 111 EMKKKLEDAGATVEL 125
            ++K L DAGA V L
Sbjct: 189 ALQKTLLDAGAKVSL 203


>gi|119953181|ref|YP_945390.1| 50S ribosomal protein L7/L12 [Borrelia turicatae 91E135]
 gi|254806263|sp|A1QZH8|RL7_BORT9 RecName: Full=50S ribosomal protein L7/L12
 gi|119861952|gb|AAX17720.1| LSU ribosomal protein L12P (L7/L12) [Borrelia turicatae 91E135]
          Length = 123

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 76/122 (62%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L      E  EL   +E+++GV+A+A         A   +   E+TEF+V+L  
Sbjct: 6   EDILTWLEEAKTSEVVELITAIEEKFGVTAAAVAVAAGSGPASVDA--EEQTEFDVMLMS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVRA+T LGL EAK LVE+APK++K G+SK +A ++KKKLE  GA VE
Sbjct: 64  F--GDSKINVIKEVRAVTGLGLGEAKALVEAAPKAIKEGVSKADAEDIKKKLEAVGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|148240707|ref|YP_001226094.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 7803]
 gi|166222221|sp|A5GPD2|RL7_SYNPW RecName: Full=50S ribosomal protein L7/L12
 gi|147849246|emb|CAK24797.1| 50S ribosomal protein L7/L12 [Synechococcus sp. WH 7803]
          Length = 130

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 60/129 (46%), Positives = 86/129 (66%), Gaps = 5/129 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTE 57
           +  + I+E L +L+L+EA+EL K++E+ +GVSA+A   VV      AG+   E    KTE
Sbjct: 3   AKTDEILESLKTLSLLEASELVKQIEEAFGVSAAASAGVVMAAPGAAGAGGGEAAEEKTE 62

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL+ FD    KI V+K VR  T LGL +AK +VE+APK++K G+SKDEA  +KK +E
Sbjct: 63  FDVVLESFDASA-KIKVLKAVREATGLGLGDAKAMVEAAPKAIKEGVSKDEAEALKKAIE 121

Query: 118 DAGATVELR 126
           + G  V L+
Sbjct: 122 EVGGKVTLK 130


>gi|323498404|ref|ZP_08103401.1| 50S ribosomal protein L7/L12 [Vibrio sinaloensis DSM 21326]
 gi|323316546|gb|EGA69560.1| 50S ribosomal protein L7/L12 [Vibrio sinaloensis DSM 21326]
          Length = 122

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GVSA+A V       A AG AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVSAAAAVVAG---GAAAGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ KDEA  +K +LE+AGA+V 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVEKDEAEALKAQLEEAGASVT 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|312882835|ref|ZP_07742568.1| 50S ribosomal protein L7/L12 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323492153|ref|ZP_08097314.1| 50S ribosomal protein L7/L12 [Vibrio brasiliensis LMG 20546]
 gi|309369527|gb|EFP97046.1| 50S ribosomal protein L7/L12 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|323313604|gb|EGA66707.1| 50S ribosomal protein L7/L12 [Vibrio brasiliensis LMG 20546]
          Length = 122

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GVSA+A V       A  G AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVSAAAAVVAG---GAAGGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ KDEA  +K +LE+AGA+V 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVEKDEAEALKAQLEEAGASVT 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|149424824|ref|XP_001521054.1| PREDICTED: similar to 50S ribosomal subunit protein L12, putative
           [Ornithorhynchus anatinus]
          Length = 203

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 45/137 (32%), Positives = 68/137 (49%), Gaps = 15/137 (10%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSAS---------------APVSVVAPVAAEA 48
           ++SIVE+L +LTL+E AEL K++E  +GVSAS               A  +V    + + 
Sbjct: 66  VDSIVEQLKTLTLLETAELVKKIETTFGVSASLAVPVVAAPAAPQPEAAEAVSESDSDDE 125

Query: 49  GSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDE 108
               +EK  FEV+LK     K+   +        D  LK+ K +++  P S+    S  E
Sbjct: 126 APQQTEKKTFEVILKSVPQAKRMPMIRTLKALYPDFDLKQIKNIIDGLPYSVSLQASAAE 185

Query: 109 ANEMKKKLEDAGATVEL 125
           A  +K KL +AG  VE+
Sbjct: 186 AENLKTKLTEAGGEVEV 202


>gi|289209337|ref|YP_003461403.1| ribosomal protein L7/L12 [Thioalkalivibrio sp. K90mix]
 gi|288944968|gb|ADC72667.1| ribosomal protein L7/L12 [Thioalkalivibrio sp. K90mix]
          Length = 126

 Score = 81.5 bits (200), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I+E + ++T++E  +L   +E+++GVSA+A V+     A    +AA+E K EF+VV+ 
Sbjct: 6   EDILEAIGNMTVLEIVDLISEMEEKFGVSAAAAVAAAPAAAGGGEAAAAEAKDEFDVVMS 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
            F   + K+ VIK VR +T LGLKEAKE+VE  P ++K G +KDEA +MK +LE+AGATV
Sbjct: 66  SF--GENKVGVIKVVRGLTGLGLKEAKEMVEGVPATVKEGAAKDEAEKMKAELEEAGATV 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|119502914|ref|ZP_01624999.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2080]
 gi|119461260|gb|EAW42350.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2080]
          Length = 127

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 82/122 (67%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++++++++  EL + +E+++GV+A+A V+     A  A  AA+E  + E  +  
Sbjct: 6   EDILEAIAAMSVMDVVELIEAMEEKFGVTAAAAVAAAPAAAGGADGAAAEAEQTEFDVIL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VRA+T LGLKEAK +V+ AP  +K G SKDEA ++KK+LE+AG   E
Sbjct: 66  TSAGEKKVNVIKVVRAVTGLGLKEAKAVVDGAPGPVKEGASKDEAEDIKKQLEEAGGAAE 125

Query: 125 LR 126
           L+
Sbjct: 126 LK 127


>gi|229818377|ref|ZP_04448658.1| hypothetical protein BIFANG_03679 [Bifidobacterium angulatum DSM
           20098]
 gi|229784247|gb|EEP20361.1| hypothetical protein BIFANG_03679 [Bifidobacterium angulatum DSM
           20098]
          Length = 126

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+APV+ VA  A  A  AA EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAAAAPGAAPAAEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT LGL EAK LV+ APK++  G  K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRAITSLGLAEAKALVDGAPKAVLEGAKKEDAEKAKSQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|223647|prf||0905174A protein L7/L12
          Length = 124

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 54/125 (43%), Positives = 80/125 (64%), Gaps = 1/125 (0%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVV 61
           +++  + E +  LTL+EA EL   L+ ++G+  +A  +V+    A   +A +E+ + E  
Sbjct: 1   ADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMMAGPAAGAAAPAEEEKTEFD 60

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K  ++K +A  MKKKLE+AGA
Sbjct: 61  VGLTDAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAVAKADAEAMKKKLEEAGA 119

Query: 122 TVELR 126
            VEL+
Sbjct: 120 KVELK 124


>gi|87306546|ref|ZP_01088693.1| probable 50S ribosomal protein L7/L12 [Blastopirellula marina DSM
           3645]
 gi|87290725|gb|EAQ82612.1| probable 50S ribosomal protein L7/L12 [Blastopirellula marina DSM
           3645]
          Length = 135

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 81/124 (65%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVL 62
           ++++ +K+++LTL +A EL   L+   G+ A+A   V+    A   +  +  +TEF+VV+
Sbjct: 14  LKTLGDKIATLTLKQAVELGDYLKDAHGIEAAAGGGVMMAGPAAGPAEEAAVQTEFDVVM 73

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI+VIK +R+IT LGLKEAKEL E  P  +K G+SK++A ++K +L DAGA 
Sbjct: 74  TSF--GGNKISVIKAIRSITGLGLKEAKELTEGVPSKVKEGVSKEDAEKVKAELTDAGAE 131

Query: 123 VELR 126
           VE++
Sbjct: 132 VEIK 135


>gi|332182023|gb|AEE17711.1| 50S ribosomal protein L7/L12 [Treponema brennaborense DSM 12168]
          Length = 126

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 64/121 (52%), Positives = 92/121 (76%), Gaps = 2/121 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++S+T++EA+EL K +E+++GV+A+APV V     A   +AA E+TEF V L+ 
Sbjct: 7   DQILDAIASMTVLEASELVKAMEEKFGVTAAAPVMVAG-AGAAPAAAAEEQTEFNVSLES 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D  K KIAVIK VRA+T LGLKEAK+LVE APK LK G+SKDEA ++KK++E+AG  V+
Sbjct: 66  ADASK-KIAVIKAVRAVTGLGLKEAKDLVEGAPKPLKEGVSKDEAAKIKKEVEEAGGVVK 124

Query: 125 L 125
           +
Sbjct: 125 I 125


>gi|260774680|ref|ZP_05883585.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260609399|gb|EEX35548.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 122

 Score = 81.5 bits (200), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GVSA+A V       A  G AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVSAAAAVVAG---GAAGGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ KDEA  +K +LE+AGA+V 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGIEKDEAEALKAQLEEAGASVT 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|255540659|ref|XP_002511394.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
 gi|223550509|gb|EEF51996.1| 50S ribosomal protein L7/L12, putative [Ricinus communis]
          Length = 193

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 47/132 (35%), Positives = 69/132 (52%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA---------PVAAEAGSAAS 53
            I  + E++++L   E  ++   L  +        +S               A       
Sbjct: 62  KIVQLAERIAALPPEERRQIGPTLHYKLNHPKLQTISTEGMDLGAQGSQAAVAAKVEEKK 121

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F+V L+ FD    KI VIKEVRA T+LGLKEAK+LVE AP  LK G++K+EAN++ 
Sbjct: 122 EKTAFDVKLEKFDAAA-KIKVIKEVRAFTNLGLKEAKDLVEKAPAVLKQGVTKEEANDII 180

Query: 114 KKLEDAGATVEL 125
           +K++ AG    +
Sbjct: 181 EKIKAAGGVAIM 192


>gi|238855643|ref|ZP_04645943.1| ribosomal protein L7/L12 [Lactobacillus jensenii 269-3]
 gi|260664916|ref|ZP_05865767.1| ribosomal protein L7/L12 [Lactobacillus jensenii SJ-7A-US]
 gi|282932785|ref|ZP_06338188.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
 gi|313472537|ref|ZP_07813027.1| ribosomal protein L7/L12 [Lactobacillus jensenii 1153]
 gi|238831709|gb|EEQ24046.1| ribosomal protein L7/L12 [Lactobacillus jensenii 269-3]
 gi|239529974|gb|EEQ68975.1| ribosomal protein L7/L12 [Lactobacillus jensenii 1153]
 gi|260561399|gb|EEX27372.1| ribosomal protein L7/L12 [Lactobacillus jensenii SJ-7A-US]
 gi|281303093|gb|EFA95292.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
          Length = 120

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 87/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E+L   T++E  +L K +E E+ V+A+APV      AA A + A+ KTEF+V L
Sbjct: 4   DTEKIIEELKGATILELNDLVKAIEDEFDVTAAAPV-----AAAGAAAGAAAKTEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK +K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVREITGLGLKDSKDLVDGAPKVIKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V ++
Sbjct: 117 VTVK 120


>gi|182412058|ref|YP_001817124.1| ribosomal protein L7/L12 [Opitutus terrae PB90-1]
 gi|177839272|gb|ACB73524.1| ribosomal protein L7/L12 [Opitutus terrae PB90-1]
          Length = 129

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 70/123 (56%), Positives = 89/123 (72%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           E ++E LS+ T+++ A L K LE +WGVSA+A V+      A AG+AA+ E+TEF VVLK
Sbjct: 9   EQVIEWLSAQTVLDLAALVKDLEGKWGVSAAAAVAAAPAAGAGAGAAAAIEQTEFTVVLK 68

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KI VIKEVRAIT LGLKEAK+LVE APK +K  ++K EA E+KKKLE AGA V
Sbjct: 69  --EAGANKIGVIKEVRAITGLGLKEAKDLVEGAPKPVKENVAKAEAEEIKKKLEAAGAKV 126

Query: 124 ELR 126
           EL+
Sbjct: 127 ELK 129


>gi|148269603|ref|YP_001244063.1| 50S ribosomal protein L7/L12 [Thermotoga petrophila RKU-1]
 gi|170288279|ref|YP_001738517.1| ribosomal protein L7/L12 [Thermotoga sp. RQ2]
 gi|281411679|ref|YP_003345758.1| ribosomal protein L7/L12 [Thermotoga naphthophila RKU-10]
 gi|166222223|sp|A5IJW4|RL7_THEP1 RecName: Full=50S ribosomal protein L7/L12
 gi|226734488|sp|B1L936|RL7_THESQ RecName: Full=50S ribosomal protein L7/L12
 gi|147735147|gb|ABQ46487.1| LSU ribosomal protein L12P [Thermotoga petrophila RKU-1]
 gi|170175782|gb|ACB08834.1| ribosomal protein L7/L12 [Thermotoga sp. RQ2]
 gi|281372782|gb|ADA66344.1| ribosomal protein L7/L12 [Thermotoga naphthophila RKU-10]
          Length = 128

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 85/126 (67%), Gaps = 3/126 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ I+E +  LT+ E AEL K+LE ++GV+A+APV+V A   A A + A+++ + E  + 
Sbjct: 3   IDEIIEAIEKLTVSELAELVKKLEDKFGVTAAAPVAVAAAPVAGAAAGAAQEEKTEFDVV 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKS---LKTGLSKDEANEMKKKLEDAG 120
                + KI VIK VR IT LGLKEAK+LVE A      +K+G+ K EA ++KKKLE+AG
Sbjct: 63  LKSFGQNKIQVIKVVREITGLGLKEAKDLVEKAGSPDAIIKSGVPKQEAEDIKKKLEEAG 122

Query: 121 ATVELR 126
           A VEL+
Sbjct: 123 AEVELK 128


>gi|119383498|ref|YP_914554.1| 50S ribosomal protein L7/L12 [Paracoccus denitrificans PD1222]
 gi|166222189|sp|A1B014|RL7_PARDP RecName: Full=50S ribosomal protein L7/L12
 gi|119373265|gb|ABL68858.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Paracoccus
           denitrificans PD1222]
          Length = 124

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 66/127 (51%), Positives = 86/127 (67%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-PVAAEAGSAASEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    AA    AA EKTEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKNILKDEYGIEPAAGGAVMVAGPAAGPAEAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVR IT LGLKEAK+LVE+  K +K G SK +A EMKKKLE A
Sbjct: 61  VVL--VDAGANKINVIKEVRGITGLGLKEAKDLVEAGGK-VKEGASKADAEEMKKKLEAA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|239825683|ref|YP_002948307.1| 50S ribosomal protein L7/L12 [Geobacillus sp. WCH70]
 gi|239805976|gb|ACS23041.1| ribosomal protein L7/L12 [Geobacillus sp. WCH70]
          Length = 122

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M   E I+E + ++T++E  EL K +E+E+    +A   VV    A  G AA+EKTEF+V
Sbjct: 1   MMTKEQIIEAVKNMTVLELNELVKAIEEEF--GVTAAAPVVVAGGAAGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIK VR IT LGLKEAK+LV++ PK +K G+SK+EA E+K KLE+ G
Sbjct: 59  IL--ADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGVSKEEAEEIKAKLEEVG 116

Query: 121 ATVELR 126
           A+VE++
Sbjct: 117 ASVEVK 122


>gi|218779769|ref|YP_002431087.1| 50S ribosomal protein L7/L12 [Desulfatibacillum alkenivorans AK-01]
 gi|226733673|sp|B8FEU2|RL7_DESAA RecName: Full=50S ribosomal protein L7/L12
 gi|218761153|gb|ACL03619.1| ribosomal protein L7/L12 [Desulfatibacillum alkenivorans AK-01]
          Length = 126

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 64/128 (50%), Positives = 96/128 (75%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I  E ++E ++++T++E +EL K +E+++GVSA+APV+ VA     A  A  EKTEF
Sbjct: 1   MADITKEDVLEFIANMTVLELSELIKDIEEKFGVSAAAPVAAVAMAGPAAADAEEEKTEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L       KKI VIKEVRAIT LGLKEAK LVE APK++K G++K++A ++K++LE 
Sbjct: 61  DVIL--LSAGDKKIQVIKEVRAITGLGLKEAKALVEEAPKAVKEGIAKEDAEKVKEQLEG 118

Query: 119 AGATVELR 126
           AGA V+++
Sbjct: 119 AGAQVDIK 126


>gi|77918307|ref|YP_356122.1| 50S ribosomal protein L7/L12 [Pelobacter carbinolicus DSM 2380]
 gi|109893778|sp|Q3A6Q5|RL7_PELCD RecName: Full=50S ribosomal protein L7/L12
 gi|77544390|gb|ABA87952.1| LSU ribosomal protein L12P [Pelobacter carbinolicus DSM 2380]
          Length = 127

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTE 57
           M++I  E +V  + +++++E AEL K LE+++GVSA+APV+V A   A AG+AA  EK E
Sbjct: 1   MADITKEQVVSFIENMSVLELAELVKELEEKFGVSAAAPVAVAAAPGAAAGAAAAEEKDE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVLK      KKI VIK VRA T LGLKEAK++V+ AP+++K  + K EA E+KK+LE
Sbjct: 61  FDVVLKS--AGDKKINVIKVVRAATGLGLKEAKDMVDGAPQTIKEAMPKAEAEELKKQLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAAVELK 127


>gi|253577169|ref|ZP_04854489.1| 50S ribosomal protein L7/L12 [Paenibacillus sp. oral taxon 786 str.
           D14]
 gi|251843413|gb|EES71441.1| 50S ribosomal protein L7/L12 [Paenibacillus sp. oral taxon 786 str.
           D14]
          Length = 122

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E+I+E +  +T++E  +L K +E+E+    +A   VVA   A  G AA E++EF+V+L  
Sbjct: 4   EAILEAIKGMTVLELNDLVKAIEEEF-GVTAAAPVVVAGGGAAGGGAAEEQSEFDVILT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAK+LV++APK LK  + K+EA+ +K KLE+AGATVE
Sbjct: 62  -NAGASKINVIKVVREITGLGLKEAKDLVDNAPKPLKEKVGKEEADSIKAKLEEAGATVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|227510703|ref|ZP_03940752.1| ribosomal protein L7/L12 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
 gi|227513718|ref|ZP_03943767.1| ribosomal protein L7/L12 [Lactobacillus buchneri ATCC 11577]
 gi|227522465|ref|ZP_03952514.1| ribosomal protein L7/L12 [Lactobacillus hilgardii ATCC 8290]
 gi|227083037|gb|EEI18349.1| ribosomal protein L7/L12 [Lactobacillus buchneri ATCC 11577]
 gi|227090417|gb|EEI25729.1| ribosomal protein L7/L12 [Lactobacillus hilgardii ATCC 8290]
 gi|227189824|gb|EEI69891.1| ribosomal protein L7/L12 [Lactobacillus brevis subsp. gravesensis
           ATCC 27305]
          Length = 121

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 45/124 (36%), Positives = 75/124 (60%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++I+++L   ++ +  +L K +E E+GVSA+APV      AA   +     T+    +
Sbjct: 4   DKDNIIDQLKDASISDLNDLVKSIEDEFGVSAAAPV------AAAGAAGGEAATKDSYDV 57

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  +   +K+  IK VR IT LGLK+AK LV+  P ++K G+S+DEAN++K+ LE  G  
Sbjct: 58  ELTESGDQKVKAIKAVREITGLGLKDAKGLVDKVPSTIKEGVSEDEANKIKETLEAVGGV 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|328350873|emb|CCA37273.1| 50S ribosomal protein L12-1, chloroplastic [Pichia pastoris CBS
           7435]
          Length = 167

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 49/132 (37%), Positives = 71/132 (53%), Gaps = 9/132 (6%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSA--------SAPVSVVAPVAAEAGSAAS 53
           + I +IV++++ L L+E + L   L+    ++         +      APV  E      
Sbjct: 36  AKITNIVDQIAQLNLLETSALISELKTRLNIADIAFPAAGAAPAQQAAAPVEEEVKEEVE 95

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F V L+ F D K K  VIKEV+++  L L EAK+ VESAPK LK  + K++A ++K
Sbjct: 96  EKTIFAVKLESF-DTKSKAKVIKEVKSLLGLSLVEAKKFVESAPKVLKENVPKEDAEKIK 154

Query: 114 KKLEDAGATVEL 125
             LE  GA V L
Sbjct: 155 GVLEGLGAKVTL 166


>gi|288554715|ref|YP_003426650.1| 50S ribosomal protein L7/L12 [Bacillus pseudofirmus OF4]
 gi|288545875|gb|ADC49758.1| 50S ribosomal protein L7/L12 [Bacillus pseudofirmus OF4]
          Length = 120

 Score = 81.1 bits (199), Expect = 4e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 78/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  +T++E  +L K +E+E+        + VA     A   A+E+TEF+++L  
Sbjct: 4   EQIIEAVKEMTVLELNDLVKAIEEEF---GVTAAAPVAVAGGAAEGGAAEQTEFDLILTS 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAK LV+ AP  +K G++K+EA EMK KLEDAGA+VE
Sbjct: 61  --AGGSKIGVIKVVREITGLGLKEAKALVDGAPSPVKEGIAKEEAEEMKAKLEDAGASVE 118

Query: 125 LR 126
           ++
Sbjct: 119 VK 120


>gi|329938252|ref|ZP_08287703.1| 50S ribosomal protein L7/L12 [Streptomyces griseoaurantiacus M045]
 gi|329302741|gb|EGG46631.1| 50S ribosomal protein L7/L12 [Streptomyces griseoaurantiacus M045]
          Length = 129

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 56/131 (42%), Positives = 84/131 (64%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  + ++E+   +TLIE +E  K  E+++ V+A+A   VV    A  G+AA     K
Sbjct: 1   MAKLSQDELLEQFEGMTLIELSEFVKAFEEKFDVTAAAAAPVVVAGGAAGGAAAEAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+VVL G     KKI VIK VR +T LGLKEAK+LV+ APK +   ++K+ A++ K+ 
Sbjct: 61  DEFDVVLTG--AGDKKIQVIKVVRELTSLGLKEAKDLVDGAPKPVLEKVTKEAADKAKES 118

Query: 116 LEDAGATVELR 126
           LE AGA+VE++
Sbjct: 119 LEGAGASVEVK 129


>gi|84685446|ref|ZP_01013344.1| ribosomal protein L7/L12 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666603|gb|EAQ13075.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2654]
          Length = 125

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 54/125 (43%), Positives = 81/125 (64%), Gaps = 1/125 (0%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E++  LTL+EA EL + L++E+G+  +A  +V+    A   + A+ + + E 
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKEILKEEYGIEPAAGGAVMMAGPAGGDAGAAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KIAVIKEVR IT LGLKEAK+LVE+  K +K G+ K EA ++K KLE AG
Sbjct: 61  DVVLKSAGGNKIAVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEDIKGKLEAAG 119

Query: 121 ATVEL 125
           A VEL
Sbjct: 120 AEVEL 124


>gi|270483719|ref|NP_001162028.1| mitochondrial ribosomal protein L12 [Nasonia vitripennis]
          Length = 181

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 41/128 (32%), Positives = 70/128 (54%), Gaps = 5/128 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAA-----EAGSAASEKTE 57
            I+ I ++++SL LIE AELS  L+K   +  +  + V    AA     E  +  + K+ 
Sbjct: 53  KIDKIAQEITSLNLIEVAELSDLLKKRLNLPDAPVMPVGGFAAAPRVEEEEAAPKAIKSS 112

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F V L  FDD +K   + +    +    L +AK+ VESAP+ +K  ++K+EA+++K+ L 
Sbjct: 113 FTVKLMKFDDKQKVALIKEIKSILPGTNLVQAKKFVESAPQVVKADIAKEEADKLKEALS 172

Query: 118 DAGATVEL 125
             GA + +
Sbjct: 173 KVGAEIVI 180


>gi|303282951|ref|XP_003060767.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226458238|gb|EEH55536.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 129

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 84/127 (66%), Gaps = 4/127 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAP---VSVVAPVAAEAGSAASEKTEF 58
           +  + I+EK+  LTL+EA+EL K++E+ +GV ASAP   + + A  A  A  AA EKTEF
Sbjct: 3   ATTDDIIEKMKGLTLLEASELVKQIEEVFGVDASAPAGGMVMAAGPAGGAAEAAEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           ++V+K  D  K +IA+IK VR++T LGLKEAK+ V + P S+  G SK E  E  K L +
Sbjct: 63  DLVIKDVDASK-RIAIIKVVRSLTSLGLKEAKDAVTNLPFSILEGKSKAECEEAMKTLTE 121

Query: 119 AGATVEL 125
            GAT E+
Sbjct: 122 GGATCEI 128


>gi|239636939|ref|ZP_04677937.1| ribosomal protein L7/L12 [Staphylococcus warneri L37603]
 gi|239597487|gb|EEQ79986.1| ribosomal protein L7/L12 [Staphylococcus warneri L37603]
 gi|330686266|gb|EGG97878.1| ribosomal protein L7/L12 [Staphylococcus epidermidis VCU121]
          Length = 122

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAGGGEAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  + K++A ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEAMPKEDAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|223042996|ref|ZP_03613044.1| ribosomal protein L7/L12 [Staphylococcus capitis SK14]
 gi|242372758|ref|ZP_04818332.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis M23864:W1]
 gi|314932764|ref|ZP_07840133.1| ribosomal protein L7/L12 [Staphylococcus caprae C87]
 gi|222443850|gb|EEE49947.1| ribosomal protein L7/L12 [Staphylococcus capitis SK14]
 gi|242349531|gb|EES41132.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis M23864:W1]
 gi|313654445|gb|EFS18198.1| ribosomal protein L7/L12 [Staphylococcus caprae C87]
          Length = 122

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  + K++A ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEAMPKEDAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|70727466|ref|YP_254382.1| 50S ribosomal protein L7/L12 [Staphylococcus haemolyticus JCSC1435]
 gi|82581598|sp|Q4L3K1|RL7_STAHJ RecName: Full=50S ribosomal protein L7/L12
 gi|68448192|dbj|BAE05776.1| 50S ribosomal protein L7/L12 [Staphylococcus haemolyticus JCSC1435]
          Length = 122

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 91/126 (72%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV++APK +K G++K+EA ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDNAPKVIKEGVAKEEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|313677112|ref|YP_004055108.1| LSU ribosomal protein l12p [Marivirga tractuosa DSM 4126]
 gi|312943810|gb|ADR23000.1| LSU ribosomal protein L12P [Marivirga tractuosa DSM 4126]
          Length = 125

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I++I ++L  LT+ E  EL+  L++  G+  +A  + V       G  A  EKT F+
Sbjct: 1   MADIKAIGDQLVELTVKEVNELADYLKETHGIEPAAAAAPVMAAGGAGGGDAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL        K+ V+K V+ +T LGLKEAKELV+ APK++K G++KDEA  +KK+LE+A
Sbjct: 61  VVLTS--AGAAKLQVVKAVKELTGLGLKEAKELVDGAPKAVKEGVAKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|167768211|ref|ZP_02440264.1| hypothetical protein CLOSS21_02767 [Clostridium sp. SS2/1]
 gi|317499070|ref|ZP_07957350.1| ribosomal protein L7/L12 [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167709735|gb|EDS20314.1| hypothetical protein CLOSS21_02767 [Clostridium sp. SS2/1]
 gi|291560230|emb|CBL39030.1| LSU ribosomal protein L12P [butyrate-producing bacterium SSC/2]
 gi|316893646|gb|EFV15848.1| ribosomal protein L7/L12 [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 120

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 78/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  L+++E  +L K  E+E+GVSA+A V V    AA A   A EK EF+V L  
Sbjct: 4   QEIIEVIKGLSVLELNDLVKACEEEFGVSAAAGVVV---AAAGAEGGAEEKDEFDVELTE 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR +T LGLKEAKELV+ APK +K G SK EA ++K KLE+ GA V 
Sbjct: 61  V--GGAKVKVIKAVREVTGLGLKEAKELVDGAPKVIKEGASKAEAEDIKAKLEEQGAKVT 118

Query: 125 LR 126
           L+
Sbjct: 119 LK 120


>gi|73748757|ref|YP_307996.1| 50S ribosomal protein L7/L12 [Dehalococcoides sp. CBDB1]
 gi|109893761|sp|Q3ZXY0|RL7_DEHSC RecName: Full=50S ribosomal protein L7/L12
 gi|73660473|emb|CAI83080.1| ribosomal protein L7 [Dehalococcoides sp. CBDB1]
          Length = 123

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 86/123 (69%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ ++  +  +T+IE +EL K LEKE+GVSA+  V+      A A +A  EKTEF V+LK
Sbjct: 3   IDEMMSAIKGMTVIELSELVKALEKEFGVSAAVAVAAPTAGGAAAAAAVEEKTEFNVILK 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             D    KI VIK VR +T LGLKEAK++VE+APK++K  +SK+EA+  KK LE AGATV
Sbjct: 63  --DVGANKINVIKAVRELTSLGLKEAKDMVEAAPKAVKENVSKEEADAAKKALEAAGATV 120

Query: 124 ELR 126
           E++
Sbjct: 121 EIK 123


>gi|289705070|ref|ZP_06501481.1| ribosomal protein L7/L12 [Micrococcus luteus SK58]
 gi|289558233|gb|EFD51513.1| ribosomal protein L7/L12 [Micrococcus luteus SK58]
          Length = 128

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 83/128 (64%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E ++     LTLIE +E  K  E+++ V+A+APV+V A   A  G+ A+ + + 
Sbjct: 1   MAKLTTEELLAAFEELTLIELSEFIKAFEEKFDVTAAAPVAVAAAGGAAGGAEAAAEEKD 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +       KKI VIKEVRA+T LGLKEAK+LV+ APK +  G++K+ A + K++LE 
Sbjct: 61  EFDVILEAAGDKKIGVIKEVRALTSLGLKEAKDLVDGAPKPVLEGVNKEAAEKAKEQLEG 120

Query: 119 AGATVELR 126
           AGATV L+
Sbjct: 121 AGATVTLK 128


>gi|170750238|ref|YP_001756498.1| 50S ribosomal protein L7/L12 [Methylobacterium radiotolerans JCM
           2831]
 gi|226733708|sp|B1LY44|RL7_METRJ RecName: Full=50S ribosomal protein L7/L12
 gi|170656760|gb|ACB25815.1| ribosomal protein L7/L12 [Methylobacterium radiotolerans JCM 2831]
          Length = 125

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 73/127 (57%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  +V+ LSSLT++EAA+L+K LE++WGVSA+A V+V A  AA   +AA  E+TEF 
Sbjct: 1   MADLAKLVDDLSSLTVLEAADLAKMLEEKWGVSAAAAVAVAAGPAAGGAAAAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G++KDEA ++K +LE A
Sbjct: 61  VVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGVAKDEAEKLKAQLEKA 118

Query: 120 GATVELR 126
           GA +EL+
Sbjct: 119 GAKIELK 125


>gi|238765328|ref|ZP_04626254.1| 50S ribosomal protein L7/L12 [Yersinia kristensenii ATCC 33638]
 gi|238696455|gb|EEP89246.1| 50S ribosomal protein L7/L12 [Yersinia kristensenii ATCC 33638]
          Length = 122

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  A  E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AAAAEAVEEQTEFNVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   + K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AGA+VE
Sbjct: 63  F--GENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKKSLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|311896603|dbj|BAJ29011.1| putative ribosomal protein L7/L12 [Kitasatospora setae KM-6054]
          Length = 126

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 57/128 (44%), Positives = 84/128 (65%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E ++E+   +TLIE +E  K  E+++ V+A+APV+V A  A  A  A  E+ EF
Sbjct: 1   MAKLSTEDLLEQFEGMTLIELSEFVKAFEEKFDVTAAAPVAVAAAGAPAAAEAVEEQDEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L G     KKI VIKEVRA+T LGLKEAK+LV++A   +   ++KD A + K +LE 
Sbjct: 61  DVILDG--AGDKKIQVIKEVRALTSLGLKEAKDLVDTAGAKVLEKVAKDVAEKAKAQLEG 118

Query: 119 AGATVELR 126
           AGA V ++
Sbjct: 119 AGAKVTVK 126


>gi|291543748|emb|CBL16857.1| LSU ribosomal protein L12P [Ruminococcus sp. 18P13]
          Length = 123

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 82/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            I   VE +  +T++E +EL   +++E+GV+A+   +     A    +AA EKTEF+VVL
Sbjct: 5   KILKFVEDIKGMTVMELSELVDAIQEEFGVTAAIAAAPA---AGAGAAAAEEKTEFDVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     K+ VIK V+ I  LGLKEAKE+VESAPK+LK G SK +A E+K KLE AGAT
Sbjct: 62  ASF--GDSKMGVIKAVKEILGLGLKEAKEVVESAPKTLKEGASKADAEEIKTKLEAAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|39938745|ref|NP_950511.1| 50S ribosomal protein L7/L12 [Onion yellows phytoplasma OY-M]
 gi|39721854|dbj|BAD04344.1| ribosomal protein L7/L12 [Onion yellows phytoplasma OY-M]
          Length = 136

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 76/128 (59%), Gaps = 5/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E+ V  L  ++L+E  EL   L++E+G+  +A    VA   A   +   EKTEF
Sbjct: 12  MAKLTKEAFVSALKEMSLLEIKELLDGLKEEFGIDPTAL--AVAAPGANNSAEVEEKTEF 69

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VV+K F D KKK+AVIK VR +T LGL +A   V+     +K  +SK  A ++K KLE 
Sbjct: 70  TVVMKSF-DEKKKLAVIKTVREVTGLGLLDAANFVKVPDSKVKENVSKALAEDIKNKLEQ 128

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 129 AGAVVELQ 136


>gi|15612685|ref|NP_240988.1| 50S ribosomal protein L7/L12 [Bacillus halodurans C-125]
 gi|14195174|sp|Q9KGE3|RL7_BACHD RecName: Full=50S ribosomal protein L7/L12
 gi|10172734|dbj|BAB03841.1| 50S ribosomal protein L7/L12 [Bacillus halodurans C-125]
          Length = 121

 Score = 81.1 bits (199), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 80/122 (65%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +  +T++E  +L K +E+E+    +A   V     A A   A+EKTEF+VVL+ 
Sbjct: 4   DQIIEAIKEMTVLELNDLVKAIEEEF--GVTAAAPVAVAGGAAAEGGAAEKTEFDVVLES 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KI VIK VR IT LGLKEAK LV+ AP  +K G++K+EA EMK KLE+AGA+VE
Sbjct: 62  --AGGSKINVIKVVREITGLGLKEAKALVDGAPAPIKEGVAKEEAEEMKAKLEEAGASVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|304437201|ref|ZP_07397162.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
 gi|304369863|gb|EFM23527.1| ribosomal protein L7/L12 [Selenomonas sp. oral taxon 149 str.
           67H29BP]
          Length = 123

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 66/124 (53%), Positives = 88/124 (70%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A   A   +   EKTEF VVL
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAVGGAAPAAGGEEKTEFTVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KKI VIK VR  T LGLKEAKELV+ APK +K  ++K EA E+KKKLE+AGAT
Sbjct: 62  AA--AGDKKINVIKAVREATGLGLKEAKELVDGAPKPIKENIAKAEAEELKKKLEEAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|227536130|ref|ZP_03966179.1| 50S ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC
           33300]
 gi|227244027|gb|EEI94042.1| 50S ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC
           33300]
          Length = 125

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ + E+L +LT+ E  EL+  L+ E+G+  +A    VA   AE G+AA+E KT F+
Sbjct: 1   MADLKQLAEQLVNLTVKEVKELADILKDEYGIEPAAAAVAVAAAPAEGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +  LGLKEAK+LV+ APK LKTG+SKDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLAGLGLKEAKDLVDGAPKELKTGVSKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|325954354|ref|YP_004238014.1| 50S ribosomal protein L7/L12 [Weeksella virosa DSM 16922]
 gi|323436972|gb|ADX67436.1| 50S ribosomal protein L7/L12 [Weeksella virosa DSM 16922]
          Length = 122

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++++ + E+L +LT++E  ELS  L+ E+G+  +A   VV        +AA E++EF+V
Sbjct: 1   MADLKKLAEELVNLTVVEVNELSTILKDEYGIEPAAAAVVV--AGGAGEAAAEEQSEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+AV+K V+ +T  GLKEAK+LV+SAP ++K  +SK+EA  +KK+LE+AG
Sbjct: 59  ILKA--GGANKLAVVKLVKDLTGKGLKEAKDLVDSAPATIKEQVSKEEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|300776013|ref|ZP_07085872.1| ribosomal protein L7/L12 [Chryseobacterium gleum ATCC 35910]
 gi|300505146|gb|EFK36285.1| ribosomal protein L7/L12 [Chryseobacterium gleum ATCC 35910]
          Length = 122

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS+++++ E L +LT+ +  EL+  L+ E+G+  +A   VV      AG AA EKTEF+V
Sbjct: 1   MSDLKNLAETLVNLTVKDVNELAAILKDEYGIEPAAAAVVV--AGGAAGEAAEEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+A++K V+ +T  GLKEAK++V+ AP  +KTG+SKDEA  +KK+LE+AG
Sbjct: 59  ILKS--AGASKLAIVKLVKDLTGAGLKEAKDIVDGAPAPIKTGVSKDEAEALKKQLEEAG 116

Query: 121 ATVELR 126
           A VEL+
Sbjct: 117 AEVELK 122


>gi|194476826|ref|YP_002049005.1| 50S ribosomal protein L7/L12 [Paulinella chromatophora]
 gi|171191833|gb|ACB42795.1| 50S ribosomal protein L7/L12 [Paulinella chromatophora]
          Length = 129

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 60/128 (46%), Positives = 85/128 (66%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG---SAASEKTEF 58
           +  + I+E L +L+L+EA+EL K++E+ +GVSASA   ++      AG    A  E+TEF
Sbjct: 3   TKTDEILESLKTLSLLEASELVKQIEEAFGVSASAGAGIMMAAPVAAGGVADAVEEQTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+ FD    KI V+K VR  T LGL EAK LVESAPK++K G++KDEA  +KK +E 
Sbjct: 63  DVILESFDAAA-KIKVLKAVREATSLGLGEAKALVESAPKAIKEGIAKDEAEALKKAIEA 121

Query: 119 AGATVELR 126
            G  V L+
Sbjct: 122 VGGKVTLK 129


>gi|288929386|ref|ZP_06423231.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329488|gb|EFC68074.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 126

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 48/126 (38%), Positives = 77/126 (61%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L++E+G+  +A    VA       +A   + +   
Sbjct: 1   MADIKAIAEELVNLTVKEVNELANVLKEEYGIEPAAAAVAVAAAPGAGAAAGGAEEKSSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +    K+ V+K V+    LGLKEAK+LV+  P +LK G+SKDEA  +KK +E+AG
Sbjct: 61  DVVLVEAGAAKLQVVKAVKEACGLGLKEAKDLVDGVPSTLKEGMSKDEAENLKKAIEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|146278577|ref|YP_001168736.1| 50S ribosomal protein L7/L12 [Rhodobacter sphaeroides ATCC 17025]
 gi|166222201|sp|A4WVL7|RL7_RHOS5 RecName: Full=50S ribosomal protein L7/L12
 gi|145556818|gb|ABP71431.1| LSU ribosomal protein L12P [Rhodobacter sphaeroides ATCC 17025]
          Length = 124

 Score = 80.7 bits (198), Expect = 5e-14,   Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 84/127 (66%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-PVAAEAGSAASEKTEFE 59
           M+++  + E +  LTL+EA EL   L+ ++G+  +A  +V+    AA A  A  EKTEF+
Sbjct: 1   MADLNKLAEDIVGLTLLEAQELKTILKDKYGIEPAAGGAVMVAGPAAAAAPAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE+  K +K   SK +A  MKKKLE+A
Sbjct: 61  VVLT--DAGANKINVIKEVRAITGLGLKEAKDLVEAGGK-VKEAASKADAEAMKKKLEEA 117

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 118 GAKVELK 124


>gi|254509121|ref|ZP_05121222.1| ribosomal protein L7/L12 [Vibrio parahaemolyticus 16]
 gi|219547959|gb|EED24983.1| ribosomal protein L7/L12 [Vibrio parahaemolyticus 16]
          Length = 122

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GVSA+A V       A AG AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVSAAAAVVAG---GAAAGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ KDEA  +K +LE+AGATV 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGIEKDEAEALKAQLEEAGATVV 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|238760255|ref|ZP_04621399.1| 50S ribosomal protein L7/L12 [Yersinia aldovae ATCC 35236]
 gi|238701519|gb|EEP94092.1| 50S ribosomal protein L7/L12 [Yersinia aldovae ATCC 35236]
          Length = 122

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  A  E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AAAAEAVEEQTEFNVVLTS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK L +AGA VE
Sbjct: 63  F--GANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKALTEAGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|223982607|ref|ZP_03632842.1| hypothetical protein HOLDEFILI_00116 [Holdemania filiformis DSM
           12042]
 gi|223965444|gb|EEF69721.1| hypothetical protein HOLDEFILI_00116 [Holdemania filiformis DSM
           12042]
          Length = 123

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 80/128 (62%), Gaps = 7/128 (5%)

Query: 1   MSNIE--SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +    I+E L  +T++E  EL K +E+E+GV+A+APV+  AP  A A +  +E + F
Sbjct: 1   MAKLTNAEIIESLKEMTILELNELVKAIEEEFGVTAAAPVAAAAPAEAAAPTGPTEVSVF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
                  +    K+ VIK VR IT LGL EAK LV+  P ++K  +  +EA E+KKKL D
Sbjct: 61  -----LKEVGASKVGVIKVVREITGLGLVEAKGLVDKCPSAIKENIKPEEAEEIKKKLMD 115

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 116 AGASVEIK 123


>gi|82701891|ref|YP_411457.1| 50S ribosomal protein L7/L12 [Nitrosospira multiformis ATCC 25196]
 gi|109893774|sp|Q2YB06|RL7_NITMU RecName: Full=50S ribosomal protein L7/L12
 gi|82409956|gb|ABB74065.1| LSU ribosomal protein L12P [Nitrosospira multiformis ATCC 25196]
          Length = 126

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLKG 64
            I++ ++++T++E ++L K +E+++GVSA+A   V A  AA A +A   E+TEF V+L  
Sbjct: 7   EILDAIANMTVLELSQLIKEMEEKFGVSAAAAAVVAAAPAAGAAAAPAEEQTEFTVMLTA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               + K+ VIK VRA+T LGLKEAK+LV+ APK +K G++K +A  ++K+L +AGAT E
Sbjct: 67  V--GESKVNVIKVVRAVTGLGLKEAKDLVDGAPKPVKEGIAKADAEAIQKQLAEAGATAE 124

Query: 125 LR 126
           ++
Sbjct: 125 IK 126


>gi|257126635|ref|YP_003164749.1| ribosomal protein L7/L12 [Leptotrichia buccalis C-1013-b]
 gi|257050574|gb|ACV39758.1| ribosomal protein L7/L12 [Leptotrichia buccalis C-1013-b]
          Length = 123

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 61/124 (49%), Positives = 84/124 (67%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L +++++E  E+ + +E+ +GVSA          AA  G+AA EKTEF+V+L
Sbjct: 4   NKEQFIEDLKAMSVLELKEVVEAIEETFGVSAQPVAVAG--GAAAGGAAAEEKTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+AVIKEVR IT LGLKEAKELVE+  K++K G+SK+EA  +K +LE AGAT
Sbjct: 62  --VSPGGAKLAVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKEEAEAVKAQLEGAGAT 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|289618744|emb|CBI54718.1| unnamed protein product [Sordaria macrospora]
          Length = 177

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 44/134 (32%), Positives = 70/134 (52%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----------VVAPVAAEAGSA 51
            I +IV+++S+LTL+E +EL   L+    +                         EA  A
Sbjct: 44  KISAIVDQISTLTLLETSELVASLKSRLNIPDLPVGGFAAAASGPAPAAAPAEEEEAAPA 103

Query: 52  ASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
           A+EKT F + L+ FD    K  VIKEV+ +  L L E+K+ VESAPK +K  + K++A +
Sbjct: 104 AAEKTLFTLKLEKFDAAA-KPKVIKEVKNLLGLSLVESKKFVESAPKVMKESVPKEDAEK 162

Query: 112 MKKKLEDAGATVEL 125
           +   +++ GA V +
Sbjct: 163 IVAAMKELGAVVTM 176


>gi|313898213|ref|ZP_07831751.1| ribosomal protein L7/L12 [Clostridium sp. HGF2]
 gi|312956977|gb|EFR38607.1| ribosomal protein L7/L12 [Clostridium sp. HGF2]
          Length = 123

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 79/128 (61%), Gaps = 7/128 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E I+  L   T++E  EL K +E+++GV+A+APV+V A     A +  SE    
Sbjct: 1   MAKLAQEDILAYLEEATILELNELVKAIEEKFGVTAAAPVAVAAVADDAAAAGPSE---- 56

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V +   D    K+AVIK VR IT LGL +AK LV+ AP  +K  +  +EA E+KKKL D
Sbjct: 57  -VTVTLTDIGGTKVAVIKAVREITGLGLVDAKGLVDKAPSVIKENIKPEEAEEIKKKLMD 115

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 116 AGASVEIK 123


>gi|256852102|ref|ZP_05557489.1| ribosomal protein L7/L12 [Lactobacillus jensenii 27-2-CHN]
 gi|260661328|ref|ZP_05862241.1| ribosomal protein L7/L12 [Lactobacillus jensenii 115-3-CHN]
 gi|282934789|ref|ZP_06340027.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
 gi|297205023|ref|ZP_06922419.1| ribosomal protein L7/L12 [Lactobacillus jensenii JV-V16]
 gi|256615514|gb|EEU20704.1| ribosomal protein L7/L12 [Lactobacillus jensenii 27-2-CHN]
 gi|260547783|gb|EEX23760.1| ribosomal protein L7/L12 [Lactobacillus jensenii 115-3-CHN]
 gi|281301152|gb|EFA93458.1| ribosomal protein L7/L12 [Lactobacillus jensenii 208-1]
 gi|297149601|gb|EFH29898.1| ribosomal protein L7/L12 [Lactobacillus jensenii JV-V16]
          Length = 120

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 88/124 (70%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E+L   T++E  +L K +E+E+ V+A+APV      AA A + A+ KTEF+V L
Sbjct: 4   DTEKIIEELKGATILELNDLVKAIEEEFDVTAAAPV-----AAAGAAAGAAAKTEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK +K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKAVREITGLGLKDSKDLVDGAPKVIKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
           V ++
Sbjct: 117 VTVK 120


>gi|123440674|ref|YP_001004667.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|166222227|sp|A1JIH9|RL7_YERE8 RecName: Full=50S ribosomal protein L7/L12
 gi|122087635|emb|CAL10417.1| 50S ribosomal protein L7/L12 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 122

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  A  E+TEF VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AAAAEAVEEQTEFNVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AGA VE
Sbjct: 63  F--GDNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAESLKKSLEEAGAAVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|118579111|ref|YP_900361.1| 50S ribosomal protein L7/L12 [Pelobacter propionicus DSM 2379]
 gi|166222190|sp|A1ALT3|RL7_PELPD RecName: Full=50S ribosomal protein L7/L12
 gi|118501821|gb|ABK98303.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Pelobacter
           propionicus DSM 2379]
          Length = 127

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 91/123 (73%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           + ++E +  ++++E +EL K LE+++GVSA+APV+V A   A A +AA  EKTEF+V+LK
Sbjct: 7   QDVIEYIEKMSVLELSELVKELEEKFGVSAAAPVAVAAAGPATADAAAAEEKTEFDVILK 66

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+LV+ AP ++KTG+SK EA + +K+L +AGA V
Sbjct: 67  A--AGANKINVIKVVRALTSLGLKEAKDLVDGAPGAVKTGVSKQEAEDAQKQLVEAGAEV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|81429278|ref|YP_396279.1| 50S ribosomal protein L7/L12 [Lactobacillus sakei subsp. sakei 23K]
 gi|109893771|sp|Q38V11|RL7_LACSS RecName: Full=50S ribosomal protein L7/L12
 gi|78610921|emb|CAI55973.1| 50S ribosomal protein L7/L12 [Lactobacillus sakei subsp. sakei 23K]
          Length = 122

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 54/124 (43%), Positives = 82/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           ++ +IV++L   +++E  +L K +E+E+GVSA+APV      AA A  A +   +    +
Sbjct: 4   DVNAIVDQLKESSILELNDLVKAIEEEFGVSAAAPV-----AAAGAAGADAAAEKDSFTV 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  +  ++K+ VIK VR IT LGLK+AK LV++AP +LK  +SKDEA EMK KLE+ GA 
Sbjct: 59  ELSEIGQEKVKVIKAVREITGLGLKDAKGLVDNAPSALKEDVSKDEAEEMKAKLEEVGAV 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VNLK 122


>gi|37524447|ref|NP_927791.1| 50S ribosomal protein L7/L12 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|81572739|sp|Q7N9A5|RL7_PHOLL RecName: Full=50S ribosomal protein L7/L12
 gi|36783871|emb|CAE12733.1| 50S ribosomal protein L7/L12 (L8) [Photorhabdus luminescens subsp.
           laumondii TTO1]
          Length = 123

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 87/125 (69%), Gaps = 6/125 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I++ ++++++++  EL   +E ++GVSA+A V+V    A  A  A  E+TEF+VVL
Sbjct: 4   NKEQILDAVATMSVMDVVELITAMEDKFGVSAAAAVAV---AAGGAAEAVEEQTEFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAP-KSLKTGLSKDEANEMKKKLEDAGA 121
                   K+AVIK VR  T LGLKEAK+LVESAP  +LK G+SKD+A  +KK LE+AGA
Sbjct: 61  SAI--GGNKVAVIKAVRGATGLGLKEAKDLVESAPNATLKEGISKDDAEALKKSLEEAGA 118

Query: 122 TVELR 126
           +VE++
Sbjct: 119 SVEIK 123


>gi|323700799|ref|ZP_08112711.1| ribosomal protein L7/L12 [Desulfovibrio sp. ND132]
 gi|323460731|gb|EGB16596.1| ribosomal protein L7/L12 [Desulfovibrio desulfuricans ND132]
          Length = 128

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 87/128 (67%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I  E +VE + ++T+++ +E  K LE  +GV A+AP   VA   A  G AA+E+ + 
Sbjct: 1   MADITKEQVVEFIGNMTVLQLSEFIKELEDVFGVEAAAPAVAVAAAPAAGGEAAAEEEQT 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +        KIAVIK VRAIT LGLKEAK LV+ APK+LK G+SK+EA+E  K+L++
Sbjct: 61  EFDVVLTGAGANKIAVIKAVRAITGLGLKEAKALVDEAPKALKEGVSKEEADEAAKQLQE 120

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 121 AGAEVEVK 128


>gi|298708207|emb|CBJ30546.1| 50S ribosomal protein L7/L12, putative [Ectocarpus siliculosus]
          Length = 244

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 55/131 (41%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--------VVAPVAAEAGSAASE 54
            +  ++  + SL  +E A L    + + G+     +S               +A +AA+E
Sbjct: 114 KVLEVMASIESLNFVEMAMLIDVFKNKLGLDELPTLSFGGADGGGESGGGDGDAPAAAAE 173

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KT F+V + GF D   KI VIKEVR IT LGL+EAKE+VES P+ +K  L +DEA  MK 
Sbjct: 174 KTIFKVKVTGFGDKA-KIKVIKEVRVITGLGLREAKEMVESLPQVVKEDLKEDEAEAMKA 232

Query: 115 KLEDAGATVEL 125
           KLE  GATVEL
Sbjct: 233 KLEAVGATVEL 243


>gi|89053058|ref|YP_508509.1| 50S ribosomal protein L7/L12 [Jannaschia sp. CCS1]
 gi|109893770|sp|Q28UX8|RL7_JANSC RecName: Full=50S ribosomal protein L7/L12
 gi|88862607|gb|ABD53484.1| LSU ribosomal protein L12P [Jannaschia sp. CCS1]
          Length = 124

 Score = 80.7 bits (198), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 64/126 (50%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-PVAAEAGSAASEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+    A  AG AA E+TEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPADGAGGAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGVDKAEAEEIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|27467222|ref|NP_763859.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis ATCC
           12228]
 gi|57866132|ref|YP_187777.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis RP62A]
 gi|242241872|ref|ZP_04796317.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis W23144]
 gi|251809957|ref|ZP_04824430.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|282875009|ref|ZP_06283884.1| ribosomal protein L7/L12 [Staphylococcus epidermidis SK135]
 gi|293367916|ref|ZP_06614554.1| ribosomal protein L7/L12 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|38258365|sp|Q8CTT1|RL7_STAES RecName: Full=50S ribosomal protein L7/L12
 gi|81675387|sp|Q5HRL2|RL7_STAEQ RecName: Full=50S ribosomal protein L7/L12
 gi|27314764|gb|AAO03901.1|AE016744_304 50S ribosomal protein L7/L12 [Staphylococcus epidermidis ATCC
           12228]
 gi|57636790|gb|AAW53578.1| ribosomal protein L7/L12 [Staphylococcus epidermidis RP62A]
 gi|242234650|gb|EES36962.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis W23144]
 gi|251806500|gb|EES59157.1| 50S ribosomal protein L7/L12 [Staphylococcus epidermidis
           BCM-HMP0060]
 gi|281296337|gb|EFA88856.1| ribosomal protein L7/L12 [Staphylococcus epidermidis SK135]
 gi|291317945|gb|EFE58353.1| ribosomal protein L7/L12 [Staphylococcus epidermidis
           M23864:W2(grey)]
 gi|319399711|gb|EFV87960.1| ribosomal protein L7/L12 [Staphylococcus epidermidis FRI909]
 gi|329729440|gb|EGG65843.1| ribosomal protein L7/L12 [Staphylococcus epidermidis VCU144]
 gi|329734660|gb|EGG70967.1| ribosomal protein L7/L12 [Staphylococcus epidermidis VCU028]
 gi|329738048|gb|EGG74269.1| ribosomal protein L7/L12 [Staphylococcus epidermidis VCU045]
          Length = 122

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 88/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  + K++A ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEAMPKEDAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 117 ASVELK 122


>gi|116493228|ref|YP_804963.1| 50S ribosomal protein L12P [Pediococcus pentosaceus ATCC 25745]
 gi|122265308|sp|Q03E51|RL7_PEDPA RecName: Full=50S ribosomal protein L7/L12
 gi|116103378|gb|ABJ68521.1| LSU ribosomal protein L12P [Pediococcus pentosaceus ATCC 25745]
          Length = 121

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + +  +E L   ++ +  +L K +E E+GVSA+APV+     A  AG AA  KT F V L
Sbjct: 4   DKDQFIEDLKGASITDLNDLVKAIEDEFGVSAAAPVA----AAGAAGGAAEAKTSFNVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR IT  GLK+AK++V++AP  +K  +S+DEANE+K KLE+AGAT
Sbjct: 60  TS--GGSAKIKVIKAVREITGAGLKDAKDMVDNAPSVIKEDVSEDEANELKAKLEEAGAT 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|291457152|ref|ZP_06596542.1| ribosomal protein L7/L12 [Bifidobacterium breve DSM 20213]
 gi|291380987|gb|EFE88505.1| ribosomal protein L7/L12 [Bifidobacterium breve DSM 20213]
          Length = 126

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 78/122 (63%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+AP +V       A  AA EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPAAVAVAAPGAAAPAAEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT+LGL EAK LV+ APK++     K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRAITNLGLAEAKGLVDGAPKAVLEKAKKEDAEKAKAQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|317485868|ref|ZP_07944730.1| ribosomal protein L7/L12 [Bilophila wadsworthia 3_1_6]
 gi|316922883|gb|EFV44107.1| ribosomal protein L7/L12 [Bilophila wadsworthia 3_1_6]
          Length = 126

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 87/123 (70%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E +VE ++++T++E +E  K LE+++GVSA+AP + +   A    +A +E KTEF+V+LK
Sbjct: 6   EEVVEFIANMTVLELSEFIKELEEKFGVSAAAPAAAMMVAAPAEAAAPAEEKTEFDVILK 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  KI VIK VRA+T LGLKEAK+ V+ AP +LK  +SK+EA E KK+L +AGA V
Sbjct: 66  S--AGANKIGVIKVVRALTGLGLKEAKDKVDGAPSTLKEAVSKEEAEEAKKQLVEAGAEV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|168334901|ref|ZP_02693022.1| ribosomal protein L7/L12 [Epulopiscium sp. 'N.t. morphotype B']
          Length = 122

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 76/123 (61%), Gaps = 6/123 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I  I++ +  LT++E  EL    E+E+GVSA+A V + A  A        EKTEF+V L 
Sbjct: 6   INEIIDAVKELTILELNELVTACEEEFGVSAAAGVMMAAGPAV----VEEEKTEFDVELT 61

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                 +KI VIK VR IT LGLKEAK++ E APK +K GLSK++A  +K KLE  GA V
Sbjct: 62  ET--GGEKIKVIKVVREITGLGLKEAKDVAEGAPKIIKEGLSKEDAEAIKAKLEAVGAKV 119

Query: 124 ELR 126
            L+
Sbjct: 120 TLK 122


>gi|153871196|ref|ZP_02000429.1| 50S ribosomal protein L7/L12 [Beggiatoa sp. PS]
 gi|152072336|gb|EDN69569.1| 50S ribosomal protein L7/L12 [Beggiatoa sp. PS]
          Length = 124

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++++T++E  EL K +E+++GVSA+APV+V    +    +A   +TEF V L  
Sbjct: 6   EDILESIANMTVMEVVELVKAMEEKFGVSAAAPVAVAVATSEGEAAAPE-QTEFTVTLTS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   +KK+ VIK +R+IT LGLKEAKELVE  P  +K  + KDEA ++K +LE+AG + E
Sbjct: 65  F--GEKKVQVIKVIRSITGLGLKEAKELVEGVPSVVKEAIPKDEAEKIKTELEEAGGSAE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|16330008|ref|NP_440736.1| 50S ribosomal protein L7/L12 [Synechocystis sp. PCC 6803]
 gi|132654|sp|P23349|RL7_SYNY3 RecName: Full=50S ribosomal protein L7/L12
 gi|47476|emb|CAA37318.1| unnamed protein product [Synechocystis sp. PCC 6803]
 gi|1652495|dbj|BAA17416.1| 50S ribosomal protein L12 [Synechocystis sp. PCC 6803]
 gi|227225|prf||1617100B ribosomal protein L12
          Length = 128

 Score = 80.7 bits (198), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 65/127 (51%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFE 59
           +  + I+E+L SL+L+EA+EL K++E+ +GVSA+APV   V+A  AA    AA EKTEF+
Sbjct: 3   AATDQILEQLKSLSLLEASELVKQIEEAFGVSAAAPVGGMVMAAAAAAPAEAAEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L+      KKIAV+K VR IT LGLKEAKELVES PK++K    KD+A  +KK++E+A
Sbjct: 63  VILEEV-PADKKIAVLKVVRTITGLGLKEAKELVESTPKAIKEATGKDDAEAIKKQIEEA 121

Query: 120 GATVELR 126
           G    ++
Sbjct: 122 GGKAAVK 128


>gi|217967753|ref|YP_002353259.1| ribosomal protein L7/L12 [Dictyoglomus turgidum DSM 6724]
 gi|226733677|sp|B8E0K0|RL7_DICTD RecName: Full=50S ribosomal protein L7/L12
 gi|217336852|gb|ACK42645.1| ribosomal protein L7/L12 [Dictyoglomus turgidum DSM 6724]
          Length = 125

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 79/124 (63%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I++ +  + +IE  EL K LE+E+GVSA+ PV+ V    A A +AA  + +    +
Sbjct: 2   NKEEIIQAIKEMKVIELVELVKALEEEFGVSAAMPVAAVGAPVAGAAAAAPVEEKTTFDV 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI V+K VR IT LGLKEAK+LV+S PK +K G+SK EA E+K KLE  GA 
Sbjct: 62  ILKDAGANKIKVLKVVREITGLGLKEAKDLVDSTPKPIKEGVSKQEAEEIKAKLEAEGAV 121

Query: 123 VELR 126
           VE++
Sbjct: 122 VEIK 125


>gi|262401580|ref|ZP_06078147.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio sp. RC586]
 gi|262352295|gb|EEZ01424.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio sp. RC586]
          Length = 121

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 81/122 (66%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V      AA    A  E+TEF VVL  
Sbjct: 6   EQILDAIAEMSVMQVVELISAMEEKFGVSAAAAVVSGPAAAA----AVEEQTEFNVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP ++K  +SK+EA  +KK+LE+AGATVE
Sbjct: 62  --AGANKVAVIKAVRGATGLGLKEAKALVDGAPATVKEAVSKEEAEALKKELEEAGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|45198430|ref|NP_985459.1| AFL089Cp [Ashbya gossypii ATCC 10895]
 gi|44984317|gb|AAS53283.1| AFL089Cp [Ashbya gossypii ATCC 10895]
          Length = 166

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 48/131 (36%), Positives = 68/131 (51%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------- 55
            I  IVE++S+LTL+E + L   L+    +   A     A   A   +  +         
Sbjct: 36  KIAQIVEQISTLTLLETSALIGELKTRLNIPDIAMAVGGAAAPAAPAAPEAAAEEEVKEE 95

Query: 56  -TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
            T F V L+ F D K K  VIKEV+ +  L L EAK+ VE+APK L+  ++K+EA ++K 
Sbjct: 96  KTIFAVKLEAF-DAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKVLRENVAKEEAEKVKA 154

Query: 115 KLEDAGATVEL 125
            LE  GA V L
Sbjct: 155 SLEALGAKVVL 165


>gi|224023599|ref|ZP_03641965.1| hypothetical protein BACCOPRO_00306 [Bacteroides coprophilus DSM
           18228]
 gi|224016821|gb|EEF74833.1| hypothetical protein BACCOPRO_00306 [Bacteroides coprophilus DSM
           18228]
          Length = 125

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAAGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK+LV+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGAAKLQVVKAVKESCGLGLKEAKDLVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|22124398|ref|NP_667821.1| 50S ribosomal protein L7/L12 [Yersinia pestis KIM 10]
 gi|51594637|ref|YP_068828.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 32953]
 gi|108809611|ref|YP_653527.1| 50S ribosomal protein L7/L12 [Yersinia pestis Antiqua]
 gi|108810384|ref|YP_646151.1| 50S ribosomal protein L7/L12 [Yersinia pestis Nepal516]
 gi|145600989|ref|YP_001165065.1| 50S ribosomal protein L7/L12 [Yersinia pestis Pestoides F]
 gi|153949418|ref|YP_001402812.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 31758]
 gi|153997218|ref|ZP_02022325.1| 50S ribosomal protein L7/L12 [Yersinia pestis CA88-4125]
 gi|165928323|ref|ZP_02224155.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165938174|ref|ZP_02226733.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|166012060|ref|ZP_02232958.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166214399|ref|ZP_02240434.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|167402407|ref|ZP_02307867.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167422931|ref|ZP_02314684.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167426797|ref|ZP_02318550.1| ribosomal protein L7/L12 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|170022596|ref|YP_001719101.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis YPIII]
 gi|186893638|ref|YP_001870750.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis PB1/+]
 gi|218930753|ref|YP_002348628.1| 50S ribosomal protein L7/L12 [Yersinia pestis CO92]
 gi|229837494|ref|ZP_04457656.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Pestoides A]
 gi|229899992|ref|ZP_04515132.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229900559|ref|ZP_04515685.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Nepal516]
 gi|270488915|ref|ZP_06205989.1| ribosomal protein L7/L12 [Yersinia pestis KIM D27]
 gi|284987553|ref|NP_994404.2| ribosomal protein L7/L12 [Yersinia pestis biovar Microtus str.
           91001]
 gi|294505416|ref|YP_003569478.1| 50S ribosomal protein L7/L12 [Yersinia pestis Z176003]
 gi|20978565|sp|Q8ZAP4|RL7_YERPE RecName: Full=50S ribosomal protein L7/L12
 gi|81640667|sp|Q66FQ3|RL7_YERPS RecName: Full=50S ribosomal protein L7/L12
 gi|123072549|sp|Q1C1U0|RL7_YERPA RecName: Full=50S ribosomal protein L7/L12
 gi|123073625|sp|Q1CN79|RL7_YERPN RecName: Full=50S ribosomal protein L7/L12
 gi|166222228|sp|A4TS30|RL7_YERPP RecName: Full=50S ribosomal protein L7/L12
 gi|166990992|sp|A7FNI4|RL7_YERP3 RecName: Full=50S ribosomal protein L7/L12
 gi|226734498|sp|B2K111|RL7_YERPB RecName: Full=50S ribosomal protein L7/L12
 gi|226734500|sp|B1JJJ7|RL7_YERPY RecName: Full=50S ribosomal protein L7/L12
 gi|21957180|gb|AAM84072.1|AE013649_2 50S ribosomal subunit protein L7/L12 [Yersinia pestis KIM 10]
 gi|51587919|emb|CAH19522.1| 50S ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 32953]
 gi|108774032|gb|ABG16551.1| LSU ribosomal protein L12P [Yersinia pestis Nepal516]
 gi|108781524|gb|ABG15582.1| LSU ribosomal protein L12P [Yersinia pestis Antiqua]
 gi|115349364|emb|CAL22335.1| 50S ribosomal protein L7/L12 [Yersinia pestis CO92]
 gi|145212685|gb|ABP42092.1| LSU ribosomal protein L12P [Yersinia pestis Pestoides F]
 gi|149289326|gb|EDM39405.1| 50S ribosomal protein L7/L12 [Yersinia pestis CA88-4125]
 gi|152960913|gb|ABS48374.1| ribosomal protein L7/L12 [Yersinia pseudotuberculosis IP 31758]
 gi|165913835|gb|EDR32453.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           IP275]
 gi|165919662|gb|EDR36995.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           F1991016]
 gi|165989055|gb|EDR41356.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           E1979001]
 gi|166204403|gb|EDR48883.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           B42003004]
 gi|166957142|gb|EDR55163.1| ribosomal protein L7/L12 [Yersinia pestis biovar Orientalis str.
           MG05-1020]
 gi|167048187|gb|EDR59595.1| ribosomal protein L7/L12 [Yersinia pestis biovar Antiqua str.
           UG05-0454]
 gi|167054179|gb|EDR64004.1| ribosomal protein L7/L12 [Yersinia pestis biovar Mediaevalis str.
           K1973002]
 gi|169749130|gb|ACA66648.1| ribosomal protein L7/L12 [Yersinia pseudotuberculosis YPIII]
 gi|186696664|gb|ACC87293.1| ribosomal protein L7/L12 [Yersinia pseudotuberculosis PB1/+]
 gi|229682379|gb|EEO78469.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Nepal516]
 gi|229686977|gb|EEO79053.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229704182|gb|EEO91193.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis Pestoides A]
 gi|262363482|gb|ACY60203.1| 50S ribosomal protein L7/L12 [Yersinia pestis D106004]
 gi|262367410|gb|ACY63967.1| 50S ribosomal protein L7/L12 [Yersinia pestis D182038]
 gi|270337419|gb|EFA48196.1| ribosomal protein L7/L12 [Yersinia pestis KIM D27]
 gi|294355875|gb|ADE66216.1| 50S ribosomal protein L7/L12 [Yersinia pestis Z176003]
 gi|320013656|gb|ADV97227.1| 50S ribosomal subunit protein L7/L12 [Yersinia pestis biovar
           Medievalis str. Harbin 35]
          Length = 122

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 87/122 (71%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+A  +      A A  AA E+TEF+VVL  
Sbjct: 7   DQILEGVAALSVMEIVELISAMEEKFGVSAAAVAAGP----AAAVEAAEEQTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   + K+AVIK VR  T LGLKEAK+LVESAP  LK G++KDEA  +KK LE+AGA+VE
Sbjct: 63  F--GENKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVNKDEAETLKKSLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|168021680|ref|XP_001763369.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685504|gb|EDQ71899.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 132

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 80/126 (63%), Gaps = 4/126 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA---SAPVSVVAPVAAEAGSAASEKTEFE 59
            ++ +V ++  LTL EA   +++L++  GVSA   ++P    A V AEA  A  EKTEF+
Sbjct: 8   KLDRLVSEVEQLTLEEARVFTEKLQERLGVSASSFASPAGTAAGVPAEAAPAVEEKTEFD 67

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +VL        +IAVIK VR +T LGLKEAK+++E  PK +K G+SK++A E +K LE A
Sbjct: 68  LVLDEV-PSSARIAVIKAVRTLTALGLKEAKDMIEGLPKKVKEGVSKEDAEEAQKALEAA 126

Query: 120 GATVEL 125
           GA   +
Sbjct: 127 GAKCSI 132


>gi|86606437|ref|YP_475200.1| 50S ribosomal protein L7/L12 [Synechococcus sp. JA-3-3Ab]
 gi|109893808|sp|Q2JTQ2|RL7_SYNJA RecName: Full=50S ribosomal protein L7/L12
 gi|86554979|gb|ABC99937.1| ribosomal protein L7/L12 [Synechococcus sp. JA-3-3Ab]
          Length = 137

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 63/133 (47%), Positives = 94/133 (70%), Gaps = 11/133 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--------- 54
           ++ I+E+L +L+L+EA+EL K +E+ +GVSA+AP   +   A  A +AA           
Sbjct: 6   VQKILEELKALSLLEASELVKAIEEAFGVSAAAPAGGMVMAAPVAAAAAPAPAAAPEPVE 65

Query: 55  -KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
            +T F+V+L+      KKIAV+K VR +T LGLK+AK+LVE+APK +K G+ K+EANE+K
Sbjct: 66  EQTAFDVILEAV-PADKKIAVLKVVRELTGLGLKDAKDLVEAAPKPVKEGIPKEEANEIK 124

Query: 114 KKLEDAGATVELR 126
           KKLE+AGATV+++
Sbjct: 125 KKLEEAGATVKVK 137


>gi|224475688|ref|YP_002633294.1| 50S ribosomal protein L7/L12 [Staphylococcus carnosus subsp.
           carnosus TM300]
 gi|222420295|emb|CAL27109.1| 50S ribosomal protein L7/L12 [Staphylococcus carnosus subsp.
           carnosus TM300]
          Length = 121

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 57/126 (45%), Positives = 87/126 (69%), Gaps = 5/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+      A  G  A+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA---GAAGGGEAAEKTEFDV 57

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV++APK +K  L K+EA ++K++LE+ G
Sbjct: 58  ELTS--AGSSKIKVVKAVKDATGLGLKDAKELVDNAPKVIKEALPKEEAEKLKEQLEEVG 115

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 116 ASVELK 121


>gi|209527685|ref|ZP_03276182.1| ribosomal protein L7/L12 [Arthrospira maxima CS-328]
 gi|209491857|gb|EDZ92215.1| ribosomal protein L7/L12 [Arthrospira maxima CS-328]
          Length = 134

 Score = 80.3 bits (197), Expect = 7e-14,   Method: Composition-based stats.
 Identities = 64/132 (48%), Positives = 90/132 (68%), Gaps = 9/132 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
             + I+E+L SL+L+EA+EL K++E+ +GV ASA       + A  G AA          
Sbjct: 4   KTDQILEQLKSLSLLEASELVKQIEEAFGVDASASAGGGMMMMAAPGMAAPGAEAAAEEE 63

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L  F    KKIAV+K VR+IT LGLKEAK+LVESAPK++K   +K++A  +KK
Sbjct: 64  KTEFDVILTEF-PADKKIAVLKVVRSITGLGLKEAKDLVESAPKAIKEATTKEDAESIKK 122

Query: 115 KLEDAGATVELR 126
           +LE+AGA VE++
Sbjct: 123 QLEEAGAKVEVK 134


>gi|292670286|ref|ZP_06603712.1| ribosomal protein L7/L12 [Selenomonas noxia ATCC 43541]
 gi|292648017|gb|EFF65989.1| ribosomal protein L7/L12 [Selenomonas noxia ATCC 43541]
          Length = 124

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           N + I+E + ++T++E +EL K +E+++GVSA+APV+V A   A   +A   EK+EF VV
Sbjct: 2   NKDQILEAIENMTVLELSELVKAMEEKFGVSAAAPVAVAAAGGAAPAAAGGEEKSEFTVV 61

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L       KKI VIK VR  T LGLKEAKELV+ APK +K  ++K EA+E+K KLE+AGA
Sbjct: 62  LAA--AGDKKINVIKAVREATGLGLKEAKELVDGAPKPVKENVAKAEADELKAKLEEAGA 119

Query: 122 TVELR 126
           TVEL+
Sbjct: 120 TVELK 124


>gi|326319226|ref|YP_004236898.1| 50S ribosomal protein L7/L12 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323376062|gb|ADX48331.1| ribosomal protein L7/L12 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 125

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S++++E  +L K +E+++GVSA+A  +  A     A +AA EKTEF VVL
Sbjct: 4   DKDAFLTALDSMSVMELNDLVKAIEEKFGVSAAAMAAPAAAGGGGAAAAAEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K+AVIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA 
Sbjct: 64  A--EAGANKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGAK 121

Query: 123 VELR 126
            EL+
Sbjct: 122 AELK 125


>gi|302559015|ref|ZP_07311357.1| 50S ribosomal protein L7/L12 [Streptomyces griseoflavus Tu4000]
 gi|302476633|gb|EFL39726.1| 50S ribosomal protein L7/L12 [Streptomyces griseoflavus Tu4000]
          Length = 127

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 54/129 (41%), Positives = 81/129 (62%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPV-AAEAGSAASEKTE 57
           M+ +  E ++ +   +TLIE +E  K  E+++ V+A+A V+V  P     A  A  EK E
Sbjct: 1   MAKLSQEDLLAQFEEMTLIELSEFVKAFEEKFDVTAAAAVAVAGPAQGGPAAPAEEEKDE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L G     KKI VIK VR +T LGLKEAK+LV+ APK +   ++KD A +  + L+
Sbjct: 61  FDVILTG--AGDKKIQVIKVVRELTSLGLKEAKDLVDGAPKPVLEKVAKDAAEKAAESLK 118

Query: 118 DAGATVELR 126
            AGA+VE++
Sbjct: 119 GAGASVEVK 127


>gi|220904900|ref|YP_002480212.1| ribosomal protein L7/L12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254806369|sp|B8J1A7|RL7_DESDA RecName: Full=50S ribosomal protein L7/L12
 gi|219869199|gb|ACL49534.1| ribosomal protein L7/L12 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
          Length = 128

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 62/125 (49%), Positives = 88/125 (70%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFEVV 61
           E +VE +S++T++E +E  K LE+++GVSA+AP + +   A  AG AA    EKTEF+V+
Sbjct: 6   EEVVEFISNMTVLELSEFIKELEEKFGVSAAAPAAAMMVAAPAAGGAADAAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK  +    KI VIK VRA+T LGLKEAKE V+  P +LK  +SK+EA + KK+L +AGA
Sbjct: 66  LK--EAGANKIGVIKVVRALTSLGLKEAKEKVDGCPSTLKEAVSKEEAEDAKKQLTEAGA 123

Query: 122 TVELR 126
            VE++
Sbjct: 124 VVEVK 128


>gi|282879908|ref|ZP_06288633.1| ribosomal protein L7/L12 [Prevotella timonensis CRIS 5C-B1]
 gi|281306210|gb|EFA98245.1| ribosomal protein L7/L12 [Prevotella timonensis CRIS 5C-B1]
          Length = 126

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 80/126 (63%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A  G+A + + +   
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAGGAAGAAEEKTSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +    K+ V+K V+    LGLKEAK+LV+ AP ++K GLSK+EA  +KK +E+AG
Sbjct: 61  DVVLTEVGATKLQVVKAVKEACGLGLKEAKDLVDGAPATIKEGLSKEEAENLKKAIEEAG 120

Query: 121 ATVELR 126
           A +EL+
Sbjct: 121 AKIELK 126


>gi|294630865|ref|ZP_06709425.1| 50S ribosomal protein L7/L12 [Streptomyces sp. e14]
 gi|292834198|gb|EFF92547.1| 50S ribosomal protein L7/L12 [Streptomyces sp. e14]
          Length = 135

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 55/131 (41%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  E ++ +   +TLIE +E  K  E+++ V+A+A   VV    A  G+AA     K
Sbjct: 7   MAKLTQEDLLAQFEEMTLIELSEFVKAFEEKFDVTAAAAAPVVVAGGAAGGAAAEAAEEK 66

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+V+L G     KKI VIK VR +T LGLKEAK+LV+ APK +   ++K+ A++ K+ 
Sbjct: 67  DEFDVILTG--AGDKKIQVIKVVRELTSLGLKEAKDLVDGAPKPVLEKVNKEAADKAKES 124

Query: 116 LEDAGATVELR 126
           LE AGA+VE++
Sbjct: 125 LEGAGASVEVK 135


>gi|302876543|ref|YP_003845176.1| 50S ribosomal protein L7/L12 [Clostridium cellulovorans 743B]
 gi|307687216|ref|ZP_07629662.1| 50S ribosomal protein L7/L12 [Clostridium cellulovorans 743B]
 gi|302579400|gb|ADL53412.1| ribosomal protein L7/L12 [Clostridium cellulovorans 743B]
          Length = 119

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 88/124 (70%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +   I+E + ++T++E  EL    E+E+GVSA+APV+VV      A +AA EKTEF VVL
Sbjct: 2   DKNQIIEAIKNMTVLELNELVTACEEEFGVSAAAPVAVV---GGAAPAAAEEKTEFNVVL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K     K+KI VIK VR +T LGLKEAKELV+  PK+LK G+SK+EA+ MK KLE+ GA 
Sbjct: 59  KE---AKEKIKVIKVVRELTGLGLKEAKELVDGVPKALKEGVSKEEADAMKAKLEEVGAV 115

Query: 123 VELR 126
           VEL+
Sbjct: 116 VELQ 119


>gi|227903271|ref|ZP_04021076.1| 50S ribosomal protein L7/L12 [Lactobacillus acidophilus ATCC 4796]
 gi|227869076|gb|EEJ76497.1| 50S ribosomal protein L7/L12 [Lactobacillus acidophilus ATCC 4796]
          Length = 120

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 85/124 (68%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + E I+E+L   +++E  +L K +E E+ V+A+APV      AA A  AA  K+ F+V L
Sbjct: 4   DTEKIIEELKGASILELNDLVKAIEDEFDVTAAAPV-----AAAGAAGAAEAKSSFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +  ++K+ VIK VR IT LGLK++K+LV+ APK++K G+S+DEAN++K KLE+ GAT
Sbjct: 59  T--EAGQEKVKVIKVVRDITGLGLKDSKDLVDGAPKNVKEGVSEDEANDIKAKLEEVGAT 116

Query: 123 VELR 126
             L+
Sbjct: 117 ATLK 120


>gi|291533630|emb|CBL06743.1| LSU ribosomal protein L12P [Megamonas hypermegale ART12/1]
          Length = 122

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E +EL K +E+++GVSA+APV+V A   A  G+AA EKTEF+V+L  
Sbjct: 4   EEIMQAIEEMTVLELSELVKAMEEKFGVSAAAPVAVAA-APAAGGAAAEEKTEFDVILAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR +T LGLKEAK LV+ AP  +K G SK++A  +K KLE+AGATVE
Sbjct: 63  --AGDKKINVIKVVREVTGLGLKEAKALVDGAPAPVKEGASKEDAEALKAKLEEAGATVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|269991321|emb|CAX12505.1| 50S ribosomal protein L12 [Fucus vesiculosus]
          Length = 132

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 59/130 (45%), Positives = 83/130 (63%), Gaps = 7/130 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSAS------APVSVVAPVAAEAGSAASEKT 56
            I +++E+L +LTL+EAAEL K +E+ + V A         +     ++ E  +   EKT
Sbjct: 4   KISTLIEELKTLTLLEAAELVKSIEETFDVDAPTGGASGVMMMNPGAISTEDNNTVEEKT 63

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           EF+V L+      KKIA++K VR++T+LGLKEAKE+VE+ PK +K GL K  A E KK L
Sbjct: 64  EFDVSLEEV-PKDKKIAILKVVRSVTELGLKEAKEVVENTPKVIKEGLPKVAAEEAKKLL 122

Query: 117 EDAGATVELR 126
           EDAGA V L+
Sbjct: 123 EDAGAVVILK 132


>gi|15896393|ref|NP_349742.1| ribosomal protein L7/L12 [Clostridium acetobutylicum ATCC 824]
 gi|20978568|sp|Q97EG8|RL7_CLOAB RecName: Full=50S ribosomal protein L7/L12
 gi|15026211|gb|AAK81082.1|AE007810_1 Ribosomal protein L7/L12 [Clostridium acetobutylicum ATCC 824]
 gi|325510549|gb|ADZ22185.1| Ribosomal protein L7/L12 [Clostridium acetobutylicum EA 2018]
          Length = 123

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 85/122 (69%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  ++++E  EL K  E+E+GVSA+APV+V     A   +A  EKTEF+VVL  
Sbjct: 4   EEIIEAIKGMSVLELNELVKACEEEFGVSAAAPVAVAGAAGAAGAAAGEEKTEFDVVL-- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   KK+ VIK VR +T LGLK+AK LV+ APK++K G++K+EA  MK K+E+AG  VE
Sbjct: 62  AEAGAKKLQVIKVVRELTGLGLKDAKALVDGAPKTIKEGVAKEEAESMKAKIEEAGGKVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|153835071|ref|ZP_01987738.1| ribosomal protein L7/L12 [Vibrio harveyi HY01]
 gi|148868467|gb|EDL67573.1| ribosomal protein L7/L12 [Vibrio harveyi HY01]
          Length = 122

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GVSA+A    V    A  G AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVSAAA---AVVAGGAAGGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ K EA+ +K +LE+AGATV 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVDKAEADALKAQLEEAGATVA 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|269123260|ref|YP_003305837.1| 50S ribosomal protein L7/L12 [Streptobacillus moniliformis DSM
           12112]
 gi|268314586|gb|ACZ00960.1| ribosomal protein L7/L12 [Streptobacillus moniliformis DSM 12112]
          Length = 121

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L ++T++E  E+ + +E+ +GVSA           A A  A  EKT F+VVL
Sbjct: 4   NKEQFIEDLKAMTVLELKEVVEAIEETFGVSAQPVAVA---GGAVAAEAVEEKTNFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G      KIAVIKEVR+IT LGLKEAK+LV++    +K G SK+EA E+K KLE AGA+
Sbjct: 61  TG--AGANKIAVIKEVRSITGLGLKEAKDLVDNGGA-VKEGASKEEAEEIKGKLEAAGAS 117

Query: 123 VELR 126
           VEL+
Sbjct: 118 VELK 121


>gi|224537808|ref|ZP_03678347.1| hypothetical protein BACCELL_02695 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224520628|gb|EEF89733.1| hypothetical protein BACCELL_02695 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 125

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 58/127 (45%), Positives = 84/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G+AA  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK+LV+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGSAKLQVVKAVKEACGLGLKEAKDLVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|95930694|ref|ZP_01313427.1| ribosomal protein L7/L12 [Desulfuromonas acetoxidans DSM 684]
 gi|95133174|gb|EAT14840.1| ribosomal protein L7/L12 [Desulfuromonas acetoxidans DSM 684]
          Length = 127

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 65/129 (50%), Positives = 95/129 (73%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTE 57
           M++I  E ++E + +++++E +EL K LE ++GVSA+APV+V A   A    AA  EKTE
Sbjct: 1   MADITKEQVIEFIENMSVLELSELVKELEDKFGVSAAAPVAVAAAGPAGDAGAAAEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVL G     KKI VIK VR++T LGLKEAKE+V+ AP ++K   +K+EA ++KK+LE
Sbjct: 61  FDVVLTG--AGDKKINVIKVVRSVTGLGLKEAKEMVDGAPSTVKEAAAKEEAEDIKKQLE 118

Query: 118 DAGATVELR 126
           +AGA+VEL+
Sbjct: 119 EAGASVELK 127


>gi|284050924|ref|ZP_06381134.1| 50S ribosomal protein L7/L12 [Arthrospira platensis str. Paraca]
 gi|291565929|dbj|BAI88201.1| 50S ribosomal protein L7/L12 [Arthrospira platensis NIES-39]
          Length = 134

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 63/132 (47%), Positives = 90/132 (68%), Gaps = 9/132 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
             + I+E+L SL+L+EA+EL K++E+ +GV ASA       + A  G AA          
Sbjct: 4   KTDQILEQLKSLSLLEASELVKQIEEAFGVDASASAGGGMMMMAAPGMAAPGAEAAAEEE 63

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KTEF+V+L  F    KKIAV+K VR+IT LGLKEAK+LVESAPK++K   +K++A  +KK
Sbjct: 64  KTEFDVILTEF-PADKKIAVLKVVRSITGLGLKEAKDLVESAPKAIKEATTKEDAESIKK 122

Query: 115 KLEDAGATVELR 126
           +LE++GA VE++
Sbjct: 123 QLEESGAKVEVK 134


>gi|1710600|sp|P52827|RM12_CRICR RecName: Full=39S ribosomal protein L12, mitochondrial;
           Short=L12mt; Short=MRP-L12; AltName: Full=P2A1; Flags:
           Precursor
 gi|1313936|emb|CAA56248.1| mitochondrial ribosomal protein [Cricetus cricetus]
          Length = 203

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 38/139 (27%), Positives = 68/139 (48%), Gaps = 17/139 (12%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS------------ 50
            I+ +V+ ++SLTL+E ++L++ L+K   +     + +   +     +            
Sbjct: 65  KIQQLVQDIASLTLLEISDLNELLKKTLKIQDVGLMPMGGMMPGAVPAAAAAAPEVAEGE 124

Query: 51  ---AASEKTEFEVVLKGFDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSK 106
                 E+T F V L        K+ +IKE++     + L +AK+LVES P+ +K  ++K
Sbjct: 125 DILKQKERTHFTVRLTEAKPVD-KVKLIKEIKNYVQGINLVQAKKLVESLPQEIKANVAK 183

Query: 107 DEANEMKKKLEDAGATVEL 125
            EA ++K  LE  G TV L
Sbjct: 184 AEAEKIKAALEAVGGTVVL 202


>gi|225175683|ref|ZP_03729677.1| ribosomal protein L7/L12 [Dethiobacter alkaliphilus AHT 1]
 gi|225169012|gb|EEG77812.1| ribosomal protein L7/L12 [Dethiobacter alkaliphilus AHT 1]
          Length = 125

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 63/127 (49%), Positives = 94/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFE 59
           MS +  ++E +  +T++E +EL K  E+E+GVSA+APV++ A  AA   + A+ E+TEF+
Sbjct: 1   MSKVNEVLEIVKEMTVLELSELVKAFEEEFGVSAAAPVAMAAAPAAGGDAPAAAEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL G     KK+ VIK VR  T LGLKEAKELV++APK++K  +SK++A+ +K KLE+A
Sbjct: 61  VVLSG--AGDKKVQVIKAVREATGLGLKEAKELVDNAPKAVKEKVSKEDADALKAKLEEA 118

Query: 120 GATVELR 126
           GA+VE++
Sbjct: 119 GASVEVK 125


>gi|224370698|ref|YP_002604862.1| 50S ribosomal protein L7/L12 [Desulfobacterium autotrophicum HRM2]
 gi|259491643|sp|C0Q9Y0|RL7_DESAH RecName: Full=50S ribosomal protein L7/L12
 gi|223693415|gb|ACN16698.1| RplL [Desulfobacterium autotrophicum HRM2]
          Length = 127

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 95/129 (73%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTE 57
           M+++  + +VE +++++++E +EL K LE+++GVSA+APV+++A   A    AA  E+TE
Sbjct: 1   MADVTKDDVVEFIANMSVLELSELVKELEEKFGVSAAAPVAMMAAGGAADAGAAAEEQTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L+      KKI VIKEVRAIT LGLKEAK LV+ APK +K G+ K+EA ++K +LE
Sbjct: 61  FDVILEA--AGDKKIGVIKEVRAITGLGLKEAKALVDEAPKPVKEGIVKEEAEKIKAQLE 118

Query: 118 DAGATVELR 126
            AGA V ++
Sbjct: 119 AAGAQVSVK 127


>gi|46446237|ref|YP_007602.1| 50S ribosomal protein L7/L12 [Candidatus Protochlamydia amoebophila
           UWE25]
 gi|81627412|sp|Q6MDM2|RL7_PARUW RecName: Full=50S ribosomal protein L7/L12
 gi|46399878|emb|CAF23327.1| probable 50S ribosomal protein L7/L12 [Candidatus Protochlamydia
           amoebophila UWE25]
          Length = 129

 Score = 80.3 bits (197), Expect = 8e-14,   Method: Composition-based stats.
 Identities = 64/124 (51%), Positives = 81/124 (65%), Gaps = 1/124 (0%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
             E +V+ LS LT++E AEL   LE +WGV A+APV+V AP A    +A  E T+F+V L
Sbjct: 5   KTEELVDALSELTVLEMAELKTLLEDKWGVKAAAPVAVAAPAAGAPAAAVVESTDFQVTL 64

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KKI +IK VR IT LGLKEAK+LVE+APK LK    K EA ++KKK+E AG  
Sbjct: 65  TEA-PADKKIGIIKVVREITGLGLKEAKDLVEAAPKELKPTAPKAEAEDIKKKIETAGGK 123

Query: 123 VELR 126
           V L+
Sbjct: 124 VTLK 127


>gi|254458746|ref|ZP_05072170.1| ribosomal protein L7/L12 [Campylobacterales bacterium GD 1]
 gi|207084512|gb|EDZ61800.1| ribosomal protein L7/L12 [Campylobacterales bacterium GD 1]
          Length = 123

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S L+++E +EL K  E+++GVSA      +A  AA  G+AA E+TEF+V++  
Sbjct: 6   EDVLEFISGLSVLELSELVKEFEEKFGVSAQP--VAMAGGAAAGGAAAEEQTEFDVIIT- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   KKI VIK VRA+T LGLKEAKE  E+ P ++K G+ K+ A   KK+LE+AGATVE
Sbjct: 63  -DAGAKKIGVIKAVRALTGLGLKEAKEATEALPSTIKEGVDKETAEAAKKELEEAGATVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|325104982|ref|YP_004274636.1| LSU ribosomal protein L12P [Pedobacter saltans DSM 12145]
 gi|324973830|gb|ADY52814.1| LSU ribosomal protein L12P [Pedobacter saltans DSM 12145]
          Length = 125

 Score = 80.3 bits (197), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  AA   +AA+E KT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAAPAAGGEAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +T LGLKEAK+LV+ APK LK G++KDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLTGLGLKEAKDLVDGAPKELKAGVAKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|332040078|gb|EGI76463.1| 50S ribosomal protein L7/L12 [Hylemonella gracilis ATCC 19624]
          Length = 125

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 82/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +  A       +AA EKT+F VVL
Sbjct: 4   DKDAFLTALDSMTVMELNDLVKAIEEKFGVSAAAMAAPAAGGGGGGAAAAEEKTDFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    K++VIK VR IT LGLKEAK+LV+ APK++K  L K +A   KKKLE+AGA 
Sbjct: 64  T--DAGANKVSVIKAVREITGLGLKEAKDLVDGAPKTVKEALPKADAEAAKKKLEEAGAK 121

Query: 123 VELR 126
            EL+
Sbjct: 122 AELK 125


>gi|297564029|ref|YP_003683002.1| ribosomal protein L7/L12 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|296848478|gb|ADH70496.1| ribosomal protein L7/L12 [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 129

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 52/129 (40%), Positives = 78/129 (60%), Gaps = 3/129 (2%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E ++     +TL+E A+  K  E ++ V+A+AP +V      + G AA+E  E 
Sbjct: 1   MAKLSNEDLLAAFEEMTLLELADFVKLFEDKFDVTAAAPAAVAVAAPGQGGGAAAEAEEK 60

Query: 59  E-VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           +   +       KKI VIKEVR +T LGLKEAK+LV++APK L  G++K+ A + K  LE
Sbjct: 61  DEFDVILEGAGDKKIQVIKEVRGLTSLGLKEAKDLVDNAPKPLLEGVNKETAEKAKAALE 120

Query: 118 DAGATVELR 126
            AGA+V L+
Sbjct: 121 GAGASVTLK 129


>gi|255019481|ref|ZP_05291577.1| LSU ribosomal protein L7/L12 (L23e) [Acidithiobacillus caldus ATCC
           51756]
 gi|254971076|gb|EET28542.1| LSU ribosomal protein L7/L12 (L23e) [Acidithiobacillus caldus ATCC
           51756]
          Length = 129

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 54/125 (43%), Positives = 82/125 (65%), Gaps = 6/125 (4%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE----KTEFEVV 61
            I++ ++ +T++E +EL K +E+++GVSA+A      P AA  G  A+     +TEF+V+
Sbjct: 7   EILDAIAGMTVLELSELIKDMEEKFGVSAAAVAVAAGPAAAGGGGEAAAAAEEQTEFDVI 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L        K+  IK VRAIT+LGLKEAK+LV+ APK +K G+SK EA  +K +L +AGA
Sbjct: 67  LTS--AGANKVNTIKVVRAITNLGLKEAKDLVDGAPKPVKEGISKAEAESIKAQLVEAGA 124

Query: 122 TVELR 126
             E++
Sbjct: 125 QAEIK 129


>gi|225024704|ref|ZP_03713896.1| hypothetical protein EIKCOROL_01590 [Eikenella corrodens ATCC
           23834]
 gi|224942530|gb|EEG23739.1| hypothetical protein EIKCOROL_01590 [Eikenella corrodens ATCC
           23834]
          Length = 123

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 74/122 (60%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +  LT++E  +L K  E ++        + VA  A    +    + + EV +  
Sbjct: 6   EDILEAIGGLTVMELNDLVKEFETKF----GVSAAAVAIAAGPGAAGGEAEAKSEVDVIL 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +K+ VIK VRAIT LGLKEAK++V+ APK++K G++  EA E+KK+LE+AGA VE
Sbjct: 62  AAAGDQKVGVIKVVRAITGLGLKEAKDMVDGAPKTIKEGVTPAEAEEIKKQLEEAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|163853414|ref|YP_001641457.1| 50S ribosomal protein L7/L12 [Methylobacterium extorquens PA1]
 gi|218532273|ref|YP_002423089.1| 50S ribosomal protein L7/L12 [Methylobacterium chloromethanicum
           CM4]
 gi|240140834|ref|YP_002965314.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           AM1]
 gi|254563343|ref|YP_003070438.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           DM4]
 gi|226733706|sp|A9W8N7|RL7_METEP RecName: Full=50S ribosomal protein L7/L12
 gi|254806382|sp|B7KN44|RL7_METC4 RecName: Full=50S ribosomal protein L7/L12
 gi|163665019|gb|ABY32386.1| ribosomal protein L7/L12 [Methylobacterium extorquens PA1]
 gi|218524576|gb|ACK85161.1| ribosomal protein L7/L12 [Methylobacterium chloromethanicum CM4]
 gi|240010811|gb|ACS42037.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           AM1]
 gi|254270621|emb|CAX26624.1| 50S ribosomal subunit protein L7/L12 [Methylobacterium extorquens
           DM4]
          Length = 125

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 79/127 (62%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++  IVE LSSLT++EAAEL+K LE++WGVSA+A V+V A  AA AG+AA  E+TEF 
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELAKLLEEKWGVSAAAAVAVAAGPAAGAGAAAVEEQTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAK+LVE APK +K G +KDEA ++K +LE A
Sbjct: 61  VVLAS--AGDKKIEVIKEVRAITGLGLKEAKDLVEGAPKPVKEGATKDEAEKLKAQLEKA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|304384448|ref|ZP_07366852.1| ribosomal protein L7/L12 [Prevotella marshii DSM 16973]
 gi|304334468|gb|EFM00757.1| ribosomal protein L7/L12 [Prevotella marshii DSM 16973]
          Length = 126

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 50/126 (39%), Positives = 79/126 (62%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++I E+L +LT+ E  EL+  L+ E+G+  +A    VA     AG+A   + +   
Sbjct: 1   MADVKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPVAAGAAGGAEEKTSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   +    K+ V+K V+    LGLKEAK+LV+ AP +LK G+SKDEA  +KK +E+AG
Sbjct: 61  DVVLTEAGAAKLQVVKAVKEACGLGLKEAKDLVDGAPSTLKEGMSKDEAENLKKVIEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|226226260|ref|YP_002760366.1| 50S ribosomal protein L7/L12 [Gemmatimonas aurantiaca T-27]
 gi|226089451|dbj|BAH37896.1| 50S ribosomal protein L7/L12 [Gemmatimonas aurantiaca T-27]
          Length = 127

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ + ++++IE +EL +  + ++ V+  A V+     AA   +AA E+TEF V+LK 
Sbjct: 9   DEILDAIGAMSVIELSELIEAFKTKFNVT-IAAVAAGGGGAAAPAAAAEEQTEFTVILK- 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   KKI VIK VR +T LGLKEAK+LV+ APK+LK  +SKDEA ++K KLE  GA VE
Sbjct: 67  -EAGAKKIQVIKVVRELTGLGLKEAKDLVDGAPKALKENVSKDEAAQIKAKLEAEGAGVE 125

Query: 125 LR 126
           ++
Sbjct: 126 IK 127


>gi|315639701|ref|ZP_07894840.1| ribosomal protein L7/L12 [Enterococcus italicus DSM 15952]
 gi|315484478|gb|EFU74935.1| ribosomal protein L7/L12 [Enterococcus italicus DSM 15952]
          Length = 121

 Score = 80.0 bits (196), Expect = 9e-14,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+IVE+L   T++E  +L K +E+E+GVSA+        VAA   +AA E+TEF V L
Sbjct: 4   NIENIVEELKGATILELNDLVKAIEEEFGVSAA----APVAVAAAGAAAAEEQTEFTVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +K+ VIK VR  T LGLKEAK +V+ AP  +K G+SK+EA  +K  LE+ GA+
Sbjct: 60  TA--AGDQKVKVIKAVREATGLGLKEAKAVVDGAPAPVKEGISKEEAEALKATLEEVGAS 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|24371821|ref|NP_715863.1| 50S ribosomal protein L7/L12 [Shewanella oneidensis MR-1]
 gi|120596981|ref|YP_961555.1| 50S ribosomal protein L7/L12 [Shewanella sp. W3-18-1]
 gi|146294849|ref|YP_001185273.1| 50S ribosomal protein L7/L12 [Shewanella putrefaciens CN-32]
 gi|81589445|sp|Q8EK75|RL7_SHEON RecName: Full=50S ribosomal protein L7/L12
 gi|166222210|sp|A4YBZ1|RL7_SHEPC RecName: Full=50S ribosomal protein L7/L12
 gi|166222212|sp|A1REA6|RL7_SHESW RecName: Full=50S ribosomal protein L7/L12
 gi|24345626|gb|AAN53308.1|AE015471_13 ribosomal protein L7/L12 [Shewanella oneidensis MR-1]
 gi|120557074|gb|ABM23001.1| LSU ribosomal protein L12P [Shewanella sp. W3-18-1]
 gi|145566539|gb|ABP77474.1| LSU ribosomal protein L12P / LSU ribosomal protein L12P [Shewanella
           putrefaciens CN-32]
 gi|319424572|gb|ADV52646.1| ribosomal protein L7/L12 [Shewanella putrefaciens 200]
          Length = 122

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E  ++++++E  EL + +E+++GVSA+   + V     EA +A  E+TEF V+L  
Sbjct: 6   DQILEAFAAMSVMEVVELIEAMEEKFGVSAA---AAVVSGGGEAAAAVEEQTEFNVILTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK +R  T LGLKEAK + E+AP ++K G+SK+EA  +KK+L +AGA+VE
Sbjct: 63  H--GDNKVAVIKAIRGATGLGLKEAKAMSEAAPVAVKEGVSKEEAEALKKELVEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|117924147|ref|YP_864764.1| 50S ribosomal protein L12P [Magnetococcus sp. MC-1]
 gi|166222180|sp|A0L5W5|RL7_MAGSM RecName: Full=50S ribosomal protein L7/L12
 gi|117607903|gb|ABK43358.1| LSU ribosomal protein L12P [Magnetococcus sp. MC-1]
          Length = 123

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++  + S+T++E +EL K LE+++GVSA+APV+V A V          KTEF+V+L  
Sbjct: 4   EEMISAIESMTVLELSELVKALEEKFGVSAAAPVAVAAAVGGGEAVVEEAKTEFDVILAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR +T LGLKEAK+LVE APK++K  +SKDEA+++K KLE+AGA VE
Sbjct: 64  --AGDKKIHVIKAVREMTGLGLKEAKDLVEGAPKAVKEAVSKDEADKLKAKLEEAGAVVE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|303327282|ref|ZP_07357724.1| ribosomal protein L7/L12 [Desulfovibrio sp. 3_1_syn3]
 gi|302863270|gb|EFL86202.1| ribosomal protein L7/L12 [Desulfovibrio sp. 3_1_syn3]
          Length = 128

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 64/125 (51%), Positives = 88/125 (70%), Gaps = 5/125 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFEVV 61
           E +VE +SS+T++E +E  K LE+++GVSA+AP + +   A  AG       EKTEF+V+
Sbjct: 6   EEVVEFISSMTVLELSEFIKELEEKFGVSAAAPAAAMVMAAPAAGGDGAAVEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           LK       KI VIK VRA+T+LGLKEAKE V+ AP +LK  +SK+EA E KK+L +AGA
Sbjct: 66  LKET--GANKIGVIKVVRALTNLGLKEAKEKVDGAPSTLKEAVSKEEAEEAKKQLTEAGA 123

Query: 122 TVELR 126
           TVE++
Sbjct: 124 TVEIK 128


>gi|149925885|ref|ZP_01914148.1| Ribosomal protein L7/L12 [Limnobacter sp. MED105]
 gi|149825173|gb|EDM84384.1| Ribosomal protein L7/L12 [Limnobacter sp. MED105]
          Length = 125

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 94/127 (74%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+    I++ ++ +T++E +EL K +E+++GVSA+A    VA  AA  G+AA  EKTEF+
Sbjct: 1   MATKAEILDAIAGMTVLELSELIKEMEEKFGVSAAAAAVAVAAPAAGGGAAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L      + K+ VIK VRA+T LGLKEAK+LV+ APK++K G+SK EA+++KK+LE+A
Sbjct: 61  VILTA--AGESKVNVIKVVRALTGLGLKEAKDLVDGAPKAVKEGVSKAEADDVKKQLEEA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|156972586|ref|YP_001443493.1| 50S ribosomal protein L7/L12 [Vibrio harveyi ATCC BAA-1116]
 gi|166222226|sp|A7MXF2|RL7_VIBHB RecName: Full=50S ribosomal protein L7/L12
 gi|156524180|gb|ABU69266.1| hypothetical protein VIBHAR_00226 [Vibrio harveyi ATCC BAA-1116]
          Length = 122

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 83/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GV+A+A V       A  G AA+E+TEF+V+L+ 
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVTAAAAVVAG---GAAGGEAAAEQTEFDVILES 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ K EA+ +K +LE+AGATV 
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVDKAEADALKAQLEEAGATVA 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|118594008|ref|ZP_01551355.1| probable 50s ribosomal subunit protein l7/l12 (acetylation
           methylation)(l8) [Methylophilales bacterium HTCC2181]
 gi|118439786|gb|EAV46413.1| probable 50s ribosomal subunit protein l7/l12 (acetylation
           methylation)(l8) [Methylophilales bacterium HTCC2181]
          Length = 125

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 83/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+++++ +EL K +E+++GVSA+A  +  A  AA   +AA EKTEF+  L  
Sbjct: 6   EDILEAIGSMSVLDLSELIKEMEEKFGVSAAAAAAAPAAAAAGGAAAAEEKTEFD--LHL 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               + K+ VIK VR IT LGLKEAK++V++APK +K  L K  A+E  KKL +AGAT E
Sbjct: 64  SGIGENKVNVIKAVREITGLGLKEAKDIVDAAPKVVKEALDKASADEALKKLTEAGATAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|281358736|ref|ZP_06245212.1| ribosomal protein L7/L12 [Victivallis vadensis ATCC BAA-548]
 gi|281314763|gb|EFA98800.1| ribosomal protein L7/L12 [Victivallis vadensis ATCC BAA-548]
          Length = 129

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 69/125 (55%), Positives = 92/125 (73%), Gaps = 2/125 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
            +E  V  + +LT++E ++L K LE+  GVSA+APV+V A  AA A + A  EKTEF+V+
Sbjct: 6   KMEEFVSYVENLTVLELSKLVKTLEERLGVSAAAPVAVAAAPAAGAAAPAAEEKTEFDVI 65

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L GF D  KKI VIKE+R IT LGLKEAK+LVE APK++K G++KDEA ++K  LE AGA
Sbjct: 66  LAGF-DAAKKIGVIKEIRGITGLGLKEAKDLVEGAPKAIKEGIAKDEAEKLKAALEAAGA 124

Query: 122 TVELR 126
            VE++
Sbjct: 125 KVEVK 129


>gi|297159572|gb|ADI09284.1| 50S ribosomal protein L7/L12 [Streptomyces bingchenggensis BCW-1]
          Length = 128

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 44/128 (34%), Positives = 78/128 (60%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + ++ +   +TLIE +E  K  E+++ V+A+AP ++     A   +A +E  + 
Sbjct: 1   MAKLSQDDLLAQFEEMTLIELSEFVKAFEEKFDVTAAAPAAIAVAPGAPGAAAEAEPEKD 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +      +KKI VIK VR +T LGLKEAK+LV+  PK +   ++K++A +  + L+ 
Sbjct: 61  EFDVILTGAGEKKIQVIKVVRELTSLGLKEAKDLVDGTPKPVLEKVNKEQAEKAAESLKG 120

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 121 AGASVEVK 128


>gi|254445976|ref|ZP_05059452.1| ribosomal protein L7/L12 [Verrucomicrobiae bacterium DG1235]
 gi|198260284|gb|EDY84592.1| ribosomal protein L7/L12 [Verrucomicrobiae bacterium DG1235]
          Length = 128

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 88/128 (68%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M++I  E ++E LS  ++++ A L K LE++WGVSA+APV+V A   A   +AA  + + 
Sbjct: 1   MADITKEDVIEWLSGQSVLDIAGLVKDLEEKWGVSAAAPVAVAAAPGAGGDAAAPAEEKT 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +       KKI  IKEVR+IT LGLKEAK+LVE APK +K G++K+EA E+K KLE 
Sbjct: 61  EFDVILVAAGDKKINAIKEVRSITGLGLKEAKDLVEGAPKPVKEGVTKEEAEEIKSKLEA 120

Query: 119 AGATVELR 126
           AGA VE++
Sbjct: 121 AGAKVEVK 128


>gi|328958741|ref|YP_004376127.1| 50S ribosomal protein L7/L12 [Carnobacterium sp. 17-4]
 gi|328675065|gb|AEB31111.1| 50S ribosomal protein L7/L12 [Carnobacterium sp. 17-4]
          Length = 121

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 58/124 (46%), Positives = 81/124 (65%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE IV  L   T++E  +L K +E+E+GV+A+APV+     A    +AA+E+TEF V L
Sbjct: 4   NIEQIVADLKESTILELNDLVKAIEEEFGVTAAAPVA----AAGAGEAAAAEQTEFTVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KI VIK VR  T LGLKEAK LV+ AP ++K  +SK++A  +K+ LE AGA+
Sbjct: 60  TS--AGDSKIKVIKAVREATGLGLKEAKGLVDGAPAAIKENISKEDAEALKEALEAAGAS 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|52694908|gb|AAU85605.1| 50S ribosomal protein L7/L12 [Borrelia garinii]
          Length = 124

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 77/122 (63%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  L     +E  +L   +E+++GV+A+         +  +   + E+TEF+V+L  
Sbjct: 6   EDILTWLEGAKTMEVVDLVTAIEEKFGVAAAIAAVGGGAASTGSTD-SEEQTEFDVILMS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KI VIKEVR+IT LGL EAK LVESAPK++K GLSK +A E+KKKLE  GA VE
Sbjct: 65  F--GDSKINVIKEVRSITGLGLGEAKALVESAPKAIKEGLSKSDAEELKKKLEAVGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|299830539|ref|YP_003734987.1| 50S ribosomal protein L12 [Durinskia baltica]
 gi|297384903|gb|ADI40202.1| 50S ribosomal protein L12 [Durinskia baltica]
          Length = 127

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 58/125 (46%), Positives = 81/125 (64%), Gaps = 2/125 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV-APVAAEAGSAASEKTEFEVV 61
            I  IVE+L +LTL+EA+EL   +E+ +GV ASA  +      AA       EKTEF++ 
Sbjct: 4   KINQIVEELKTLTLLEASELVSAIEETFGVDASAAAAGPIMMAAAAPVEEVEEKTEFDLS 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L       KKIA++K +R+IT LGLKEAKELVESAPK ++  ++KD A + KK++E+AG 
Sbjct: 64  LDEV-PADKKIAILKVIRSITGLGLKEAKELVESAPKVIQEAVAKDAAEDAKKQIEEAGG 122

Query: 122 TVELR 126
              L+
Sbjct: 123 KASLK 127


>gi|56707313|ref|YP_169209.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110669783|ref|YP_666340.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|81598039|sp|Q5NID3|RL7_FRATT RecName: Full=50S ribosomal protein L7/L12
 gi|123169675|sp|Q14JT6|RL7_FRAT1 RecName: Full=50S ribosomal protein L7/L12
 gi|56603805|emb|CAG44776.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320116|emb|CAL08159.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|282158438|gb|ADA77829.1| 50S ribosomal protein L7/L12 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 125

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  +L K +E ++GVSA+A V+V A   A    AA EKTEF+VVL  
Sbjct: 6   EDILNAVAEMSVMDVCDLVKMMEDKFGVSAAAAVAVAAGPVAGPAEAAEEKTEFDVVL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KIA IK VR  T LGLKEAK+ VE  P ++K   SK+EA  +KK+LE+AGA VE
Sbjct: 64  VDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKEEAEVLKKQLEEAGAKVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|163803769|ref|ZP_02197625.1| 50S ribosomal protein L7/L12 [Vibrio sp. AND4]
 gi|159172427|gb|EDP57297.1| 50S ribosomal protein L7/L12 [Vibrio sp. AND4]
          Length = 122

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 81/122 (66%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GV+A+A V       A  G AA+E+TEF VVL  
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVTAAAAVVAGG---AAGGEAAAEQTEFNVVLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ K EA  +K +LE+AGA+VE
Sbjct: 63  V--GGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVEKAEAEALKAQLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|85057742|ref|YP_456658.1| 50S ribosomal protein L7/L12 [Aster yellows witches'-broom
           phytoplasma AYWB]
 gi|84789847|gb|ABC65579.1| LSU ribosomal protein L12P [Aster yellows witches'-broom
           phytoplasma AYWB]
          Length = 136

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 76/128 (59%), Gaps = 5/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E+ V  L  ++L+E  EL   L++++G+  +A    VA   A   +   EKTEF
Sbjct: 12  MAKLTKEAFVSALKEMSLLEIKELLDGLKEDFGIDPTAL--AVAAPGANNAAEVEEKTEF 69

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            VV+K F D KKK+AVIK VR +T LGL +A   V+     +K  +SK  A ++K KLE 
Sbjct: 70  TVVMKSF-DEKKKLAVIKTVREVTGLGLLDAANFVKVPGSKVKENVSKVLAEDIKNKLEQ 128

Query: 119 AGATVELR 126
           AGA VEL+
Sbjct: 129 AGAVVELQ 136


>gi|198282629|ref|YP_002218950.1| 50S ribosomal protein L7/L12 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218666954|ref|YP_002424821.1| ribosomal protein L7/L12 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226733628|sp|B7J458|RL7_ACIF2 RecName: Full=50S ribosomal protein L7/L12
 gi|226733629|sp|B5ELX1|RL7_ACIF5 RecName: Full=50S ribosomal protein L7/L12
 gi|198247150|gb|ACH82743.1| ribosomal protein L7/L12 [Acidithiobacillus ferrooxidans ATCC
           53993]
 gi|218519167|gb|ACK79753.1| ribosomal protein L7/L12 [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 128

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 52/124 (41%), Positives = 80/124 (64%), Gaps = 5/124 (4%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---KTEFEVVL 62
            I++ ++ +T++E +EL K +E+++GVSA+A         A AG  A+    +TEF+V+L
Sbjct: 7   EILDAIAGMTVLELSELIKEMEEKFGVSAAAVAVAAPAGGAAAGEGAAAVEEQTEFDVIL 66

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+  IK VRAIT LGLKEAK+LV+ APK +K G++K EA  +K +L +AGA 
Sbjct: 67  TA--AGANKVNTIKVVRAITGLGLKEAKDLVDGAPKPVKEGVAKAEAESVKAQLVEAGAE 124

Query: 123 VELR 126
            E++
Sbjct: 125 AEIK 128


>gi|303237467|ref|ZP_07324032.1| ribosomal protein L7/L12 [Prevotella disiens FB035-09AN]
 gi|302482287|gb|EFL45317.1| ribosomal protein L7/L12 [Prevotella disiens FB035-09AN]
          Length = 126

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/126 (38%), Positives = 79/126 (62%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA   +A + + + E 
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAGPAAGGAAAGAAEEKSEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    K+ V+K V+    LGLK+AK+LV+ AP ++K G++KDEA  +KK +E  G
Sbjct: 61  DVVLVDAGASKLKVVKAVKEACGLGLKDAKDLVDGAPSTIKEGVAKDEAENLKKLIEAEG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|193577753|ref|XP_001942794.1| PREDICTED: 39S ribosomal protein L12, mitochondrial-like isoform 1
           [Acyrthosiphon pisum]
 gi|328720555|ref|XP_003247065.1| PREDICTED: 39S ribosomal protein L12, mitochondrial-like isoform 2
           [Acyrthosiphon pisum]
          Length = 175

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTE 57
            +E +  +++SLT+IE +E ++ L+    +      +VV+  A        E     KT 
Sbjct: 47  KLEKLYTEITSLTMIEVSEFTELLKVRLNLKDIPMGAVVSAPATAGQDDEEEVAATVKTS 106

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V L  FDD K+K+A+IKEV+ +   + L +AK+ VESAP  +K+ + KDEA ++K+  
Sbjct: 107 FTVKLMKFDD-KQKVALIKEVKNLMEGMNLVQAKKFVESAPTVIKSDIGKDEAEKLKEAF 165

Query: 117 EDAGATVEL 125
              GA   +
Sbjct: 166 TKVGAECVI 174


>gi|218246569|ref|YP_002371940.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 8801]
 gi|257059609|ref|YP_003137497.1| 50S ribosomal protein L7/L12 [Cyanothece sp. PCC 8802]
 gi|226733671|sp|B7JWT5|RL7_CYAP8 RecName: Full=50S ribosomal protein L7/L12
 gi|218167047|gb|ACK65784.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 8801]
 gi|256589775|gb|ACV00662.1| ribosomal protein L7/L12 [Cyanothece sp. PCC 8802]
          Length = 132

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 65/131 (49%), Positives = 92/131 (70%), Gaps = 7/131 (5%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------K 55
           +  + I+E+L SLTL+EA+EL K++E+ +GVSA+APV     + A  G+A +       K
Sbjct: 3   AATDQILEQLKSLTLLEASELVKQIEEAFGVSAAAPVGGGMMMMAPGGAAPAAAEPEEEK 62

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+VVL+      KKIA++K VRAIT LGLKEAK+LVESAPK +K   +KD+A  +KK+
Sbjct: 63  TEFDVVLEDV-PADKKIAILKVVRAITGLGLKEAKDLVESAPKPIKEATNKDDAESIKKQ 121

Query: 116 LEDAGATVELR 126
           LE+AGA   ++
Sbjct: 122 LEEAGAKASVK 132


>gi|270292521|ref|ZP_06198732.1| ribosomal protein L7/L12 [Streptococcus sp. M143]
 gi|270278500|gb|EFA24346.1| ribosomal protein L7/L12 [Streptococcus sp. M143]
          Length = 121

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 55/124 (44%), Positives = 79/124 (63%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   +++E  +L K +E+E+GV+A+        VAA  G+  + K  F+V L
Sbjct: 4   NIENIIAEIKEASILELNDLVKAIEEEFGVTAA----APVAVAAAGGAEEAAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KK+ VIK VR IT LGLKEAKELV+ AP  +K G+   EA E+K KLE+AGA+
Sbjct: 60  TA--AGDKKVGVIKVVREITGLGLKEAKELVDGAPGVIKEGVPTAEAEEIKAKLEEAGAS 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|255084820|ref|XP_002504841.1| predicted protein [Micromonas sp. RCC299]
 gi|226520110|gb|ACO66099.1| predicted protein [Micromonas sp. RCC299]
          Length = 128

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 84/127 (66%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFE 59
           +  + I+EK+ +LTL+EA+EL K++E+ +GV ASAP    V+A   A A   A+EKTEF+
Sbjct: 3   ATTDEIIEKMKTLTLLEASELVKQIEETFGVDASAPAGGMVMAAGPAAAAEEAAEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           +V+   D  K +IA+IK VR +T LGLKEAK+ V + P ++  G +K E  E  K+LE  
Sbjct: 63  LVITDVDASK-RIAIIKVVRGLTSLGLKEAKDAVTNLPFTILEGKTKGEVEEAMKELEAG 121

Query: 120 GATVELR 126
           GA  E++
Sbjct: 122 GAKCEMK 128


>gi|73663524|ref|YP_302305.1| 50S ribosomal protein L7/L12 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
 gi|82581599|sp|Q49V50|RL7_STAS1 RecName: Full=50S ribosomal protein L7/L12
 gi|72496039|dbj|BAE19360.1| 50S ribosomal protein L7 L12 [Staphylococcus saprophyticus subsp.
           saprophyticus ATCC 15305]
          Length = 122

 Score = 80.0 bits (196), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 86/126 (68%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G A +EKT+F+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAAGGDAEAEKTDFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  L K+EA ++K+ LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEALEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|256821654|ref|YP_003145617.1| 50S ribosomal protein L7/L12 [Kangiella koreensis DSM 16069]
 gi|256795193|gb|ACV25849.1| ribosomal protein L7/L12 [Kangiella koreensis DSM 16069]
          Length = 125

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 89/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++E  EL + +E+++GVSA+A V+V  P A     AA+E+TEF+VV+K 
Sbjct: 6   DDILNAIAEMSVMEVVELVEAMEEKFGVSAAAAVAVAGPAAGGDAGAAAEQTEFDVVMKS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK +R IT LGLKEAK++VE AP ++K G+ K EA ++KK+LE+AGA VE
Sbjct: 66  F--GGNKVAVIKAIRGITGLGLKEAKDMVEGAPVAVKEGVEKAEAEDIKKQLEEAGAEVE 123

Query: 125 LR 126
           ++
Sbjct: 124 VK 125


>gi|22297842|ref|NP_681089.1| 50S ribosomal protein L7/L12 [Thermosynechococcus elongatus BP-1]
 gi|81743859|sp|Q8DM25|RL7_THEEB RecName: Full=50S ribosomal protein L7/L12
 gi|22294019|dbj|BAC07851.1| 50S ribosomal protein L12 [Thermosynechococcus elongatus BP-1]
          Length = 132

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 67/131 (51%), Positives = 93/131 (70%), Gaps = 7/131 (5%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE------K 55
           +  + I+EKL SLTL+EAAEL K++E+ +GVSA+APV  +   A  AG+AA+       K
Sbjct: 3   AATDEILEKLKSLTLLEAAELVKQIEETFGVSAAAPVGGMMVAAPVAGAAAAPAEEVEEK 62

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           T F+V+L+      KKIAV+K VR++T LGLKEAKE+VES PK +K G SK++A   KK+
Sbjct: 63  TAFDVILEEV-PADKKIAVLKVVRSLTGLGLKEAKEVVESTPKPVKEGASKEDAEAAKKE 121

Query: 116 LEDAGATVELR 126
           LE+AGA V ++
Sbjct: 122 LEEAGAKVSIK 132


>gi|198277435|ref|ZP_03209966.1| hypothetical protein BACPLE_03654 [Bacteroides plebeius DSM 17135]
 gi|325299611|ref|YP_004259528.1| ribosomal protein L7/L12 [Bacteroides salanitronis DSM 18170]
 gi|198269933|gb|EDY94203.1| hypothetical protein BACPLE_03654 [Bacteroides plebeius DSM 17135]
 gi|324319164|gb|ADY37055.1| ribosomal protein L7/L12 [Bacteroides salanitronis DSM 18170]
          Length = 125

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 86/127 (67%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAAGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK+LV+ AP ++K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGAAKLQVVKAVKEACGLGLKEAKDLVDGAPSTVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|194337662|ref|YP_002019456.1| ribosomal protein L7/L12 [Pelodictyon phaeoclathratiforme BU-1]
 gi|226733715|sp|B4SG12|RL7_PELPB RecName: Full=50S ribosomal protein L7/L12
 gi|194310139|gb|ACF44839.1| ribosomal protein L7/L12 [Pelodictyon phaeoclathratiforme BU-1]
          Length = 124

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 63/124 (50%), Positives = 88/124 (70%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVL 62
           IE++VE++  LTL EA+EL K LE+++GVSA+         AA   +    E+TEF+VVL
Sbjct: 3   IETLVEEIGKLTLTEASELVKALEEKFGVSAAPVAVAGVAAAAAGDAPVVEEQTEFDVVL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                 + KI VIK VRAIT LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+DAGA+
Sbjct: 63  TA--AGESKINVIKAVRAITGLGLKEAKDLVDGAPKTVKEAISKDEAEKIAKELKDAGAS 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|171060538|ref|YP_001792887.1| 50S ribosomal protein L7/L12 [Leptothrix cholodnii SP-6]
 gi|226733704|sp|B1Y7H4|RL7_LEPCP RecName: Full=50S ribosomal protein L7/L12
 gi|170777983|gb|ACB36122.1| ribosomal protein L7/L12 [Leptothrix cholodnii SP-6]
          Length = 124

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 54/124 (43%), Positives = 83/124 (66%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +  A  A  A +   EKTEF VVL
Sbjct: 4   DKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPGA-GAGAAAAVVEEKTEFNVVL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D   +K++VIK VR +T LGLKEAK+LV+ APK++K G++K +A    KKL +AGA 
Sbjct: 63  --LDAGAQKVSVIKAVRELTGLGLKEAKDLVDGAPKNVKEGIAKADAEAALKKLLEAGAK 120

Query: 123 VELR 126
            E++
Sbjct: 121 AEIK 124


>gi|323305028|gb|EGA58782.1| Mnp1p [Saccharomyces cerevisiae FostersB]
          Length = 180

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 50/142 (35%), Positives = 67/142 (47%), Gaps = 20/142 (14%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-------------------SAPVSVVAP 43
            I  IV+ +S LTL+E + L   L+    +                         +  A 
Sbjct: 39  KISKIVQDISQLTLLETSSLINELKTVLNIPEISMPMGGFMAGAAGAGAGNVPSSTGEAG 98

Query: 44  VAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTG 103
              E  +    KT F V L  F D K K  VIKEV+ +  L L EAK+ VE+APK LK  
Sbjct: 99  SGXEEEAKPEAKTVFTVKLDSF-DTKTKAKVIKEVKGLLGLSLVEAKKFVEAAPKVLKEN 157

Query: 104 LSKDEANEMKKKLEDAGATVEL 125
           ++KD+A ++KK LED GA V L
Sbjct: 158 VAKDDAEKIKKTLEDLGAKVSL 179


>gi|15230614|ref|NP_187255.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|42572277|ref|NP_974234.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|145331982|ref|NP_001078113.1| ribosomal protein L12 family protein [Arabidopsis thaliana]
 gi|7658342|gb|AAF66132.1| hypothetical protein; 10657-10097 [Arabidopsis thaliana]
 gi|17381070|gb|AAL36347.1| unknown protein [Arabidopsis thaliana]
 gi|20465711|gb|AAM20324.1| unknown protein [Arabidopsis thaliana]
          Length = 186

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 47/125 (37%), Positives = 67/125 (53%), Gaps = 6/125 (4%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA-----AEAGSAASEKT 56
           S I  + E++++L+  E  ++   L +   +     +S     A     A       EKT
Sbjct: 58  SKIMELAERIAALSPEERKQIGPALNEHLRLPKQQMISSDGIGAKQDTGAGNVEEKKEKT 117

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+V L+ F+    KI VIKEVR  T LGLKEAKELVE  P  LK G++K+EANE+  K+
Sbjct: 118 AFDVKLEKFNASD-KIKVIKEVRTFTSLGLKEAKELVEKVPAILKQGVTKEEANEIIAKI 176

Query: 117 EDAGA 121
           +  G 
Sbjct: 177 KAVGG 181


>gi|323358931|ref|YP_004225327.1| ribosomal protein L7/L12 [Microbacterium testaceum StLB037]
 gi|323275302|dbj|BAJ75447.1| ribosomal protein L7/L12 [Microbacterium testaceum StLB037]
          Length = 128

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 75/128 (58%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E +++    LTLIE +E  K  E+ + V+A+APV+V  P A  A  A   + + 
Sbjct: 1   MAKLSTEELLDAFKELTLIELSEFVKAFEETFDVTAAAPVAVAGPAAGGAAPAEEAEEKD 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
              +       KKI VIK VR +T LGL EAK +V+ APK++  G +K+ A + K  LE+
Sbjct: 61  SFDVVLEAAGDKKIQVIKVVRELTSLGLGEAKAVVDGAPKAVLEGANKETAEKAKAALEE 120

Query: 119 AGATVELR 126
           AGA+V L+
Sbjct: 121 AGASVTLK 128


>gi|160934073|ref|ZP_02081460.1| hypothetical protein CLOLEP_02936 [Clostridium leptum DSM 753]
 gi|156866746|gb|EDO60118.1| hypothetical protein CLOLEP_02936 [Clostridium leptum DSM 753]
          Length = 132

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 84/124 (67%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            +  ++E + SLT++E +EL K LE+E+GVSA+APV+V A  AA   + A+ + + E  +
Sbjct: 9   KVVKLIEDVKSLTVLELSELVKALEEEFGVSAAAPVAVAAAPAAGGAAPAAAEEKTEFDV 68

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   KIAVIK VR  T LGLKEAK LV+ APK++K G+SKD+A  +K KL +AGA 
Sbjct: 69  VLKAAGANKIAVIKVVREATGLGLKEAKALVDGAPKNVKEGVSKDDAEALKAKLTEAGAE 128

Query: 123 VELR 126
           VE++
Sbjct: 129 VEVK 132


>gi|15807037|ref|NP_295766.1| 50S ribosomal protein L7/L12 [Deinococcus radiodurans R1]
 gi|14195182|sp|Q9RST0|RL7_DEIRA RecName: Full=50S ribosomal protein L7/L12
 gi|190613548|pdb|2ZJQ|5 Chain 5, Interaction Of L7 With L11 Induced By Microccocin Binding
           To The Deinococcus Radiodurans 50s Subunit
 gi|6459831|gb|AAF11590.1|AE002040_7 ribosomal protein L7/L12 [Deinococcus radiodurans R1]
          Length = 122

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 60/124 (48%), Positives = 83/124 (66%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++++++L  LT++E A+L   L++ WGV+A+  VS     A  A  AA EKTEF+VVL
Sbjct: 4   DKQALIDQLGQLTIMELADLIDGLKETWGVTAAVAVSGG--GAGAASPAAEEKTEFDVVL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    KI VIKE+R IT LGLKEAK++ E     LK G++KDEA +MK +LE AGA 
Sbjct: 62  --IDAGASKINVIKEIRGITGLGLKEAKDMSEKGG-VLKEGVAKDEAEKMKAQLEAAGAR 118

Query: 123 VELR 126
           VEL+
Sbjct: 119 VELK 122


>gi|160888407|ref|ZP_02069410.1| hypothetical protein BACUNI_00820 [Bacteroides uniformis ATCC 8492]
 gi|167764380|ref|ZP_02436505.1| hypothetical protein BACSTE_02764 [Bacteroides stercoris ATCC
           43183]
 gi|218131346|ref|ZP_03460150.1| hypothetical protein BACEGG_02957 [Bacteroides eggerthii DSM 20697]
 gi|270294760|ref|ZP_06200961.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D20]
 gi|317476373|ref|ZP_07935622.1| ribosomal protein L7/L12 [Bacteroides eggerthii 1_2_48FAA]
 gi|317477759|ref|ZP_07936952.1| ribosomal protein L7/L12 [Bacteroides sp. 4_1_36]
 gi|329962258|ref|ZP_08300264.1| ribosomal protein L7/L12 [Bacteroides fluxus YIT 12057]
 gi|156862084|gb|EDO55515.1| hypothetical protein BACUNI_00820 [Bacteroides uniformis ATCC 8492]
 gi|167697785|gb|EDS14364.1| hypothetical protein BACSTE_02764 [Bacteroides stercoris ATCC
           43183]
 gi|217986278|gb|EEC52615.1| hypothetical protein BACEGG_02957 [Bacteroides eggerthii DSM 20697]
 gi|270274007|gb|EFA19868.1| 50S ribosomal protein L7/L12 [Bacteroides sp. D20]
 gi|316906104|gb|EFV27865.1| ribosomal protein L7/L12 [Bacteroides sp. 4_1_36]
 gi|316907399|gb|EFV29104.1| ribosomal protein L7/L12 [Bacteroides eggerthii 1_2_48FAA]
 gi|328530366|gb|EGF57243.1| ribosomal protein L7/L12 [Bacteroides fluxus YIT 12057]
          Length = 125

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 84/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G+AA  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGSAKLQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|83648860|ref|YP_437295.1| 50S ribosomal protein L7/L12 [Hahella chejuensis KCTC 2396]
 gi|109893766|sp|Q2S904|RL7_HAHCH RecName: Full=50S ribosomal protein L7/L12
 gi|83636903|gb|ABC32870.1| ribosomal protein L7/L12 [Hahella chejuensis KCTC 2396]
          Length = 124

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ +++++   L + +E+++GVSA+A V+V A   A   +A  EKTEF+VVL+ 
Sbjct: 6   DDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAVAA-APAADAAAVEEKTEFDVVLQS 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VR IT LGLKEAK+LV+ AP ++K  LSKD+A + KK+LE+AGATVE
Sbjct: 65  --AGEKKVNVIKVVRGITGLGLKEAKDLVDGAPSTVKEALSKDDAEKAKKELEEAGATVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|209548926|ref|YP_002280843.1| 50S ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|226733727|sp|B5ZYS6|RL7_RHILW RecName: Full=50S ribosomal protein L7/L12
 gi|209534682|gb|ACI54617.1| ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 125

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 72/127 (56%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A       +    EKTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAGGAGPAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVRAIT LGLKEAK+LVE APK++K G++K EA ++KKKLEDA
Sbjct: 61  VIL--VEAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEGVNKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|149185493|ref|ZP_01863809.1| ribosomal protein L7/L12 [Erythrobacter sp. SD-21]
 gi|148830713|gb|EDL49148.1| ribosomal protein L7/L12 [Erythrobacter sp. SD-21]
          Length = 125

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 78/127 (61%), Positives = 97/127 (76%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I  +VE+LS LT++EAAEL+K LE+EWGVSA+A V+V  P    AG AA+E K EF+
Sbjct: 1   MADIAKLVEELSKLTVMEAAELAKALEEEWGVSAAAAVAVAGPAGGGAGEAAAEEKDEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL G  D  KKI VIKEVRAIT LGL EAK LVE APK++K G++K EA E+K K+E A
Sbjct: 61  VVLTG--DGGKKIQVIKEVRAITGLGLTEAKALVEGAPKAIKEGVNKAEAEEIKGKIEAA 118

Query: 120 GATVELR 126
           G TVEL+
Sbjct: 119 GGTVELK 125


>gi|300772102|ref|ZP_07081972.1| ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC 33861]
 gi|300760405|gb|EFK57231.1| ribosomal protein L7/L12 [Sphingobacterium spiritivorum ATCC 33861]
          Length = 125

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 91/127 (71%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++++ + E+L +LT+ E  EL+  L+ E+G+  +A    VA   AE G+AA+E KT F+
Sbjct: 1   MADLKQLAEQLVNLTVKEVKELADILKDEYGIEPAAAAVAVAAAPAEGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +  LGLKEAK+LV+ APK LK G+SKDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLAGLGLKEAKDLVDGAPKELKAGVSKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|294674791|ref|YP_003575407.1| 50S ribosomal protein L7/L12 [Prevotella ruminicola 23]
 gi|294471910|gb|ADE81299.1| ribosomal protein L7/L12 [Prevotella ruminicola 23]
          Length = 126

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 51/126 (40%), Positives = 79/126 (62%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A AG+A + + +   
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAAGAADAAEEKTSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        K+ V+K V+    LGLKEAK+LV+ AP ++K GLSK+EA  +KK +E AG
Sbjct: 61  DVVLKSAGAAKLQVVKAVKEACGLGLKEAKDLVDGAPATVKEGLSKEEAENLKKTIEAAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|169351742|ref|ZP_02868680.1| hypothetical protein CLOSPI_02523 [Clostridium spiroforme DSM 1552]
 gi|169291964|gb|EDS74097.1| hypothetical protein CLOSPI_02523 [Clostridium spiroforme DSM 1552]
          Length = 123

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 50/128 (39%), Positives = 74/128 (57%), Gaps = 7/128 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E I+  L   T++E  +L K +E+++ V+A+APV+V A  A EA    +     
Sbjct: 1   MAKLTHEDILAYLEEATILELNDLVKAIEEKFDVTAAAPVAVAAAGAEEAAGEPA----- 55

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V +        K+AVIK VR IT LGL +AK LV+  P  +K  +   E  E+K+KLE 
Sbjct: 56  NVTVTLTAPGGTKVAVIKVVREITGLGLVDAKGLVDKVPSVIKENIPAAEGAEIKEKLEA 115

Query: 119 AGATVELR 126
           AGATVE++
Sbjct: 116 AGATVEVK 123


>gi|199599017|ref|ZP_03212424.1| Ribosomal protein L7/L12 [Lactobacillus rhamnosus HN001]
 gi|258509271|ref|YP_003172022.1| 50S ribosomal protein L7/L12 [Lactobacillus rhamnosus GG]
 gi|199590053|gb|EDY98152.1| Ribosomal protein L7/L12 [Lactobacillus rhamnosus HN001]
 gi|257149198|emb|CAR88171.1| LSU/50S ribosomal protein L7/L12P [Lactobacillus rhamnosus GG]
 gi|259650552|dbj|BAI42714.1| 50S ribosomal protein L7/L12 [Lactobacillus rhamnosus GG]
          Length = 122

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/124 (39%), Positives = 81/124 (65%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +++ I+ +L   +++E  +L K +E E+GV A+APV      A  A    +  T+    +
Sbjct: 4   DVDGIIAQLKDASILELNDLVKSIEDEFGVKAAAPV-----AAGGAAGGDAAATKDTYDV 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  +  ++K+ VIK VR IT  GLK+AK LV++APK +K GLS+D+AN++K++LE+ GAT
Sbjct: 59  ELTEAGQEKVKVIKAVREITGQGLKDAKGLVDAAPKVIKEGLSEDDANKIKEQLEEVGAT 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|229552931|ref|ZP_04441656.1| ribosomal protein L7/L12 [Lactobacillus rhamnosus LMS2-1]
 gi|258540458|ref|YP_003174957.1| 50S ribosomal protein L7/L12 [Lactobacillus rhamnosus Lc 705]
 gi|229313707|gb|EEN79680.1| ribosomal protein L7/L12 [Lactobacillus rhamnosus LMS2-1]
 gi|257152134|emb|CAR91106.1| LSU/50S ribosomal protein L7/L12P [Lactobacillus rhamnosus Lc 705]
 gi|328478568|gb|EGF48245.1| 50S ribosomal protein L7/L12 [Lactobacillus rhamnosus MTCC 5462]
          Length = 122

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 49/124 (39%), Positives = 81/124 (65%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +++ I+ +L   +++E  +L K +E E+GV A+APV      A  A    +  T+    +
Sbjct: 4   DVDGIIAQLKDASILELNDLVKSIEDEFGVKAAAPV-----AAGAAAGGDAAATKDSYDV 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  +  ++K+ VIK VR IT  GLK+AK LV++APK +K GLS+D+AN++K++LE+ GAT
Sbjct: 59  ELTEAGQEKVKVIKAVREITGQGLKDAKGLVDAAPKVIKEGLSEDDANKIKEQLEEVGAT 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|186685899|ref|YP_001869095.1| 50S ribosomal protein L7/L12 [Nostoc punctiforme PCC 73102]
 gi|226733713|sp|B2JA77|RL7_NOSP7 RecName: Full=50S ribosomal protein L7/L12
 gi|186468351|gb|ACC84152.1| ribosomal protein L7/L12 [Nostoc punctiforme PCC 73102]
          Length = 130

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 94/129 (72%), Gaps = 5/129 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKTE 57
           +  + I+E+L +L+L+EA+EL K++E+ +GVSA+APV  +  +A   G+A +    E+TE
Sbjct: 3   AATDQILEQLKTLSLLEASELVKQIEEAFGVSAAAPVGGMMMMAGPGGAAPAEEAVEQTE 62

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           FEV+L       KKIAV+K VR +T LGLKEAK+LVE+APK++K G++KD A + KK++E
Sbjct: 63  FEVILDSV-PADKKIAVLKIVRELTGLGLKEAKDLVEAAPKAVKEGIAKDAAEDAKKRIE 121

Query: 118 DAGATVELR 126
           +AG  V ++
Sbjct: 122 EAGGKVTIK 130


>gi|4469298|emb|CAB38448.1| 50S ribosomal protein L12 [Prototheca wickerhamii]
          Length = 134

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 75/128 (58%), Gaps = 5/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPV----AAEAGSAASEKTE 57
           +    I+EKL ++TL+EA EL  ++EK +GV ASAP             +      EKT 
Sbjct: 7   ATTLEILEKLKAITLLEATELVSQIEKTFGVDASAPAVSGLRPILVEPIKQEDIIEEKTT 66

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L+      K++ ++K +RA+T L LK+AKE +   PK++  G+SK+E+   K++LE
Sbjct: 67  FDVILEEV-PSDKRVPILKVIRALTSLDLKQAKESITDLPKTILQGVSKEESEAAKQQLE 125

Query: 118 DAGATVEL 125
             G  +++
Sbjct: 126 AVGGKIKV 133


>gi|56418631|ref|YP_145949.1| 50S ribosomal protein L7/L12 [Geobacillus kaustophilus HTA426]
 gi|81558138|sp|Q5L407|RL7_GEOKA RecName: Full=50S ribosomal protein L7/L12
 gi|56378473|dbj|BAD74381.1| 50S ribosomal protein L7/L12 (BL13) [Geobacillus kaustophilus
           HTA426]
          Length = 123

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 65/126 (51%), Positives = 91/126 (72%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M   E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA A +AA  KTEF+V
Sbjct: 1   MMTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGAEAAAE-KTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIK VR IT LGLKEAK+LV++ PK +K G++K+EA E+K KLE+AG
Sbjct: 60  IL--ADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEEAEEIKAKLEEAG 117

Query: 121 ATVELR 126
           A VE++
Sbjct: 118 AKVEIK 123


>gi|223560|prf||0812296A protein,chloroplast ribosomal
          Length = 130

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 78/122 (63%), Gaps = 2/122 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
            IE +  +LS LTL EA  L   L+ + GVSA++     A  A  A + A  EKTEF+V 
Sbjct: 7   KIEQLGTQLSGLTLEEARVLVDWLQDKLGVSAASFAPAAAVAAPGAPADAVEEKTEFDVS 66

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           +        +I+VIK VRA+T LGLKEAKEL+E  PK LK G+SKD+A + KK+LEDAGA
Sbjct: 67  IDEVPSNA-RISVIKAVRALTSLGLKEAKELIEGLPKKLKEGVSKDDAEDAKKQLEDAGA 125

Query: 122 TV 123
            V
Sbjct: 126 KV 127


>gi|262273340|ref|ZP_06051155.1| LSU ribosomal protein L7/L12 (L23e) [Grimontia hollisae CIP 101886]
 gi|262222713|gb|EEY74023.1| LSU ribosomal protein L7/L12 (L23e) [Grimontia hollisae CIP 101886]
          Length = 122

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 85/122 (69%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GV+A+A V       A AG AA E+TEF+V+L  
Sbjct: 6   EQILDAIAEMSVMQVVELIEAMEEKFGVTAAAAVVAG---GAVAGEAAEEQTEFDVILTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK +V+ AP  LK G+SK+EA  +KK+LE+AGA+VE
Sbjct: 63  --AGANKVAVIKAVRGATGLGLKEAKAVVDGAPAPLKEGVSKEEAEALKKELEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|259415959|ref|ZP_05739879.1| ribosomal protein L7/L12 [Silicibacter sp. TrichCH4B]
 gi|259347398|gb|EEW59175.1| ribosomal protein L7/L12 [Silicibacter sp. TrichCH4B]
          Length = 124

 Score = 79.6 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 62/126 (49%), Positives = 84/126 (66%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA-PVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+  +A  +V+    A    +A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGEAAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+ K EA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVDKAEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|298246514|ref|ZP_06970320.1| ribosomal protein L7/L12 [Ktedonobacter racemifer DSM 44963]
 gi|297553995|gb|EFH87860.1| ribosomal protein L7/L12 [Ktedonobacter racemifer DSM 44963]
          Length = 125

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 50/123 (40%), Positives = 73/123 (59%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           +E+I+  +  L ++E  ELSK L+ +WGVSA+     VA   AEA +A   + + E    
Sbjct: 3   VETIIADIEKLNVLELVELSKTLQDKWGVSAAPAAVAVAAAPAEAAAAPVVEEKTEFDAV 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    KI VIK VR +T LGLKEAK +V+ APK +K  +SK+EA  +  KL + GA V
Sbjct: 63  LTEVGANKINVIKVVRELTGLGLKEAKAVVDEAPKPVKEAVSKEEAERIAAKLTEVGAKV 122

Query: 124 ELR 126
            ++
Sbjct: 123 TIK 125


>gi|282889741|ref|ZP_06298280.1| 50S ribosomal protein L7/L12 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281500315|gb|EFB42595.1| 50S ribosomal protein L7/L12 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 128

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 84/124 (67%), Gaps = 1/124 (0%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
             E +VE+LS LT++E AEL   LE++WGV A+A  +V+A   A A  AA+E T+F++ L
Sbjct: 4   KKEELVEQLSQLTVLEMAELKTALEEKWGVKAAAAAAVMAVAPAAAAPAAAESTDFQITL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +   D  KKI+ IK VR IT LGLKEAKELVES PK +K    K EA E+KKK+E AG  
Sbjct: 64  EKVTD-DKKISAIKVVREITGLGLKEAKELVESTPKVIKETAPKAEAEEIKKKVEAAGCK 122

Query: 123 VELR 126
           V L+
Sbjct: 123 VTLK 126


>gi|254585621|ref|XP_002498378.1| ZYRO0G08822p [Zygosaccharomyces rouxii]
 gi|238941272|emb|CAR29445.1| ZYRO0G08822p [Zygosaccharomyces rouxii]
          Length = 183

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/135 (32%), Positives = 67/135 (49%), Gaps = 13/135 (9%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA------------SAPVSVVAPVAAEAGS 50
            I +IV ++S LTL+E + L   L+ +  +              +   +  A        
Sbjct: 49  KISNIVNEISKLTLLETSVLINELKTQLNIPDIALPAAGAVAAPAGGAASGAAEEEAQEE 108

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
              EKT F + L+ F D K K  +IKE++ +  L L EAK+  E+APK LK  ++KD+A 
Sbjct: 109 KPEEKTIFALKLESF-DAKAKPKIIKEIKTMLGLSLVEAKKFAEAAPKVLKDNVAKDDAE 167

Query: 111 EMKKKLEDAGATVEL 125
           ++K  LE  GA V L
Sbjct: 168 KIKSSLEALGAKVSL 182


>gi|134096329|ref|YP_001101404.1| 50S ribosomal protein L7/L12 [Herminiimonas arsenicoxydans]
 gi|166222175|sp|A4G9U6|RL7_HERAR RecName: Full=50S ribosomal protein L7/L12
 gi|133740232|emb|CAL63283.1| 50S ribosomal subunit protein L7/L12 [Herminiimonas arsenicoxydans]
          Length = 124

 Score = 79.6 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + +LT++E  +L K  E+++GVSA+A  +  A   A  G+AA E+TEF V+L  
Sbjct: 6   DDILEAVGNLTVLELNDLVKAFEEKFGVSAAAMAAPAA-GGAAGGAAAEEQTEFTVILAD 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK VR IT LGLKEAK+LV++APK LK G+SK +A   KKKLE+AGA  E
Sbjct: 65  F--GANKVGVIKAVREITGLGLKEAKDLVDAAPKPLKEGVSKADAEAAKKKLEEAGAKAE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|306823601|ref|ZP_07456976.1| ribosomal protein L7/L12 [Bifidobacterium dentium ATCC 27679]
 gi|309802855|ref|ZP_07696956.1| ribosomal protein L7/L12 [Bifidobacterium dentium JCVIHMP022]
 gi|304553308|gb|EFM41220.1| ribosomal protein L7/L12 [Bifidobacterium dentium ATCC 27679]
 gi|308220322|gb|EFO76633.1| ribosomal protein L7/L12 [Bifidobacterium dentium JCVIHMP022]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+AP +V       A  A  EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPAAVAVAAPGAAAPAEEEKDEFDVILST 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT LGL EAK LV+ APK++     K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRAITSLGLAEAKALVDGAPKAVLEKAKKEDAEKAKSQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|182418861|ref|ZP_02950119.1| ribosomal protein L7/L12 [Clostridium butyricum 5521]
 gi|237666389|ref|ZP_04526374.1| ribosomal protein L7/L12 [Clostridium butyricum E4 str. BoNT E
           BL5262]
 gi|182377286|gb|EDT74853.1| ribosomal protein L7/L12 [Clostridium butyricum 5521]
 gi|237657588|gb|EEP55143.1| ribosomal protein L7/L12 [Clostridium butyricum E4 str. BoNT E
           BL5262]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 83/122 (68%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +++++  EL K  E+E+    SA  +VVA  A   G+A  EKTEF+VVL  
Sbjct: 4   EDIIQAIKEMSVLDLNELVKACEEEF--GVSAAAAVVAGGAVAGGAAGEEKTEFDVVLA- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KI VIK VR IT LGLKEAKE+V+ APK+LK G+SKDEA +MK KL + GATVE
Sbjct: 61  -NAGDNKIKVIKAVREITGLGLKEAKEIVDGAPKTLKEGVSKDEAEDMKAKLAEVGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|255037204|ref|YP_003087825.1| 50S ribosomal protein L7/L12 [Dyadobacter fermentans DSM 18053]
 gi|254949960|gb|ACT94660.1| ribosomal protein L7/L12 [Dyadobacter fermentans DSM 18053]
          Length = 128

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 56/130 (43%), Positives = 87/130 (66%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA----SEKT 56
           M+++++  E+L +LT+ E  EL+  L+ E+G+  +A  +V+    A    A      EKT
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAAILKDEYGIEPAAAGAVMVAGPAGGAGADAPAVEEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+V+LK       K+AV+K V+ +T LGLKEAKELV+ APK +K G++KDEA+ +KK+L
Sbjct: 61  SFDVILKS--AGAGKLAVVKLVKDLTGLGLKEAKELVDGAPKPVKEGVAKDEADALKKQL 118

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 119 EEAGAEVEVK 128


>gi|293375380|ref|ZP_06621661.1| ribosomal protein L7/L12 [Turicibacter sanguinis PC909]
 gi|325844409|ref|ZP_08168136.1| ribosomal protein L7/L12 [Turicibacter sp. HGF1]
 gi|292645933|gb|EFF63962.1| ribosomal protein L7/L12 [Turicibacter sanguinis PC909]
 gi|325489083|gb|EGC91467.1| ribosomal protein L7/L12 [Turicibacter sp. HGF1]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 78/121 (64%), Gaps = 7/121 (5%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            ++E +  ++++E  EL K +E+E+GV+A+APV++V      AG +       EV +   
Sbjct: 8   EMIEAIKEMSVLELNELVKAIEEEFGVTAAAPVAMVGGAVEAAGPS-------EVDVILT 60

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
           +   KKI VIK VR IT LGLKEAKELV+  P  +K  +S +EA E+K KLE+AGA VE+
Sbjct: 61  NAGAKKIGVIKVVREITGLGLKEAKELVDGTPAKIKEKVSPEEAEELKAKLEEAGAVVEV 120

Query: 126 R 126
           +
Sbjct: 121 K 121


>gi|121606529|ref|YP_983858.1| 50S ribosomal protein L7/L12 [Polaromonas naphthalenivorans CJ2]
 gi|166222191|sp|A1VTF9|RL7_POLNA RecName: Full=50S ribosomal protein L7/L12
 gi|120595498|gb|ABM38937.1| LSU ribosomal protein L12P [Polaromonas naphthalenivorans CJ2]
          Length = 125

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 56/124 (45%), Positives = 83/124 (66%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA++  +  A       + A EKTEF VVL
Sbjct: 4   DKDAFLTVLDSMTVLELNDLVKAIEEKFGVSAASMAAPAAGGGGAGAAVAEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +   +K+ VIK VR +T LGLKEAK+LV+ APK++K G +K +A   KKKLEDAGA 
Sbjct: 64  --LEAGAQKVQVIKAVRELTGLGLKEAKDLVDGAPKNVKEGANKADAEAAKKKLEDAGAK 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|81177555|ref|XP_723723.1| ribosomal protein L7/L12 [Plasmodium yoelii yoelii str. 17XNL]
 gi|23478112|gb|EAA15288.1| ribosomal protein L7/L12 [Plasmodium yoelii yoelii]
          Length = 263

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 48/173 (27%), Positives = 74/173 (42%), Gaps = 51/173 (29%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKE------------------------WGVSASAPV 38
            +  + + + +LTLIEAA+L    +++                        +GVS    +
Sbjct: 91  KVLKLADDILNLTLIEAADLCDICQEKLEGNTKFNNGHFINRNPFPHPSSFFGVSNMHQI 150

Query: 39  SVVAPVAAEA--------------------------GSAASEKTEFEVVLKGFDDPKKKI 72
           +    +                                    KT F V L+ F D K KI
Sbjct: 151 NGGINIPVSNITNTSTNVENANSDNTKQSIENEKTEEKKKPAKTTFNVKLEKF-DVKNKI 209

Query: 73  AVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
             IKE+R IT++GLKEAKE+VESAP  ++     ++A+E+KK  E+ GAT+ L
Sbjct: 210 NTIKEIRKITNVGLKEAKEMVESAPFYIQKNAPTEQADEIKKIFENLGATIIL 262


>gi|119511568|ref|ZP_01630676.1| 50S ribosomal protein L7/L12 [Nodularia spumigena CCY9414]
 gi|119463803|gb|EAW44732.1| 50S ribosomal protein L7/L12 [Nodularia spumigena CCY9414]
          Length = 129

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 59/128 (46%), Positives = 90/128 (70%), Gaps = 4/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG---SAASEKTEF 58
           +  + I+E+L +L+L+EA+EL K++E+ +GVSA+AP   +  +A  A        EKTEF
Sbjct: 3   ATTDQILEQLKTLSLLEASELVKQIEEAFGVSAAAPAGGMMMMAPGAAAAAEPVEEKTEF 62

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L       KKIAV+K VR +T LGLKEAK+LVE+APK++K G++KD A + KK++E+
Sbjct: 63  DVILDSV-PADKKIAVLKIVRELTGLGLKEAKDLVEAAPKAVKEGIAKDAAEDAKKRIEE 121

Query: 119 AGATVELR 126
           AG  V ++
Sbjct: 122 AGGKVTVK 129


>gi|125977474|ref|XP_001352770.1| GA18594 [Drosophila pseudoobscura pseudoobscura]
 gi|54641520|gb|EAL30270.1| GA18594 [Drosophila pseudoobscura pseudoobscura]
          Length = 181

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------VVAPVAAEAGSAASEK 55
            ++SIV  +++L L+E +ELS  L+++  +  +A            A    E  +    +
Sbjct: 51  KLDSIVNNIAALNLLEVSELSTLLKQKLNLPETAFAPQFAAGPARAAAEDEEEAAPKKVQ 110

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V L  FDD K+K+A+IKEV+ +   + L +AK+ VESAP  +K  + K+EA ++K+
Sbjct: 111 TSFTVKLVKFDD-KQKVALIKEVKNLLEGMNLVQAKKFVESAPTVVKQDIPKEEAEKLKE 169

Query: 115 KLEDAGATVEL 125
            L  AGA VE+
Sbjct: 170 ALSKAGAIVEI 180


>gi|89071238|ref|ZP_01158417.1| ribosomal protein L7/L12 [Oceanicola granulosus HTCC2516]
 gi|89043224|gb|EAR49454.1| ribosomal protein L7/L12 [Oceanicola granulosus HTCC2516]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 62/128 (48%), Positives = 85/128 (66%), Gaps = 6/128 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVA---PVAAEAGSAASEKTE 57
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +V+          G+A  EKTE
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVMMAGPAGGDAGGAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+VVLK  +   +KI VIKEVR IT LGLKEAK+LVE+  K +K G+ K EA E+K KLE
Sbjct: 61  FDVVLK--NAGAQKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGIDKAEAEEIKSKLE 117

Query: 118 DAGATVEL 125
            AGA VEL
Sbjct: 118 AAGAEVEL 125


>gi|222529517|ref|YP_002573399.1| 50S ribosomal protein L7/L12 [Caldicellulosiruptor bescii DSM 6725]
 gi|222456364|gb|ACM60626.1| ribosomal protein L7/L12 [Caldicellulosiruptor bescii DSM 6725]
          Length = 129

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 68/127 (53%), Positives = 93/127 (73%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFE 59
            ++ ++E++ +LT++E +E+ K LE+E+GV+A+APV+V A   A A SAA    EKTEF 
Sbjct: 5   KVQKLIEEIKTLTVLELSEMVKALEEEFGVTAAAPVAVAAAPVAGAQSAAPAAEEKTEFN 64

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIK VR IT LGLKEAK+LV+SAPK +K  +SKDEA ++KKKLE+ 
Sbjct: 65  VIL--ADAGSDKIKVIKVVREITGLGLKEAKDLVDSAPKPIKENVSKDEAEQIKKKLEEV 122

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 123 GAKVELK 129


>gi|168700809|ref|ZP_02733086.1| hypothetical protein GobsU_14889 [Gemmata obscuriglobus UQM 2246]
          Length = 128

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 49/128 (38%), Positives = 74/128 (57%), Gaps = 5/128 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVV--APVAAEAGSAASEKTEF 58
           M++++ + + L+ LTL++A EL   L+ ++ +  +A    V        A    +E TEF
Sbjct: 1   MASVQELGDALAGLTLVQAVELKTYLKDKYQIEPAAGAVAVAAPTGPVAAAEKPAEATEF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V+L+ F D   K+  IK VR IT  GL EAK  VE APKS+K  + K  A ++KKKLE+
Sbjct: 61  NVILESFTD---KVKTIKVVREITGQGLGEAKATVEGAPKSIKESVDKKTAEDVKKKLEE 117

Query: 119 AGATVELR 126
            GA V ++
Sbjct: 118 TGAKVSIK 125


>gi|34112958|gb|AAQ62403.1| Ribosomal protein L7/L12 [uncultured marine gamma proteobacterium
           EBAC31A08]
 gi|37912943|gb|AAR05275.1| ribosomal protein L7/L12 [uncultured marine gamma proteobacterium
           EB000-45B06]
 gi|40063170|gb|AAR38007.1| ribosomal protein L7/L12 [uncultured marine bacterium 562]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 82/123 (66%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFEVVLK 63
           E I++ +  +++++  +L   +E+++GV+A+A V+     AA   + A+E K  F+VVL 
Sbjct: 6   EDILKAIEEMSVMDLVDLISDIEEKFGVTAAAAVAAAPAAAAGGDAEAAEEKDAFDVVLN 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                 +K+ VIK VRAIT LGLKEAK++V+ AP ++K G SKD+A  M K+L +AGAT 
Sbjct: 66  A--AGDQKVQVIKAVRAITGLGLKEAKDMVDGAPSTVKEGASKDDAEAMLKQLTEAGATA 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|195169657|ref|XP_002025637.1| GL20728 [Drosophila persimilis]
 gi|194109130|gb|EDW31173.1| GL20728 [Drosophila persimilis]
          Length = 181

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 46/131 (35%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------VVAPVAAEAGSAASEK 55
            ++SIV  +++L L+E +ELS  L+++  +  +A            A    E  +    +
Sbjct: 51  KLDSIVNNIAALNLLEVSELSTLLKQKLNLPETAFAPQFAAGPARAAAEDEEEAAPKKVQ 110

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           T F V L  FDD K+K+A+IKEV+ +   + L +AK+ VESAP  +K  + K+EA ++K+
Sbjct: 111 TSFTVKLVKFDD-KQKVALIKEVKNLLEGMNLVQAKKFVESAPTVVKQDIPKEEAEKLKE 169

Query: 115 KLEDAGATVEL 125
            L  AGA VE+
Sbjct: 170 ALSKAGAIVEI 180


>gi|227821747|ref|YP_002825717.1| 50S ribosomal protein L7/L12 [Sinorhizobium fredii NGR234]
 gi|254806390|sp|C3MAX1|RL7_RHISN RecName: Full=50S ribosomal protein L7/L12
 gi|227340746|gb|ACP24964.1| ribosomal protein L7/L12 [Sinorhizobium fredii NGR234]
          Length = 127

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 78/129 (60%), Positives = 99/129 (76%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           M+++  IVE LSSLT++EAAELSK LE++WGVSA+APV+V A   A  G+A     EKTE
Sbjct: 1   MADLAKIVEDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAAGGAAAAAEEEKTE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLE
Sbjct: 61  FDVILT--DAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLE 118

Query: 118 DAGATVELR 126
           DAGA V+++
Sbjct: 119 DAGAKVDVK 127


>gi|269962519|ref|ZP_06176867.1| 50S ribosomal protein L7/L12 [Vibrio harveyi 1DA3]
 gi|269832714|gb|EEZ86825.1| 50S ribosomal protein L7/L12 [Vibrio harveyi 1DA3]
          Length = 122

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/122 (43%), Positives = 82/122 (67%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++GV+A+A V       A  G AA+E+TEF+V+L  
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKFGVTAAAAVVAGG---AAGGEAAAEQTEFDVILTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP  LK G+ K EA  +K +LE+AGA+VE
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKALVDGAPAPLKEGVEKAEAEALKAQLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|119025303|ref|YP_909148.1| 50S ribosomal protein L7/L12 [Bifidobacterium adolescentis ATCC
           15703]
 gi|154486704|ref|ZP_02028111.1| hypothetical protein BIFADO_00525 [Bifidobacterium adolescentis
           L2-32]
 gi|166222138|sp|A1A033|RL7_BIFAA RecName: Full=50S ribosomal protein L7/L12
 gi|118764887|dbj|BAF39066.1| 50S ribosomal protein L7/L12 [Bifidobacterium adolescentis ATCC
           15703]
 gi|154084567|gb|EDN83612.1| hypothetical protein BIFADO_00525 [Bifidobacterium adolescentis
           L2-32]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+APV+ VA   A   +A  EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAAAPAAGAAAEEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT+LGL EAK LV+ APK++     K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRAITNLGLAEAKALVDGAPKAVLEKAKKEDAEKAKSQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|148981194|ref|ZP_01816320.1| 50S ribosomal protein L7/L12 [Vibrionales bacterium SWAT-3]
 gi|145960950|gb|EDK26276.1| 50S ribosomal protein L7/L12 [Vibrionales bacterium SWAT-3]
          Length = 122

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 77/122 (63%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++     +  + V       G AA+E+TEF+V+L  
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKF---GVSAAAAVVAGGPAGGDAAAEQTEFDVILTS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR  T LGLKEAK LV+SAP  LK G+ K EA  +K +LE+AGA+VE
Sbjct: 63  --AGSNKVQVIKAVRGATGLGLKEAKGLVDSAPAPLKEGVDKAEAEALKAQLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|163839744|ref|YP_001624149.1| 50S ribosomal protein L12P (L7/L12) [Renibacterium salmoninarum
           ATCC 33209]
 gi|162953220|gb|ABY22735.1| LSU ribosomal protein L12P (L7/L12) [Renibacterium salmoninarum
           ATCC 33209]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 84/128 (65%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + ++E    LT+IE +E  K+ E+ + V+A+A         +   +A  EK  F
Sbjct: 1   MAKLTNDELIEAFKELTIIELSEFVKQFEETFEVTAAAVAVAGPAGCSGEAAAEEEKDSF 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+     +KKIAVIKEVRA+T LGLKEAK++V++APK++  G +K+ A + K +LE+
Sbjct: 61  DVILES--AGEKKIAVIKEVRALTSLGLKEAKDVVDAAPKAVLEGATKEAAEKAKAQLEE 118

Query: 119 AGATVELR 126
           AGATV L+
Sbjct: 119 AGATVTLK 126


>gi|152980013|ref|YP_001355111.1| 50S ribosomal protein L7/L12 [Janthinobacterium sp. Marseille]
 gi|166222176|sp|A6T3L4|RL7_JANMA RecName: Full=50S ribosomal protein L7/L12
 gi|151280090|gb|ABR88500.1| large subunit ribosomal protein L7/L12 [Janthinobacterium sp.
           Marseille]
          Length = 124

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 84/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E + +LT++E  +L K  E+++GVSA+A  +  A   A  G+AA E+TEF VVL  
Sbjct: 6   DDILEAVGNLTVLELNDLVKAFEEKFGVSAAAMAAPAA-GGAAGGAAAEEQTEFTVVLAD 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+ VIK VR IT LGLKEAK+LV++APK LK G+SK +A   KKKLE+AGA  E
Sbjct: 65  F--GANKVGVIKAVREITGLGLKEAKDLVDAAPKPLKEGVSKADAEAAKKKLEEAGAKAE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|24216120|ref|NP_713601.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45656646|ref|YP_000732.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|67461164|sp|Q72UA9|RL7_LEPIC RecName: Full=50S ribosomal protein L7/L12
 gi|67461208|sp|Q8F0S1|RL7_LEPIN RecName: Full=50S ribosomal protein L7/L12
 gi|24197363|gb|AAN50619.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45599882|gb|AAS69369.1| 50S ribosomal protein L7/L12 [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
          Length = 127

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 89/122 (72%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E+++E++  LTL+EAA+L K++E ++G+SA+APV+V A  AA AG+ A+E+     V+  
Sbjct: 4   EALLEQIGKLTLVEAADLVKKMEDKFGISAAAPVAVAAVGAAPAGAGAAEEASTFNVILK 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
             D  KKI VIK VR IT LGL +AK LVE+  K++K G++K EA+++KKK E AGA +E
Sbjct: 64  GFDSAKKIEVIKLVREITGLGLADAKGLVEAGGKAVKEGVAKAEADDLKKKFEGAGAQIE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|325288569|ref|YP_004264750.1| LSU ribosomal protein L12P [Syntrophobotulus glycolicus DSM 8271]
 gi|324963970|gb|ADY54749.1| LSU ribosomal protein L12P [Syntrophobotulus glycolicus DSM 8271]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 84/126 (66%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           MS    I+E +  LT++E AEL K  E+E+GV+A+AP +VVA   A  G+A + + + E 
Sbjct: 1   MSKTAEILEAVKGLTVLELAELVKAFEEEFGVTAAAPAAVVAAAPAAGGAAPAAEEKTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +        KI VIK VR +T LGLKEAK+LV++APK +K  ++KDEA  +K KL +AG
Sbjct: 61  DVILASAGAAKINVIKVVREVTGLGLKEAKDLVDNAPKPVKEKVAKDEAEAIKAKLTEAG 120

Query: 121 ATVELR 126
           ATVE++
Sbjct: 121 ATVEVK 126


>gi|120553644|ref|YP_957995.1| 50S ribosomal protein L7/L12 [Marinobacter aquaeolei VT8]
 gi|166222181|sp|A1TYI9|RL7_MARAV RecName: Full=50S ribosomal protein L7/L12
 gi|120323493|gb|ABM17808.1| LSU ribosomal protein L12P [Marinobacter aquaeolei VT8]
          Length = 124

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+  ++ ++++E  EL + +E+++ VSA+A V+     AA AG AA EKTEF+VVL G
Sbjct: 6   DDILNAIAEMSVMEVVELVEAMEEKFNVSAAAAVAAAP-AAAAAGEAAEEKTEFDVVLTG 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VR +T LGLKEAKE+V+ AP ++K G SKDEA E KKKLE+AGA+VE
Sbjct: 65  --AGEKKVNVIKAVRELTGLGLKEAKEMVDGAPSTVKEGASKDEAEEAKKKLEEAGASVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|56750903|ref|YP_171604.1| 50S ribosomal protein L7/L12 [Synechococcus elongatus PCC 6301]
 gi|81299442|ref|YP_399650.1| 50S ribosomal protein L7/L12 [Synechococcus elongatus PCC 7942]
 gi|81596295|sp|Q5N3N6|RL7_SYNP6 RecName: Full=50S ribosomal protein L7/L12
 gi|109893810|sp|Q31QK6|RL7_SYNE7 RecName: Full=50S ribosomal protein L7/L12
 gi|56685862|dbj|BAD79084.1| 50S ribosomal protein L12 [Synechococcus elongatus PCC 6301]
 gi|81168323|gb|ABB56663.1| LSU ribosomal protein L12P [Synechococcus elongatus PCC 7942]
          Length = 128

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 68/127 (53%), Positives = 92/127 (72%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--KTEFE 59
           +  + I+E L +LTL+EAAEL K++E+ +GVSA+APV  V   AA   +A +   KTEF+
Sbjct: 3   AKTDEILESLKTLTLLEAAELVKQIEEAFGVSAAAPVGGVVVAAAAGAAAEAVEEKTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL+      KKIAV+K VR IT LGLKEAK+LVE+APK +K G+SKD+A   KK+LE+A
Sbjct: 63  VVLEEV-PADKKIAVLKVVRGITGLGLKEAKDLVEAAPKPIKEGVSKDDAEAAKKELEEA 121

Query: 120 GATVELR 126
           GA V ++
Sbjct: 122 GAKVSVK 128


>gi|15640354|ref|NP_229981.1| 50S ribosomal protein L7/L12 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121591004|ref|ZP_01678322.1| ribosomal protein L7/L12 [Vibrio cholerae 2740-80]
 gi|121728880|ref|ZP_01681889.1| ribosomal protein L7/L12 [Vibrio cholerae V52]
 gi|147673429|ref|YP_001218595.1| 50S ribosomal protein L7/L12 [Vibrio cholerae O395]
 gi|153216338|ref|ZP_01950416.1| ribosomal protein L7/L12 [Vibrio cholerae 1587]
 gi|153819684|ref|ZP_01972351.1| ribosomal protein L7/L12 [Vibrio cholerae NCTC 8457]
 gi|153823149|ref|ZP_01975816.1| ribosomal protein L7/L12 [Vibrio cholerae B33]
 gi|153827142|ref|ZP_01979809.1| ribosomal protein L7/L12 [Vibrio cholerae MZO-2]
 gi|153831462|ref|ZP_01984129.1| ribosomal protein L7/L12 [Vibrio cholerae 623-39]
 gi|227080539|ref|YP_002809090.1| ribosomal protein L7/L12 [Vibrio cholerae M66-2]
 gi|229506878|ref|ZP_04396386.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae BX 330286]
 gi|229508683|ref|ZP_04398177.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae B33]
 gi|229512396|ref|ZP_04401871.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TMA 21]
 gi|229516065|ref|ZP_04405516.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC9]
 gi|229519865|ref|ZP_04409298.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TM 11079-80]
 gi|229526889|ref|ZP_04416292.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229527012|ref|ZP_04416408.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae 12129(1)]
 gi|229606392|ref|YP_002877040.1| 50S ribosomal protein L7/L12 [Vibrio cholerae MJ-1236]
 gi|254227012|ref|ZP_04920573.1| ribosomal protein L7/L12 [Vibrio cholerae V51]
 gi|254292043|ref|ZP_04962820.1| ribosomal protein L7/L12 [Vibrio cholerae AM-19226]
 gi|254851636|ref|ZP_05240986.1| ribosomal protein L7/L12 [Vibrio cholerae MO10]
 gi|255747128|ref|ZP_05421071.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholera CIRS 101]
 gi|262149004|ref|ZP_06028149.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae INDRE 91/1]
 gi|262166946|ref|ZP_06034666.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC27]
 gi|14195175|sp|Q9KV31|RL7_VIBCH RecName: Full=50S ribosomal protein L7/L12
 gi|172047475|sp|A5F3P4|RL7_VIBC3 RecName: Full=50S ribosomal protein L7/L12
 gi|254806404|sp|C3LR59|RL7_VIBCM RecName: Full=50S ribosomal protein L7/L12
 gi|9654741|gb|AAF93500.1| ribosomal protein L7/L12 [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121547145|gb|EAX57275.1| ribosomal protein L7/L12 [Vibrio cholerae 2740-80]
 gi|121628848|gb|EAX61308.1| ribosomal protein L7/L12 [Vibrio cholerae V52]
 gi|124114333|gb|EAY33153.1| ribosomal protein L7/L12 [Vibrio cholerae 1587]
 gi|125620474|gb|EAZ48847.1| ribosomal protein L7/L12 [Vibrio cholerae V51]
 gi|126509772|gb|EAZ72366.1| ribosomal protein L7/L12 [Vibrio cholerae NCTC 8457]
 gi|126519336|gb|EAZ76559.1| ribosomal protein L7/L12 [Vibrio cholerae B33]
 gi|146315312|gb|ABQ19851.1| ribosomal protein L7/L12 [Vibrio cholerae O395]
 gi|148873057|gb|EDL71192.1| ribosomal protein L7/L12 [Vibrio cholerae 623-39]
 gi|149738970|gb|EDM53286.1| ribosomal protein L7/L12 [Vibrio cholerae MZO-2]
 gi|150422029|gb|EDN13999.1| ribosomal protein L7/L12 [Vibrio cholerae AM-19226]
 gi|227008427|gb|ACP04639.1| ribosomal protein L7/L12 [Vibrio cholerae M66-2]
 gi|227012183|gb|ACP08393.1| ribosomal protein L7/L12 [Vibrio cholerae O395]
 gi|229335535|gb|EEO01016.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae 12129(1)]
 gi|229336058|gb|EEO01077.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae bv. albensis
           VL426]
 gi|229343106|gb|EEO08091.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TM 11079-80]
 gi|229346968|gb|EEO11935.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC9]
 gi|229350611|gb|EEO15556.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae TMA 21]
 gi|229354318|gb|EEO19247.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae B33]
 gi|229355983|gb|EEO20902.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae BX 330286]
 gi|229369047|gb|ACQ59470.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae MJ-1236]
 gi|254847341|gb|EET25755.1| ribosomal protein L7/L12 [Vibrio cholerae MO10]
 gi|255735177|gb|EET90579.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholera CIRS 101]
 gi|262024651|gb|EEY43332.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae RC27]
 gi|262031194|gb|EEY49813.1| LSU ribosomal protein L7/L12 (L23e) [Vibrio cholerae INDRE 91/1]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 81/122 (66%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V      AA    A  E+TEF V+L  
Sbjct: 6   EQILDAIAEMSVMQVVELISAMEEKFGVSAAAAVVSGPAAAA----AVEEQTEFNVILAA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK LV+ AP S+K  +SK+EA  +KK+LE+AGATVE
Sbjct: 62  --AGANKVAVIKAVRGATGLGLKEAKALVDGAPASVKEAVSKEEAEALKKELEEAGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 VK 121


>gi|306820724|ref|ZP_07454351.1| ribosomal protein L7/L12 [Eubacterium yurii subsp. margaretiae ATCC
           43715]
 gi|304551223|gb|EFM39187.1| ribosomal protein L7/L12 [Eubacterium yurii subsp. margaretiae ATCC
           43715]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 88/123 (71%), Gaps = 4/123 (3%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE I++ +  + ++E  EL K+ E+E+GVSA+APV+V   VAA    +A EK+EF+V+L 
Sbjct: 8   IEQIIDAIKEMKVLELNELVKKAEEEFGVSAAAPVAVG--VAAGPAESAEEKSEFDVIL- 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +    K+ VIK VR +T LGLK+AK+LV+ APK +K G+SKDEA E+K KLE AGA V
Sbjct: 65  -AEAGASKVGVIKVVREVTGLGLKDAKDLVDGAPKPIKEGVSKDEAEEIKTKLEAAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|270291190|ref|ZP_06197413.1| 50S ribosomal protein L7/L12 [Pediococcus acidilactici 7_4]
 gi|304385475|ref|ZP_07367820.1| ribosomal protein L7/L12 [Pediococcus acidilactici DSM 20284]
 gi|270280586|gb|EFA26421.1| 50S ribosomal protein L7/L12 [Pediococcus acidilactici 7_4]
 gi|304328682|gb|EFL95903.1| ribosomal protein L7/L12 [Pediococcus acidilactici DSM 20284]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 81/124 (65%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + +  +E L   ++ +  +L K +E E+GVSA+APV+     A  AG AA  KT F V L
Sbjct: 4   DKDQFIEDLKGASISDLNDLVKAIEDEFGVSAAAPVA----AAGAAGGAAEAKTSFNVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
            G      KI VIK VR IT  GLK+AK++V++AP  +K  LS+DEAN+MK KLE+AGAT
Sbjct: 60  TG--AGSAKIKVIKAVREITGAGLKDAKDMVDNAPTVIKEDLSEDEANDMKAKLEEAGAT 117

Query: 123 VELR 126
           VE++
Sbjct: 118 VEVK 121


>gi|219848381|ref|YP_002462814.1| 50S ribosomal protein L7/L12 [Chloroflexus aggregans DSM 9485]
 gi|254806271|sp|B8G988|RL7_CHLAD RecName: Full=50S ribosomal protein L7/L12
 gi|219542640|gb|ACL24378.1| ribosomal protein L7/L12 [Chloroflexus aggregans DSM 9485]
          Length = 132

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 61/134 (45%), Positives = 87/134 (64%), Gaps = 10/134 (7%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-------- 52
           MS I++I+E +  L ++E  EL K++E++WGV+A+APV  +   A  A +          
Sbjct: 1   MSKIDTIIEMIEGLNVLELVELKKKMEEKWGVTAAAPVMAMGVAAPVAAAGDGAAAAAPA 60

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKTEF+V+LK  +    KI VIK VR +T LGLKEAK+LVE APK ++ G+SK+EA   
Sbjct: 61  EEKTEFDVILK--EAGPNKIQVIKVVRELTSLGLKEAKDLVEGAPKPVREGVSKEEAEAA 118

Query: 113 KKKLEDAGATVELR 126
           K KL + GA VE++
Sbjct: 119 KAKLTEVGAVVEIK 132


>gi|328874702|gb|EGG23067.1| ribosomal protein [Dictyostelium fasciculatum]
          Length = 189

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 44/129 (34%), Positives = 69/129 (53%), Gaps = 7/129 (5%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-----VVAPVAAEAGSAASEKT 56
           + +E +V K+  L+L+E  EL++ L+   G+      +       A  AA A +AA  K+
Sbjct: 60  AQVEEVVSKIEKLSLLEVIELTQLLQTRLGIPDIDMSNLGGGGAPAAAAAPAAAAAPPKS 119

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           EF+V L    +   K  +IKE+R I   L L E K LVE  P  +   +SK+EA+++  K
Sbjct: 120 EFQVRLVKVPEGA-KYKIIKELREIKPSLSLMETKGLVEKLPSVIAEKVSKEEADKICAK 178

Query: 116 LEDAGATVE 124
           ++ AGA  E
Sbjct: 179 IKAAGAEAE 187


>gi|228475264|ref|ZP_04059989.1| ribosomal protein L7/L12 [Staphylococcus hominis SK119]
 gi|314937155|ref|ZP_07844502.1| ribosomal protein L7/L12 [Staphylococcus hominis subsp. hominis
           C80]
 gi|228270729|gb|EEK12138.1| ribosomal protein L7/L12 [Staphylococcus hominis SK119]
 gi|313655774|gb|EFS19519.1| ribosomal protein L7/L12 [Staphylococcus hominis subsp. hominis
           C80]
          Length = 122

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 58/126 (46%), Positives = 90/126 (71%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+GV+A+APV+     AA  G AA+EKTEF+V
Sbjct: 1   MANQEQIIEAIKEMSVLELNDLVKAIEEEFGVTAAAPVAAA--GAAGGGDAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV++APK +K  ++K++A ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDNAPKVIKEAVAKEDAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|149922218|ref|ZP_01910656.1| ribosomal protein L7/L12 [Plesiocystis pacifica SIR-1]
 gi|149816958|gb|EDM76443.1| ribosomal protein L7/L12 [Plesiocystis pacifica SIR-1]
          Length = 127

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 88/123 (71%), Gaps = 4/123 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ LS+L++++ A+L K LE +WGV A+A  +V+    A A  A  E+TEF+VVLK 
Sbjct: 8   EQVIDFLSNLSVMQMADLVKELEDKWGVEAAAGGAVMVAGPA-AEEAKEEQTEFDVVLKS 66

Query: 65  FDDPKKKIAVIKEVRAI-TDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           F    KKI VIK +RA  + LGLKEAK LVESAP ++K  +SK+EA E+KK LE+AGA V
Sbjct: 67  F--GAKKINVIKAIRAQISGLGLKEAKSLVESAPVAVKEAVSKEEAEELKKILEEAGAEV 124

Query: 124 ELR 126
           E++
Sbjct: 125 EVK 127


>gi|253987831|ref|YP_003039187.1| 50S ribosomal protein L7/L12 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253779281|emb|CAQ82442.1| 50s ribosomal subunit protein l7/l12 [Photorhabdus asymbiotica]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++++++++  EL   +E+++GVSA+A V+VV    A A  A  EKTEF+VVL  
Sbjct: 6   EQILDTVATMSVMDVVELITAMEEKFGVSAAAAVAVV----AGAAEAVEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK  +SKD+A  +KK LE+AGA+VE
Sbjct: 62  I--GGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDDAEALKKSLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|254483541|ref|ZP_05096767.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2148]
 gi|214036198|gb|EEB76879.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2148]
          Length = 124

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 52/123 (42%), Positives = 84/123 (68%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I+  ++ ++++E  EL + +E+++GV+A+A V+     A     AA  E+TEF+V+L 
Sbjct: 4   EDILNAIAEMSVMEVVELIEAMEEKFGVTAAAAVAAAPAAAGGDAGAAAEEQTEFDVILT 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                +KK+ VIK VR++T LGLKEAK LV+ AP ++K G +K+EA ++KK+LE+AG   
Sbjct: 64  S--AGEKKVNVIKVVRSVTGLGLKEAKGLVDGAPSAIKEGATKEEAEDVKKQLEEAGGAA 121

Query: 124 ELR 126
           EL+
Sbjct: 122 ELK 124


>gi|125975205|ref|YP_001039115.1| 50S ribosomal protein L12P [Clostridium thermocellum ATCC 27405]
 gi|256003133|ref|ZP_05428125.1| ribosomal protein L7/L12 [Clostridium thermocellum DSM 2360]
 gi|281419556|ref|ZP_06250567.1| ribosomal protein L7/L12 [Clostridium thermocellum JW20]
 gi|125715430|gb|ABN53922.1| LSU ribosomal protein L12P [Clostridium thermocellum ATCC 27405]
 gi|255992824|gb|EEU02914.1| ribosomal protein L7/L12 [Clostridium thermocellum DSM 2360]
 gi|281406778|gb|EFB37045.1| ribosomal protein L7/L12 [Clostridium thermocellum JW20]
 gi|316939369|gb|ADU73403.1| ribosomal protein L7/L12 [Clostridium thermocellum DSM 1313]
          Length = 129

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 66/127 (51%), Positives = 93/127 (73%), Gaps = 5/127 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFE 59
            +  ++E + +L+++E +EL K LE+E+GVSA+APV+V A  AA  G+AA    EKTEFE
Sbjct: 5   KVTKLIEDVKALSVLELSELVKALEEEFGVSAAAPVAVAAVGAAAPGAAAPAAEEKTEFE 64

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       KI VIK VR +T LGLKEAK+LV+ APK+LK G+SKDEA +++ K ++ 
Sbjct: 65  VILKS--PGADKIKVIKVVREVTGLGLKEAKDLVDGAPKTLKEGVSKDEAAQIEAKFKEV 122

Query: 120 GATVELR 126
           GATVE++
Sbjct: 123 GATVEIK 129


>gi|209696267|ref|YP_002264197.1| 50S ribosomal protein L7/L12 [Aliivibrio salmonicida LFI1238]
 gi|226733633|sp|B6ENR4|RL7_ALISL RecName: Full=50S ribosomal protein L7/L12
 gi|208010220|emb|CAQ80551.1| 50S ribosomal subunit protein L7/L12 [Aliivibrio salmonicida
           LFI1238]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 48/122 (39%), Positives = 76/122 (62%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++        +        A  AA E+TEF+V+L  
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKF----GVTAAAAVVAGGAAAEAAEEQTEFDVILTA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++VIK VR  T LGLKEAK LV+SAP +LK G+ K EA  +K +LE+AGATVE
Sbjct: 62  I--GGNKVSVIKAVRGATGLGLKEAKGLVDSAPAALKEGVDKAEAEGLKAQLEEAGATVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|15618004|ref|NP_224288.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae CWL029]
 gi|15835615|ref|NP_300139.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae J138]
 gi|16752964|ref|NP_445237.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae AR39]
 gi|33241415|ref|NP_876356.1| 50S ribosomal protein L7/L12 [Chlamydophila pneumoniae TW-183]
 gi|6647728|sp|Q9Z9A1|RL7_CHLPN RecName: Full=50S ribosomal protein L7/L12
 gi|4376338|gb|AAD18233.1| L7/L12 Ribosomal Protein [Chlamydophila pneumoniae CWL029]
 gi|7189609|gb|AAF38503.1| ribosomal protein L7/L12 [Chlamydophila pneumoniae AR39]
 gi|8978453|dbj|BAA98290.1| L7/L12 ribosomal protein [Chlamydophila pneumoniae J138]
 gi|33235923|gb|AAP98013.1| ribosomal protein L7/L12 [Chlamydophila pneumoniae TW-183]
 gi|269302959|gb|ACZ33059.1| ribosomal protein L7/L12 [Chlamydophila pneumoniae LPCoLN]
          Length = 129

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 58/123 (47%), Positives = 80/123 (65%), Gaps = 1/123 (0%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           +E++VEKLS+LT++E ++L K LE++W V+ASAPV  VA         A+E TEF V L+
Sbjct: 6   LETLVEKLSNLTVLELSQLKKLLEEKWDVTASAPVVAVAAGGGGEAPVAAEPTEFAVTLE 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                 KKI V+K VR +T L LKEAKE+ E  PK++K   SK +A +  KKL+DAGA  
Sbjct: 66  DV-PADKKIGVLKVVREVTGLALKEAKEMTEGLPKTVKEKTSKSDAEDTVKKLQDAGAKA 124

Query: 124 ELR 126
             +
Sbjct: 125 SFK 127


>gi|238756061|ref|ZP_04617384.1| 50S ribosomal protein L7/L12 [Yersinia ruckeri ATCC 29473]
 gi|238705728|gb|EEP98122.1| 50S ribosomal protein L7/L12 [Yersinia ruckeri ATCC 29473]
          Length = 121

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E +++L+++E  EL   +E+++GVSA+     VA   A A  A  EKTEF+V+L  
Sbjct: 6   DQIIEGVAALSVMEIVELISAMEEKFGVSAA----AVAAGPAAAAEAVEEKTEFDVILSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     K+AVIK VR  T LGLKEAK+LVESAP +LK G+SKD+A  +KK LE+AGA+VE
Sbjct: 62  F--GDNKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSKDDAEALKKALEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|71905953|ref|YP_283540.1| 50S ribosomal protein L7/L12 [Dechloromonas aromatica RCB]
 gi|109893759|sp|Q47JB1|RL7_DECAR RecName: Full=50S ribosomal protein L7/L12
 gi|71845574|gb|AAZ45070.1| LSU ribosomal protein L12P [Dechloromonas aromatica RCB]
          Length = 123

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 80/122 (65%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + SLT++E  +L K  E+++    SA    VA  A    +AA E+TEF V+L G
Sbjct: 6   EDILEAVGSLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEQTEFTVMLTG 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KK+ VIK VRA T LGLKEAK+LV+ APK++K G+SK +A  +K +LE AGA VE
Sbjct: 64  --AGDKKVEVIKVVRAATGLGLKEAKDLVDGAPKAVKEGVSKADAEALKAQLEAAGAKVE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|301093686|ref|XP_002997688.1| 50S ribosomal protein L7/L12, putative [Phytophthora infestans
           T30-4]
 gi|262109937|gb|EEY67989.1| 50S ribosomal protein L7/L12, putative [Phytophthora infestans
           T30-4]
          Length = 178

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/128 (42%), Positives = 84/128 (65%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTE 57
            ++++++++  L ++E AELS  ++ ++G++ SA    +   AA   + A+E     KT 
Sbjct: 51  KVQTVLDQILDLNMVEIAELSHAIQTKFGIAESAFQVGMGGGAAGGAAPAAEEAKEEKTA 110

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V L  F D K KI VIKEVRAIT LGLKEAKELVE AP +LK  + K++A+ + ++L+
Sbjct: 111 FDVKLASF-DAKSKIKVIKEVRAITGLGLKEAKELVEGAPSTLKKDVKKEDADALIEQLK 169

Query: 118 DAGATVEL 125
             GA VEL
Sbjct: 170 AVGAVVEL 177


>gi|183221355|ref|YP_001839351.1| 50S ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189911448|ref|YP_001963003.1| 50S ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167776124|gb|ABZ94425.1| 50S Ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|167779777|gb|ABZ98075.1| 50S ribosomal protein L7/L12 [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
          Length = 127

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 92/123 (74%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKT-EFEVVL 62
           +++++E++ SLTL++AA+L K++E+++G+SA+APV+V A   A  G+AA+E+   F V+L
Sbjct: 3   VDALLEQIGSLTLVQAADLVKKMEEKFGISAAAPVAVAAVAGAGGGAAAAEEPATFNVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K      KKI VIK VR IT LGL +AK LVE+  KS+K G+SKDEA ++KKKLE  GA 
Sbjct: 63  KAH--GDKKIDVIKLVREITGLGLADAKTLVEAGGKSVKEGVSKDEAADIKKKLEGVGAQ 120

Query: 123 VEL 125
           VE+
Sbjct: 121 VEV 123


>gi|189499298|ref|YP_001958768.1| 50S ribosomal protein L7/L12 [Chlorobium phaeobacteroides BS1]
 gi|226733659|sp|B3EL60|RL7_CHLPB RecName: Full=50S ribosomal protein L7/L12
 gi|189494739|gb|ACE03287.1| ribosomal protein L7/L12 [Chlorobium phaeobacteroides BS1]
          Length = 126

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/126 (47%), Positives = 88/126 (69%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++IE++VE++  L+L EA+EL K LE ++GVSA+  V   A  AA  G A +++ + E 
Sbjct: 1   MASIEALVEEIGKLSLTEASELVKALEDKFGVSAAPAVFAGAAAAAPGGEAEAKEEQTEF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            ++       KI VIK VR+IT LGLKEAKE+V+ APK +K  +SK+EA ++ K+L+DAG
Sbjct: 61  DVELKAVGANKINVIKAVRSITGLGLKEAKEMVDGAPKVVKEAVSKEEAEKVAKELKDAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AEVELK 126


>gi|269955427|ref|YP_003325216.1| 50S ribosomal protein L7/L12 [Xylanimonas cellulosilytica DSM
           15894]
 gi|269304108|gb|ACZ29658.1| ribosomal protein L7/L12 [Xylanimonas cellulosilytica DSM 15894]
          Length = 127

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 62/129 (48%), Positives = 86/129 (66%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           M+ +  E ++E+   LTLIE ++  K  E+ + V+A+APV+V A   A A + A E K E
Sbjct: 1   MAKLTTEELIEQFKGLTLIELSDFVKVFEETFDVTAAAPVAVAAAGPAAAAAEAVEEKDE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L       KKI VIKEVRA+T LGLKEAK+LV+ APK +   ++KD A + K +LE
Sbjct: 61  FDVILTA--AGDKKIQVIKEVRALTSLGLKEAKDLVDGAPKPVLENVAKDAAEKAKAQLE 118

Query: 118 DAGATVELR 126
            AGATVEL+
Sbjct: 119 GAGATVELK 127


>gi|311748522|ref|ZP_07722307.1| ribosomal protein L7/L12 [Algoriphagus sp. PR1]
 gi|126577038|gb|EAZ81286.1| ribosomal protein L7/L12 [Algoriphagus sp. PR1]
          Length = 127

 Score = 79.2 bits (194), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 56/129 (43%), Positives = 85/129 (65%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA---ASEKTE 57
           M+++  + ++L +LT+ E  EL+  L+ ++G+  +A    VA  AA          EKT 
Sbjct: 1   MADLTQLADQLVNLTVKEVKELTDILKDQYGIEPAAAAVAVAGPAAGGADGGAAEEEKTS 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       K+AV+K V+ +T LGLK+AKELV+SAPK+LK G++KDEA  +KK LE
Sbjct: 61  FDVILKA--AGASKLAVVKLVKELTGLGLKDAKELVDSAPKALKEGIAKDEAEGLKKSLE 118

Query: 118 DAGATVELR 126
           +AGA VE++
Sbjct: 119 EAGAEVEIK 127


>gi|256825896|ref|YP_003149856.1| 50S ribosomal protein L7/L12 [Kytococcus sedentarius DSM 20547]
 gi|256689289|gb|ACV07091.1| LSU ribosomal protein L12P [Kytococcus sedentarius DSM 20547]
          Length = 129

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 62/131 (47%), Positives = 90/131 (68%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEK 55
           M+ +  + ++E+   +TLIE +E  K+ E+ + V+A+APV+V     A AG A     EK
Sbjct: 1   MAKLSNDELIEQFKEMTLIELSEFVKQFEEVFEVTAAAPVAVAGAAPAAAGDAGDAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+V+L       KKI VIKEVR +T LGLKEAK+LV+ APK++  G+SK+EA++ K+ 
Sbjct: 61  TEFDVILAA--AGDKKIGVIKEVRGLTSLGLKEAKDLVDGAPKAVLEGVSKEEADKAKEA 118

Query: 116 LEDAGATVELR 126
           LE AGATVE++
Sbjct: 119 LEGAGATVEVK 129


>gi|68071947|ref|XP_677887.1| ribosomal protein L7/L12 [Plasmodium berghei strain ANKA]
 gi|56498172|emb|CAH98105.1| ribosomal protein L7/L12, putative [Plasmodium berghei]
          Length = 262

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 47/172 (27%), Positives = 73/172 (42%), Gaps = 50/172 (29%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEW-------------------------------- 30
            +  +V+ + +LTLIEAA+L    +++                                 
Sbjct: 91  KVLKLVDDILNLTLIEAADLCDMCQEKLEGNIQFNNGYFINRNPFPHPLSFFEASNVHQI 150

Query: 31  ---------GVSASAPVSVVAPV--------AAEAGSAASEKTEFEVVLKGFDDPKKKIA 73
                     ++ ++     A                    KT F + L+ F D K KI 
Sbjct: 151 NGGINIPTSNITNASTNVENAIPDIKQTNEIGKTEEKKNQTKTTFNIKLEKF-DVKNKIN 209

Query: 74  VIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
            IKE+R IT++GLKEAKE+VESAP  ++     ++A+E+KK  ED GAT+ L
Sbjct: 210 TIKEIRKITNVGLKEAKEMVESAPFYIQKNAPAEQADEIKKIFEDLGATIIL 261


>gi|239918209|ref|YP_002957767.1| LSU ribosomal protein L12P [Micrococcus luteus NCTC 2665]
 gi|281415600|ref|ZP_06247342.1| LSU ribosomal protein L12P [Micrococcus luteus NCTC 2665]
 gi|259491652|sp|C5CC72|RL7_MICLC RecName: Full=50S ribosomal protein L7/L12
 gi|239839416|gb|ACS31213.1| LSU ribosomal protein L12P [Micrococcus luteus NCTC 2665]
          Length = 129

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/131 (45%), Positives = 87/131 (66%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  E ++     LTLIE +E  K  E+++ V+A+APV+V A   A  G+ A+    K
Sbjct: 1   MAKLTTEELLAAFEELTLIELSEFIKAFEEKFDVTAAAPVAVAAAGGAAGGAEAAAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+V+L+      KKI VIKEVRA+T LGLKEAK+LV+ APK +  G++K+ A + K++
Sbjct: 61  DEFDVILEA--AGDKKIGVIKEVRALTSLGLKEAKDLVDGAPKPILEGVNKETAEKAKEQ 118

Query: 116 LEDAGATVELR 126
           LE AGATV L+
Sbjct: 119 LEGAGATVTLK 129


>gi|224129696|ref|XP_002328780.1| predicted protein [Populus trichocarpa]
 gi|222839078|gb|EEE77429.1| predicted protein [Populus trichocarpa]
          Length = 173

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 50/133 (37%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKT------ 56
            +E I + L  LT IE  + +     + G+    P    A ++  A   ++         
Sbjct: 41  KLERIADVLLDLTKIERHDYAILFRHKMGLGRYGPAVSGAILSGPAAPGSASGDVKTAAA 100

Query: 57  ----EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
                F++ L+ FD    KI VIKEVR  TDLGLKEAK+LVE  P  LK GL+K+EA  +
Sbjct: 101 AEKTAFDIKLEKFDAAA-KIKVIKEVRTFTDLGLKEAKDLVEKVPVVLKKGLTKEEAGPI 159

Query: 113 KKKLEDAGATVEL 125
            +KL+  GATV L
Sbjct: 160 IEKLKALGATVVL 172


>gi|326799810|ref|YP_004317629.1| 50S ribosomal protein L7/L12 [Sphingobacterium sp. 21]
 gi|326550574|gb|ADZ78959.1| 50S ribosomal protein L7/L12 [Sphingobacterium sp. 21]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 58/127 (45%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL++ L+ E+G+  +A    VA  AA   + A  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELAQILKDEYGIEPAAAAVAVAGPAAGGDAPAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  +   +K+AV+K V+ +T LGLKEAK+LV+ APK LK G++KDEA  +KK+LE+A
Sbjct: 61  VILK--EAGGQKLAVVKLVKDLTGLGLKEAKDLVDGAPKELKAGVAKDEAEALKKQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAVVEIK 125


>gi|325293347|ref|YP_004279211.1| 50S ribosomal protein L7/L12 [Agrobacterium sp. H13-3]
 gi|325061200|gb|ADY64891.1| 50S ribosomal protein L7/L12 [Agrobacterium sp. H13-3]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 76/127 (59%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A A +    EKTEF+
Sbjct: 1   MADLAKIVEDLSTLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAGAAAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VIL--VDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|288573178|ref|ZP_06391535.1| ribosomal protein L7/L12 [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288568919|gb|EFC90476.1| ribosomal protein L7/L12 [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 124

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 88/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFEVVLK 63
           E I++ +  ++++E +EL K LE ++GVSA+AP  ++A  AA A  A   EKTEF VVLK
Sbjct: 4   EDIIKAIEEMSVLELSELVKELEDKFGVSAAAPAMMMAAPAAGAAVAAEEEKTEFNVVLK 63

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +   +KI VIK VR IT LGLKEAKELV++  K++K G++KDEA  +KK+LE+ GATV
Sbjct: 64  --EAGSQKIKVIKVVREITGLGLKEAKELVDNPGKAIKEGVAKDEAETVKKQLEEVGATV 121

Query: 124 EL 125
           EL
Sbjct: 122 EL 123


>gi|239813606|ref|YP_002942516.1| 50S ribosomal protein L7/L12 [Variovorax paradoxus S110]
 gi|259491660|sp|C5CKF2|RL7_VARPS RecName: Full=50S ribosomal protein L7/L12
 gi|239800183|gb|ACS17250.1| ribosomal protein L7/L12 [Variovorax paradoxus S110]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 84/124 (67%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +        A + A E+TEF V+L
Sbjct: 4   DKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAGAGGGAAAAVAEEQTEFNVML 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D    K++ IK VR IT LGLKEAK+LVE+APK++K GLSK +A   KKKLEDAGA 
Sbjct: 64  --MDAGANKVSAIKAVREITGLGLKEAKDLVEAAPKAVKEGLSKADAEAAKKKLEDAGAK 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|34499649|ref|NP_903864.1| 50S ribosomal protein L7/L12 [Chromobacterium violaceum ATCC 12472]
 gi|81654188|sp|Q7NQE5|RL7_CHRVO RecName: Full=50S ribosomal protein L7/L12
 gi|34105499|gb|AAQ61854.1| 50S ribosomal protein L7/L12 [Chromobacterium violaceum ATCC 12472]
          Length = 123

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 56/122 (45%), Positives = 80/122 (65%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E ++ LT++E  +L K  E+++    SA    VA  A    +AA EKTEF+VVL  
Sbjct: 6   EDILEAVAGLTVMELNDLVKAFEEKF--GVSAAAVAVAGPAGAGAAAAEEKTEFDVVLSA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VRAIT LGLKEAK+LV+ APK++K G++K EA ++ K+L +AGA  E
Sbjct: 64  --AGDNKVGVIKVVRAITGLGLKEAKDLVDGAPKNVKEGVAKAEAEDIVKQLTEAGAKAE 121

Query: 125 LR 126
           ++
Sbjct: 122 IK 123


>gi|171462870|ref|YP_001796983.1| ribosomal protein L7/L12 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
 gi|226733718|sp|B1XSP2|RL7_POLNS RecName: Full=50S ribosomal protein L7/L12
 gi|171192408|gb|ACB43369.1| ribosomal protein L7/L12 [Polynucleobacter necessarius subsp.
           necessarius STIR1]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 79/122 (64%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+++++  +L K  E+++GVSA+A   V    A    +  +E+TEF V L  
Sbjct: 6   EEIIEAVGSMSVMDLNDLVKAFEEKFGVSAAAMAVVGPAGAGGGDAGGAEQTEFTVNL-- 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    K++VIK VR IT LGLKEAK+LV+ APK +K G+ K  A E KKKLE+AGA  E
Sbjct: 64  VEAGANKVSVIKAVREITGLGLKEAKDLVDGAPKPIKEGVDKKTAEEAKKKLEEAGAKAE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|329956689|ref|ZP_08297262.1| ribosomal protein L7/L12 [Bacteroides clarus YIT 12056]
 gi|328524061|gb|EGF51137.1| ribosomal protein L7/L12 [Bacteroides clarus YIT 12056]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 55/127 (43%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A   +AA  EK+ F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGAAAAAEEKSSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGSAKLQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|167627268|ref|YP_001677768.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|241667824|ref|ZP_04755402.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876367|ref|ZP_05249077.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|189042995|sp|B0TX09|RL7_FRAP2 RecName: Full=50S ribosomal protein L7/L12
 gi|167597269|gb|ABZ87267.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|254842388|gb|EET20802.1| 50S ribosomal protein L7/L12 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 124

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 83/122 (68%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  +L K +E+++GVSA+A V+V A   A A  AA EKTEF+VVL  
Sbjct: 6   EDILNAVAEMSVMDVCDLVKMMEEKFGVSAAAAVAVAA-APAAAAEAAEEKTEFDVVL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    KIA IK VR  T LGLKEAK+ VE  P ++K   SKDEA  +KK+LE+AGA VE
Sbjct: 63  VDAGSNKIAAIKAVRGATGLGLKEAKDAVEGTPFTVKEAASKDEAEALKKQLEEAGAKVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|297184062|gb|ADI20181.1| hypothetical protein [uncultured Sphingobacterium sp. EB080_L08E11]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 87/127 (68%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV-SASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++I+ + + L +LT+ E +EL+  L++E G+  A+A  +V  P A   G AA  +TEF+
Sbjct: 1   MADIKELGDALVNLTVKEVSELAGYLKEEHGIEPAAAAAAVAGPAAGGGGDAAEAQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLKEAKE V+ AP +LK G++KDEA  +K +LE+A
Sbjct: 61  VILKA--AGGSKLAVVKLVKEMTGLGLKEAKEKVDGAPAALKEGVTKDEAEALKAQLEEA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAEVEVK 125


>gi|326772039|ref|ZP_08231324.1| ribosomal protein L7/L12 [Actinomyces viscosus C505]
 gi|326638172|gb|EGE39073.1| ribosomal protein L7/L12 [Actinomyces viscosus C505]
          Length = 129

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEK 55
           M+ +  E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A        EK
Sbjct: 1   MAKLTTEELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGGDAAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+V+L+      KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++
Sbjct: 61  DEFDVILEA--AGDKKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKETAEKAKEQ 118

Query: 116 LEDAGATVELR 126
           LE AGATV L+
Sbjct: 119 LEGAGATVTLK 129


>gi|302336392|ref|YP_003801599.1| LSU ribosomal protein L12P [Olsenella uli DSM 7084]
 gi|301320232|gb|ADK68719.1| LSU ribosomal protein L12P [Olsenella uli DSM 7084]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA A +A  EKT F+V L  
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGAAAAEEEKTNFDVELTA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KIAVIK VR++T LGLKEAKE VESAPK L  G  K++A   K +LE+AGATV 
Sbjct: 66  F--GDNKIAVIKVVRSLTSLGLKEAKEAVESAPKVLIEGAKKEDAEAAKAQLEEAGATVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|308233481|ref|ZP_07664218.1| LSU ribosomal protein L12P [Atopobium vaginae DSM 15829]
 gi|328943545|ref|ZP_08241010.1| 50S ribosomal protein L7/L12 [Atopobium vaginae DSM 15829]
 gi|327491514|gb|EGF23288.1| 50S ribosomal protein L7/L12 [Atopobium vaginae DSM 15829]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA A  A  EKT F+V L  
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGAAPAEEEKTNFDVELTS 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KIAVIK VR++T LGLKEAK+ VE+APK L  G  K++A   KK+LE+AGA+V 
Sbjct: 66  V--GSNKIAVIKVVRSLTSLGLKEAKDAVEAAPKVLLEGAKKEDAEAAKKQLEEAGASVT 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|326792618|ref|YP_004310439.1| ribosomal protein L7/L12 [Clostridium lentocellum DSM 5427]
 gi|326543382|gb|ADZ85241.1| ribosomal protein L7/L12 [Clostridium lentocellum DSM 5427]
          Length = 123

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 5/123 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ I++ +  LT++E  EL    E+E+GVSA+A V V    A  AG+AA EKT+F+V L 
Sbjct: 6   IQEIIDAVKELTILELNELVTACEEEFGVSAAAGVMVA---AGPAGAAAEEKTDFDVELT 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +   +KI VIK VR IT LGLKEAKE V+ APK LK G++KDEA  +K KLE+ GA V
Sbjct: 63  --EAGAEKIKVIKVVREITGLGLKEAKEAVDGAPKVLKEGVAKDEAESIKAKLEEVGAKV 120

Query: 124 ELR 126
            L+
Sbjct: 121 TLK 123


>gi|302877793|ref|YP_003846357.1| 50S ribosomal protein L7/L12 [Gallionella capsiferriformans ES-2]
 gi|302580582|gb|ADL54593.1| ribosomal protein L7/L12 [Gallionella capsiferriformans ES-2]
          Length = 123

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/121 (43%), Positives = 88/121 (72%), Gaps = 4/121 (3%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGF 65
            +++ ++S+T++E +EL K++E+++GVSA+A        AA   +AA+E++EF+V+L   
Sbjct: 7   ELMDAVASMTVLELSELIKQMEEKFGVSAAAVAVAG--PAAGPAAAAAEQSEFDVILATV 64

Query: 66  DDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
                K++VIK VR IT LGLKEAK+LV++APK +K G+SK +A+ + K+L +AGAT E+
Sbjct: 65  --GDNKVSVIKAVRVITGLGLKEAKDLVDAAPKVVKEGVSKADADAIAKQLIEAGATAEV 122

Query: 126 R 126
           +
Sbjct: 123 K 123


>gi|284047645|ref|YP_003397984.1| ribosomal protein L7/L12 [Acidaminococcus fermentans DSM 20731]
 gi|283951866|gb|ADB46669.1| ribosomal protein L7/L12 [Acidaminococcus fermentans DSM 20731]
          Length = 121

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 64/124 (51%), Positives = 91/124 (73%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + + I+E + ++T++E A+L K +E ++GVSA+APV+V    A  AG+AA+EKTEF+VVL
Sbjct: 2   DKDQIMEAIENMTVLELADLVKAMEDKFGVSAAAPVAVA--AAPAAGAAAAEKTEFDVVL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K  D    KI VIK VR +T LGLKEAK  V++AP ++K  ++K +A  MK KLE+AGAT
Sbjct: 60  K--DAGASKINVIKVVRELTGLGLKEAKAAVDAAPNAIKEHVAKADAEAMKAKLEEAGAT 117

Query: 123 VELR 126
           VEL+
Sbjct: 118 VELK 121


>gi|315651735|ref|ZP_07904740.1| 50S ribosomal protein L7/L12 [Eubacterium saburreum DSM 3986]
 gi|315485990|gb|EFU76367.1| 50S ribosomal protein L7/L12 [Eubacterium saburreum DSM 3986]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 83/128 (64%), Gaps = 5/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     ++ +  L+++E  EL K  E+E+   ++A   VVA   A AG+AA EKTEF
Sbjct: 1   MAKLTTAEFIDAIKELSVLELNELVKACEEEF-GVSAAAGVVVAAAGAGAGAAAEEKTEF 59

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L       +K+ VIK VR +T LGLKEAK+LV+ APK LKT +SK+EA  +KK+LE+
Sbjct: 60  DVELTAT--GDQKVKVIKVVREVTGLGLKEAKDLVDGAPKVLKTEISKEEAEGIKKQLEE 117

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 118 VGAQVTLK 125


>gi|149198914|ref|ZP_01875955.1| ribosomal protein L7/L12 [Lentisphaera araneosa HTCC2155]
 gi|149137909|gb|EDM26321.1| ribosomal protein L7/L12 [Lentisphaera araneosa HTCC2155]
          Length = 132

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 84/122 (68%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E++V+ +  ++++E   L K LE   GVSA+APV+V A   A A + A+E+     V+  
Sbjct: 11  EALVKSIEEMSVLELTTLVKALEDRLGVSAAAPVAVAAAGGAAAPAEAAEEQTEFDVVLA 70

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKIAVIK VR+ T LGLK+AK+LVE APK++K   +KDEA+++KK LE+AGATVE
Sbjct: 71  AYPADKKIAVIKVVRSATGLGLKDAKDLVEGAPKTVKEAAAKDEADKIKKDLEEAGATVE 130

Query: 125 LR 126
           L+
Sbjct: 131 LK 132


>gi|225438225|ref|XP_002264348.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|225468320|ref|XP_002271482.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 165

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/132 (40%), Positives = 75/132 (56%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEA---------GSAAS 53
            +E I ++L  LT +E  + S     + G++   P       A  A          + A+
Sbjct: 34  KLERIADELLDLTKLERYDYSILFRLKLGLNKYGPAVSGLASADSASAGSGSAPADAKAA 93

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           EKT F++ L+ FD    KI +IKEVR  TDLGLKEAK+LVE AP  LK G++K+E N + 
Sbjct: 94  EKTAFDIKLEKFDAAA-KIKIIKEVRTFTDLGLKEAKDLVEKAPVVLKKGVTKEEGNPIV 152

Query: 114 KKLEDAGATVEL 125
           +KL++ GATV L
Sbjct: 153 EKLKELGATVVL 164


>gi|229497096|ref|ZP_04390800.1| ribosomal protein L7/L12 [Porphyromonas endodontalis ATCC 35406]
 gi|229316021|gb|EEN81950.1| ribosomal protein L7/L12 [Porphyromonas endodontalis ATCC 35406]
          Length = 125

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTEFE 59
           M++I++I E L +LT+ E +EL+  L++E+G+  +A    VA     AG+A +E KT F+
Sbjct: 1   MADIKAIAETLVNLTVKEVSELANVLKEEYGIEPAAAAVAVAAAPGAAGAAEAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK F     K+ V+K V+    LGLKEAK++V++AP +LK G+ K  A+ MK  LE+A
Sbjct: 61  VVLKSF--GSAKLQVVKAVKEHCGLGLKEAKDIVDAAPATLKEGVDKATADAMKAALEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|299137933|ref|ZP_07031113.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX8]
 gi|298599863|gb|EFI56021.1| ribosomal protein L7/L12 [Acidobacterium sp. MP5ACTX8]
          Length = 124

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 85/127 (66%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I+ + +++ SL+L+EA+EL K+LE+  GVSA+A V+        A +A   EKTEF 
Sbjct: 1   MADIQQLEDQIVSLSLLEASELVKKLEERLGVSAAAAVAAAPAGGGAAAAAPAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  D    KI  IK VR +T LGLKEAK+LV+ APK LK  +SK++A  + KK +  
Sbjct: 61  VILK--DAGANKINTIKAVREVTALGLKEAKDLVDGAPKPLKENISKEDAAAIAKKFDGV 118

Query: 120 GATVELR 126
            ATVE++
Sbjct: 119 -ATVEIK 124


>gi|171741308|ref|ZP_02917115.1| hypothetical protein BIFDEN_00387 [Bifidobacterium dentium ATCC
           27678]
 gi|212716660|ref|ZP_03324788.1| hypothetical protein BIFCAT_01593 [Bifidobacterium catenulatum DSM
           16992]
 gi|225351093|ref|ZP_03742116.1| hypothetical protein BIFPSEUDO_02679 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|283455332|ref|YP_003359896.1| 50S ribosomal protein L12P (L7/L12) [Bifidobacterium dentium Bd1]
 gi|171276922|gb|EDT44583.1| hypothetical protein BIFDEN_00387 [Bifidobacterium dentium ATCC
           27678]
 gi|212660364|gb|EEB20939.1| hypothetical protein BIFCAT_01593 [Bifidobacterium catenulatum DSM
           16992]
 gi|225158549|gb|EEG71791.1| hypothetical protein BIFPSEUDO_02679 [Bifidobacterium
           pseudocatenulatum DSM 20438]
 gi|283101966|gb|ADB09072.1| rplL LSU ribosomal protein L12P (L7/L12) [Bifidobacterium dentium
           Bd1]
          Length = 126

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+AP +V       A  A  EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPAAVAVAAPGAAAPAEEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT LGL EAK LV+ APK++     K++A + K +LE+AGATVE
Sbjct: 67  V--GDKKIQVIKAVRAITSLGLAEAKALVDGAPKAVLEKAKKEDAEKAKSQLEEAGATVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|295837042|ref|ZP_06823975.1| ribosomal protein L7/L12 [Streptomyces sp. SPB74]
 gi|295826332|gb|EDY45890.2| ribosomal protein L7/L12 [Streptomyces sp. SPB74]
          Length = 132

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 80/128 (62%), Gaps = 4/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E ++ +   LTLIE +E  K  E+++ V+A+APV+     +A A  AA E+ EF
Sbjct: 7   MAKLSQEELLAQFEELTLIELSEFVKAFEEKFDVTAAAPVAAAVGPSAPAAEAAEEQDEF 66

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L G     KKI VIK VR +T LGLKEAK+LV+  PK +   + K  A +  + L+ 
Sbjct: 67  DVILTG--AGDKKIQVIKVVRELTSLGLKEAKDLVDGTPKPVLEKVDKAAAEKAAESLKG 124

Query: 119 AGATVELR 126
           AGA+VE++
Sbjct: 125 AGASVEVK 132


>gi|297571944|ref|YP_003697718.1| ribosomal protein L7/L12 [Arcanobacterium haemolyticum DSM 20595]
 gi|296932291|gb|ADH93099.1| ribosomal protein L7/L12 [Arcanobacterium haemolyticum DSM 20595]
          Length = 127

 Score = 78.8 bits (193), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 60/129 (46%), Positives = 86/129 (66%), Gaps = 5/129 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-KTE 57
           M+ +  E ++E    LTL+E  +  K+ E+E+ V A+APV+V A   A   + A E K E
Sbjct: 1   MAKLTAEELIEAFKELTLVELNDFVKKFEEEFDVEAAAPVAVAAAAPAAGAAEAEEEKDE 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L+      KKI VIKEVRA+T LGLKEAK+LV+ APK +  G++K+ A + K++LE
Sbjct: 61  FDVILES--AGDKKIGVIKEVRALTSLGLKEAKDLVDGAPKPVLEGVNKETAEKAKEQLE 118

Query: 118 DAGATVELR 126
            AGATV L+
Sbjct: 119 GAGATVTLK 127


>gi|258647509|ref|ZP_05734978.1| ribosomal protein L7/L12 [Prevotella tannerae ATCC 51259]
 gi|260852282|gb|EEX72151.1| ribosomal protein L7/L12 [Prevotella tannerae ATCC 51259]
          Length = 124

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 55/125 (44%), Positives = 81/125 (64%), Gaps = 2/125 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A   +AA EKT F+V
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAGAAAAEEKTAFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +LK       K+ V+K V+    LGLKEAK+LV+  P  LK G++K+EA  +KK LE+AG
Sbjct: 61  ILKA--AGSAKLQVVKAVKENCGLGLKEAKDLVDGVPSKLKEGVAKEEAESLKKVLEEAG 118

Query: 121 ATVEL 125
           A VE+
Sbjct: 119 AEVEI 123


>gi|139438553|ref|ZP_01772069.1| Hypothetical protein COLAER_01067 [Collinsella aerofaciens ATCC
           25986]
 gi|133776092|gb|EBA39912.1| Hypothetical protein COLAER_01067 [Collinsella aerofaciens ATCC
           25986]
          Length = 125

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 65/128 (50%), Positives = 89/128 (69%), Gaps = 5/128 (3%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + I++ L  +TL+EA+EL K +E  +GVSA+AP +VVA   A   + A EKTEF
Sbjct: 1   MAKLTTDEIIDALKEMTLLEASELVKAIEDTFGVSAAAPAAVVA-APAAGAAEAEEKTEF 59

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +VVL+GF     KI VIK VR +T+LGLKEAKE+VE APK++  G  K++A   K+KLE 
Sbjct: 60  DVVLEGF--GDNKIQVIKAVRELTNLGLKEAKEVVEGAPKAVLEGAKKEDAEAAKEKLEA 117

Query: 119 AGATVELR 126
           AGA V L+
Sbjct: 118 AGAAVTLK 125


>gi|15889251|ref|NP_354932.1| 50S ribosomal protein L7/L12 [Agrobacterium tumefaciens str. C58]
 gi|24212246|sp|Q8UE07|RL7_AGRT5 RecName: Full=50S ribosomal protein L7/L12
 gi|15157081|gb|AAK87717.1| 50S ribosomal protein L7/L12 [Agrobacterium tumefaciens str. C58]
          Length = 125

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 78/127 (61%), Positives = 99/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++  IVE LS+LT++EAAELSK LE++WGVSA+APV+V A   A A +A   EKTEF+
Sbjct: 1   MADLAKIVEDLSTLTVLEAAELSKLLEEKWGVSAAAPVAVAAAGGAGAAAAVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    KI VIKEVRAIT LGLKEAK+LVE APK++K  +SK EA ++KKKLEDA
Sbjct: 61  VVL--VDAGANKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAVSKAEAADLKKKLEDA 118

Query: 120 GATVELR 126
           GA V+++
Sbjct: 119 GAKVDVK 125


>gi|163783790|ref|ZP_02178774.1| ribosomal protein L7/L12 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159880943|gb|EDP74463.1| ribosomal protein L7/L12 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 114

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 82/116 (70%), Gaps = 5/116 (4%)

Query: 14  LTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEKTEFEVVLKGFDDPKK 70
           ++++E AEL K+LE+E+GVSA+A V+      A    A     EKTEF+VVLK       
Sbjct: 1   MSVLEVAELVKKLEEEFGVSAAAMVAAAPAGGAAGAGAGAAAEEKTEFDVVLKS--PGGN 58

Query: 71  KIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVELR 126
           KI VIK VR IT LGLKEAKELV++APK +K G+SK+EA ++K KLE+AGA VEL+
Sbjct: 59  KIQVIKVVREITGLGLKEAKELVDNAPKPIKEGVSKEEAEQIKSKLEEAGAEVELK 114


>gi|126734764|ref|ZP_01750510.1| ribosomal protein L7/L12 [Roseobacter sp. CCS2]
 gi|126715319|gb|EBA12184.1| ribosomal protein L7/L12 [Roseobacter sp. CCS2]
          Length = 124

 Score = 78.8 bits (193), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 65/126 (51%), Positives = 87/126 (69%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGV-SASAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++ + E++ +LTL+EA EL   L+ E+G+  A+    ++A      G AA+EKTEF+
Sbjct: 1   MADLKKMAEEIVALTLLEAQELKTILKDEYGIEPAAGGAVMMASGGDAGGEAAAEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAK+LVE+  K +K G SKDEA E+K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKDLVEAGGK-IKEGASKDEAEEIKSKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|281207310|gb|EFA81493.1| hypothetical protein PPL_05481 [Polysphondylium pallidum PN500]
          Length = 176

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 42/128 (32%), Positives = 65/128 (50%), Gaps = 8/128 (6%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS------VVAPVAAEAGSAASEKTE 57
           +E IV ++  L+L+E  EL+  L+   G+      S           A  A +AA  K+E
Sbjct: 48  VEDIVGQIEKLSLLEVIELTSLLQTRLGIPDIDIGSLGGGAAPAGAAAPAAAAAAPPKSE 107

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           ++V L    +   K  +IKE+R I   L L E K LVE  P  +   +SK+EA+++  K+
Sbjct: 108 YQVRLTKVPEGA-KYKIIKELREIKPSLSLMETKGLVEKLPSVIADKVSKEEADKIIAKI 166

Query: 117 EDAGATVE 124
           + AGA  E
Sbjct: 167 KAAGAESE 174


>gi|195491016|ref|XP_002093384.1| GE20790 [Drosophila yakuba]
 gi|194179485|gb|EDW93096.1| GE20790 [Drosophila yakuba]
          Length = 182

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 44/132 (33%), Positives = 75/132 (56%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS--------VVAPVAAEAGSAASE 54
            ++SIV  +++LTL+E +ELS  L+++  +  +A                  E  +    
Sbjct: 51  KLDSIVNNIAALTLLEVSELSTLLKQKLNLPETAFAPQFAAGPARAAPAEDEEEAAPKKV 110

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           +T F+V L  F D K+K+A+IKEV+ +   + L +AK+ VESAP  +K  + K+EA ++K
Sbjct: 111 QTSFKVKLVKF-DEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDIPKEEAEKLK 169

Query: 114 KKLEDAGATVEL 125
           + L  AGA +E+
Sbjct: 170 EALAKAGAIIEI 181


>gi|52694894|gb|AAU85598.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
 gi|52694918|gb|AAU85610.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
          Length = 124

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 79/124 (63%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  L     +E  +L   +E+++GV+A+  V      +  +   + E+TEF+V+L
Sbjct: 4   NKEDILTWLEGAKTMEVVDLVTAIEEKFGVTAAVAVGGGGVASTGSTD-SEEQTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+KKKLE  GA 
Sbjct: 63  MSF--GDSKINVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELKKKLEAVGAK 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|89075378|ref|ZP_01161800.1| 50S ribosomal protein L7/L12 [Photobacterium sp. SKA34]
 gi|89048927|gb|EAR54496.1| 50S ribosomal protein L7/L12 [Photobacterium sp. SKA34]
          Length = 121

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 45/122 (36%), Positives = 73/122 (59%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL + +E+++        +        A  AA E+TEF+V+L  
Sbjct: 6   EQILDAVAEMSVMQVVELIEAMEEKF----GVTAAAAVVAGGAAAEAAEEQTEFDVILTA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+ VIK VR  T LGLKEAK +V+ AP  LK G+ K EA  +K +LE+AGA+VE
Sbjct: 62  C--GPNKVQVIKAVRGATGLGLKEAKAVVDGAPAPLKEGVEKSEAEALKAQLEEAGASVE 119

Query: 125 LR 126
           ++
Sbjct: 120 IK 121


>gi|261880896|ref|ZP_06007323.1| ribosomal protein L7/L12 [Prevotella bergensis DSM 17361]
 gi|270332404|gb|EFA43190.1| ribosomal protein L7/L12 [Prevotella bergensis DSM 17361]
          Length = 126

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 79/126 (62%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++++I E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA   + A+ + +   
Sbjct: 1   MADVKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAGPAAGGAADAAAEEKSSF 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +   D    K+ V+K V+    LGLKEAK LVE AP ++K GLSKDEA  +KK +E+AG
Sbjct: 61  DVVLTDIGATKLQVVKAVKEACGLGLKEAKALVEGAPAAIKEGLSKDEAENLKKAIEEAG 120

Query: 121 ATVELR 126
           A VEL+
Sbjct: 121 AKVELK 126


>gi|257454925|ref|ZP_05620173.1| ribosomal protein L7/L12 [Enhydrobacter aerosaccus SK60]
 gi|257447635|gb|EEV22630.1| ribosomal protein L7/L12 [Enhydrobacter aerosaccus SK60]
          Length = 123

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 86/122 (70%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++  +++E  +L   +E+++GVSA+A  +     AA    AA EK +F VVL G
Sbjct: 6   QEILDAIAEKSVMEIVDLISAMEEKFGVSAAALAAAP--AAAGDAPAAEEKDDFTVVLTG 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KK+AVIK VR IT LGLKEAK+LVE AP+++K G++K EA E+KKKLE+AGA+VE
Sbjct: 64  --AGDKKVAVIKAVREITGLGLKEAKDLVEGAPQTVKEGVAKAEAEELKKKLEEAGASVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|284039327|ref|YP_003389257.1| ribosomal protein L7/L12 [Spirosoma linguale DSM 74]
 gi|283818620|gb|ADB40458.1| ribosomal protein L7/L12 [Spirosoma linguale DSM 74]
          Length = 128

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/130 (43%), Positives = 87/130 (66%), Gaps = 6/130 (4%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS----EKT 56
           M+++++  E+L SLT+ E  EL+  L+ E+G+  +A   V+          A+    EKT
Sbjct: 1   MADLKAFAEQLVSLTVKEVNELATILKDEYGIEPAAAAPVMVAGGGAGAGDAAPAVAEKT 60

Query: 57  EFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
            F+VVLK       K+AV+K V+ +T LGLKEAKELV++APK +K G+SKDEA+ ++K+L
Sbjct: 61  SFDVVLKS--AGAAKLAVVKLVKDLTGLGLKEAKELVDTAPKPVKEGVSKDEADALRKQL 118

Query: 117 EDAGATVELR 126
           E+AGA VE++
Sbjct: 119 EEAGAEVEVK 128


>gi|330430115|gb|AEC21449.1| 50S ribosomal protein L7/L12 [Pusillimonas sp. T7-7]
          Length = 126

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 86/122 (70%), Gaps = 3/122 (2%)

Query: 6   SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLKG 64
            I++ ++S+T++E +EL K +E+++GVSA+A    VA  AA   +AA  E+TEF VVL  
Sbjct: 7   EILDAIASMTVLELSELIKEMEEKFGVSAAAAAVAVAAPAAGGAAAAAEEQTEFTVVLAE 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K++VIK VR IT LGLKEAK+LV+ APK +K GL+K +A   +KKLE+AGA VE
Sbjct: 67  V--GANKVSVIKAVREITGLGLKEAKDLVDGAPKPVKEGLAKADAEAAQKKLEEAGAKVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|160881808|ref|YP_001560776.1| ribosomal protein L7/L12 [Clostridium phytofermentans ISDg]
 gi|189042989|sp|A9KJL7|RL7_CLOPH RecName: Full=50S ribosomal protein L7/L12
 gi|160430474|gb|ABX44037.1| ribosomal protein L7/L12 [Clostridium phytofermentans ISDg]
          Length = 120

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 51/122 (41%), Positives = 74/122 (60%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           +  ++ +  +T++E  +L K  E+E+     +  + V   AA    AA EKTEF+V L  
Sbjct: 4   QEFIDAIKGMTVLELNDLVKACEEEF---GVSAAAGVVVAAAGPAEAAEEKTEFDVELT- 59

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D    K+ VIK VR +T LGLKEAK++V+ APK LK   SK+EA+++K KLE  GA V 
Sbjct: 60  -DVGANKVKVIKVVREVTGLGLKEAKDVVDGAPKVLKEAASKEEADDIKAKLEAEGAKVT 118

Query: 125 LR 126
           L+
Sbjct: 119 LK 120


>gi|189465410|ref|ZP_03014195.1| hypothetical protein BACINT_01763 [Bacteroides intestinalis DSM
           17393]
 gi|319900916|ref|YP_004160644.1| LSU ribosomal protein L12P [Bacteroides helcogenes P 36-108]
 gi|189437684|gb|EDV06669.1| hypothetical protein BACINT_01763 [Bacteroides intestinalis DSM
           17393]
 gi|319415947|gb|ADV43058.1| LSU ribosomal protein L12P [Bacteroides helcogenes P 36-108]
          Length = 125

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 84/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A  G+AA  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAGGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGAAKLQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKTLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|329944329|ref|ZP_08292588.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 170 str.
           F0386]
 gi|328531059|gb|EGF57915.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 170 str.
           F0386]
          Length = 129

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 59/131 (45%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A    +    K
Sbjct: 1   MAKLTTEELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGGEAAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+V+L+      KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++
Sbjct: 61  DEFDVILEA--AGDKKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKEAAEKAKEQ 118

Query: 116 LEDAGATVELR 126
           LE AGATV L+
Sbjct: 119 LEGAGATVTLK 129


>gi|302671725|ref|YP_003831685.1| ribosomal protein L7/L12 RplL [Butyrivibrio proteoclasticus B316]
 gi|302396198|gb|ADL35103.1| ribosomal protein L7/L12 RplL [Butyrivibrio proteoclasticus B316]
          Length = 125

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 54/128 (42%), Positives = 76/128 (59%), Gaps = 5/128 (3%)

Query: 1   MSNIE--SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     ++ +  LT++E  +L K  E+E+   ++A   VVA   A A +A  EKTEF
Sbjct: 1   MAKLTTAEFIDAIKELTVLELNDLVKACEEEF-GVSAAAGVVVAAAGAGAAAAGEEKTEF 59

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
            V L        K+ VIK VR +T LGLKEAK+LV+ APK +K   SK EA+++K KLE 
Sbjct: 60  NVELTEV--GPNKVKVIKVVRELTGLGLKEAKDLVDGAPKMVKENASKAEADDIKAKLEA 117

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 118 EGAKVTLK 125


>gi|229824595|ref|ZP_04450664.1| hypothetical protein GCWU000282_01942 [Catonella morbi ATCC 51271]
 gi|229785966|gb|EEP22080.1| hypothetical protein GCWU000282_01942 [Catonella morbi ATCC 51271]
          Length = 121

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   T+IE  +L K +E+E+GV+A+        VAA   +AA EKTEF+V L
Sbjct: 4   NIENIIAEIKEATIIELNDLVKAIEEEFGVTAA----APVAVAAGPAAAAEEKTEFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    KI VIK VR  T LGLKEAKELV+ AP  +K G SK++A  +K  LE+ GAT
Sbjct: 60  T--NAGAGKIKVIKVVREATGLGLKEAKELVDGAPSVVKEGASKEDAEALKAALEEVGAT 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|254517461|ref|ZP_05129517.1| ribosomal protein L7/L12 [Clostridium sp. 7_2_43FAA]
 gi|226911210|gb|EEH96411.1| ribosomal protein L7/L12 [Clostridium sp. 7_2_43FAA]
          Length = 122

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 81/122 (66%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E  EL K  E+E+   ++A    VA   A   +AA EKTEF+VVL  
Sbjct: 4   EDIIQAIKEMTVLELNELVKACEEEF-GVSAAAPVAVAGAVAGGAAAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR +T LGLKEAKE+V+ APK+LK G+SK+EA +MK KL + GA VE
Sbjct: 63  --AGSQKIKVIKVVRELTGLGLKEAKEIVDGAPKTLKEGVSKEEAEDMKAKLAEVGAEVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|297183425|gb|ADI19558.1| hypothetical protein [uncultured gamma proteobacterium
           HF0770_27E13]
          Length = 131

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 78/122 (63%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E ++E +S +++++  EL   +E+++GVSASAP  V     A A  +  E  + E  L  
Sbjct: 10  EELLEAISKMSVMDLVELISEMEEKFGVSASAPAPVAVAATAGAEPSDKEDEQTEFDLIL 69

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KIAVIK VRAIT LGLK+AK++VE AP ++K  +SK E  EM K+LED+GA VE
Sbjct: 70  KSFGDNKIAVIKAVRAITSLGLKDAKDMVEKAPITIKEAVSKKEVEEMTKQLEDSGAVVE 129

Query: 125 LR 126
           L+
Sbjct: 130 LK 131


>gi|157825319|ref|YP_001493039.1| 50S ribosomal protein L7/L12 [Rickettsia akari str. Hartford]
 gi|166222202|sp|A8GMA6|RL7_RICAH RecName: Full=50S ribosomal protein L7/L12
 gi|157799277|gb|ABV74531.1| 50S ribosomal protein L7/L12 [Rickettsia akari str. Hartford]
          Length = 124

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  I E+LSSLTL++AAEL K LE++W VSA+APV+V A  AA A  A +EKTEFE+
Sbjct: 1   MADLAKIEEQLSSLTLMQAAELVKMLEEKWCVSAAAPVAVAAAGAAPAAEAVAEKTEFEI 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL       KK+ VIK V+ IT LGL EAK+LV+ APK +K+ + K EA E+K KLE AG
Sbjct: 61  VL--IAAGDKKVEVIKAVKDITGLGLIEAKKLVDEAPKLMKSNVKKAEAEEIKGKLEAAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AKVELK 124


>gi|157363340|ref|YP_001470107.1| 50S ribosomal protein L7/L12 [Thermotoga lettingae TMO]
 gi|166990990|sp|A8F4F9|RL7_THELT RecName: Full=50S ribosomal protein L7/L12
 gi|157313944|gb|ABV33043.1| ribosomal protein L7/L12 [Thermotoga lettingae TMO]
          Length = 129

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 67/130 (51%), Positives = 86/130 (66%), Gaps = 8/130 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVS---ASAPVSVVAPVAAEAGSAASEKTEFE 59
           N+E IVE +  LT+ E AEL K LE+++GVS     A  +  AP A    + A EKTEF+
Sbjct: 2   NVEQIVEAIEKLTVAELAELVKALEEKFGVSAAAPIAVAAAAAPAAGAQQAQAEEKTEFD 61

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKS---LKTGLSKDEANEMKKKL 116
           V+LKGF     KI VIK VR IT LGLKEAK+LVE A      +K+G+ K+EA ++KKKL
Sbjct: 62  VLLKGF--GSNKIGVIKVVREITGLGLKEAKDLVEKAGSPDAIVKSGIPKNEAEDIKKKL 119

Query: 117 EDAGATVELR 126
           E+AGA V L+
Sbjct: 120 EEAGAEVTLK 129


>gi|195125922|ref|XP_002007423.1| GI12941 [Drosophila mojavensis]
 gi|193919032|gb|EDW17899.1| GI12941 [Drosophila mojavensis]
          Length = 182

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 43/133 (32%), Positives = 75/133 (56%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAE---------AGSAAS 53
            ++SIV  +++L L+E AELS  L+++  +  +A     A                +   
Sbjct: 50  KLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQFAAPGPARSAAAEDEEEAAPKK 109

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            +T F+V +  F D K+K+A+IKEV+ +   + L +AK+ VESAP  +K  ++K+EA ++
Sbjct: 110 VQTAFKVKMIKF-DEKQKVALIKEVKNLLEGMNLVQAKKFVESAPTIVKEDVTKEEAEKL 168

Query: 113 KKKLEDAGATVEL 125
           K+ L  AGA +E+
Sbjct: 169 KEALAKAGAVIEI 181


>gi|302543375|ref|ZP_07295717.1| ribosomal protein L7/L12 [Streptomyces hygroscopicus ATCC 53653]
 gi|302460993|gb|EFL24086.1| ribosomal protein L7/L12 [Streptomyces himastatinicus ATCC 53653]
          Length = 129

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/131 (43%), Positives = 85/131 (64%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  E ++E+  +LTLIE +E  K  E+++ V+A+AP +VVA     AG+AA     +
Sbjct: 1   MAKLTQEELLEQFETLTLIELSEFVKAFEEKFDVTAAAPAAVVAAAPGGAGAAAEAEEEQ 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+VVL G     KKI VIK VR +T LGLKEAK+LV+  PK +   +SK+ A +  + 
Sbjct: 61  DEFDVVLTG--AGDKKIQVIKVVRELTSLGLKEAKDLVDGTPKPVLEKVSKEAAEKAAES 118

Query: 116 LEDAGATVELR 126
           L+ AGA+VE++
Sbjct: 119 LKGAGASVEVK 129


>gi|78188334|ref|YP_378672.1| 50S ribosomal protein L7/L12 [Chlorobium chlorochromatii CaD3]
 gi|109893755|sp|Q3ATP6|RL7_CHLCH RecName: Full=50S ribosomal protein L7/L12
 gi|78170533|gb|ABB27629.1| LSU ribosomal protein L12P [Chlorobium chlorochromatii CaD3]
          Length = 124

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 86/124 (69%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG-SAASEKTEFEVVL 62
           IE++VE++  LTL EAA L K LE+++GVSA+         A     +A  E+TEF VVL
Sbjct: 3   IENLVEEIGKLTLTEAAALVKALEEKFGVSAAPVAVAAGVAAPAGDVAAVEEQTEFTVVL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                 + KI VIK VR+IT LGLKEAK+LV+ APK++K  +SKDEA ++ K+L+DAGA+
Sbjct: 63  --VAAGESKINVIKVVRSITGLGLKEAKDLVDGAPKNVKEAISKDEAEKIAKELKDAGAS 120

Query: 123 VELR 126
           VE++
Sbjct: 121 VEVK 124


>gi|302553514|ref|ZP_07305856.1| ribosomal protein L7/L12 [Streptomyces viridochromogenes DSM 40736]
 gi|302471132|gb|EFL34225.1| ribosomal protein L7/L12 [Streptomyces viridochromogenes DSM 40736]
          Length = 129

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 56/131 (42%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  E ++ +   +TLIE +E  K  E+++ V+A+A   VV    A  G+AA     K
Sbjct: 1   MAKLSQEDLLAQFEEMTLIELSEFVKAFEEKFDVTAAAAAPVVVAGGAAGGAAAEAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+VVL G     KKI VIK VR +T LGLKEAK+LV+ APK +   ++K+ A++ K+ 
Sbjct: 61  DEFDVVLTG--AGDKKIQVIKVVRELTSLGLKEAKDLVDGAPKPVLEKVNKEAADKAKES 118

Query: 116 LEDAGATVELR 126
           LE AGA+VE++
Sbjct: 119 LEGAGASVEVK 129


>gi|257784973|ref|YP_003180190.1| 50S ribosomal protein L7/L12 [Atopobium parvulum DSM 20469]
 gi|257473480|gb|ACV51599.1| ribosomal protein L7/L12 [Atopobium parvulum DSM 20469]
          Length = 126

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 61/123 (49%), Positives = 85/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFEVVLK 63
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA   + A+ EK+ F+V+L+
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGGAAEAAEEKSNFDVILE 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GF     KI VIK VRA+T+LGLKEAKE+VE APK++  G  K++A   K +LE+AGATV
Sbjct: 66  GF--GDNKIGVIKVVRALTNLGLKEAKEVVEGAPKAVLEGAKKEDAEAAKAQLEEAGATV 123

Query: 124 ELR 126
            L+
Sbjct: 124 TLK 126


>gi|164658976|ref|XP_001730613.1| hypothetical protein MGL_2409 [Malassezia globosa CBS 7966]
 gi|159104509|gb|EDP43399.1| hypothetical protein MGL_2409 [Malassezia globosa CBS 7966]
          Length = 180

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 45/132 (34%), Positives = 69/132 (52%), Gaps = 9/132 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------- 55
            I  IV+ +  LTL+EA+EL + L+    ++  A  +      A A  A           
Sbjct: 48  KITEIVDSIEKLTLLEASELVQELKTRLNITDIAMPAAAPAAPAAAAPAEEAPAEEKPKE 107

Query: 56  -TEFEVVLKGFDDPKKKIAVIKEVRA-ITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
            T F +   G      K  VIKEV+A  T + L EAK+ VESAP++LK  ++K++A ++K
Sbjct: 108 KTLFTIKFLGLGSDSAKAKVIKEVKAINTSMNLVEAKKFVESAPQTLKENVTKEDAQKIK 167

Query: 114 KKLEDAGATVEL 125
           + +E AG  +EL
Sbjct: 168 EAVEKAGGKIEL 179


>gi|23336425|ref|ZP_00121643.1| COG0222: Ribosomal protein L7/L12 [Bifidobacterium longum DJO10A]
 gi|23466103|ref|NP_696706.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum NCC2705]
 gi|189440530|ref|YP_001955611.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum DJO10A]
 gi|227546439|ref|ZP_03976488.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|239620979|ref|ZP_04664010.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|312133839|ref|YP_004001178.1| rpll [Bifidobacterium longum subsp. longum BBMN68]
 gi|317483029|ref|ZP_07942031.1| ribosomal protein L7/L12 [Bifidobacterium sp. 12_1_47BFAA]
 gi|322689960|ref|YP_004209694.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322691900|ref|YP_004221470.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp. longum
           JCM 1217]
 gi|81753606|sp|Q8G443|RL7_BIFLO RecName: Full=50S ribosomal protein L7/L12
 gi|226733643|sp|B3DPX4|RL7_BIFLD RecName: Full=50S ribosomal protein L7/L12
 gi|23326836|gb|AAN25342.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum NCC2705]
 gi|189428965|gb|ACD99113.1| Ribosomal protein L7/L12 [Bifidobacterium longum DJO10A]
 gi|227213096|gb|EEI80975.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis ATCC 55813]
 gi|239516080|gb|EEQ55947.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis CCUG 52486]
 gi|291516493|emb|CBK70109.1| LSU ribosomal protein L12P [Bifidobacterium longum subsp. longum
           F8]
 gi|311773130|gb|ADQ02618.1| RplL [Bifidobacterium longum subsp. longum BBMN68]
 gi|316915530|gb|EFV36950.1| ribosomal protein L7/L12 [Bifidobacterium sp. 12_1_47BFAA]
 gi|320456756|dbj|BAJ67378.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp. longum
           JCM 1217]
 gi|320461296|dbj|BAJ71916.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 126

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 81/122 (66%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+APV+ VA VA  A  A  EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAAVAGAAAPAEEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT+LGL EAK LV+ APK++     K++A + K +LE+AGA+VE
Sbjct: 67  V--GDKKIQVIKAVRAITNLGLAEAKALVDGAPKAVLEKAKKEDAEKAKAQLEEAGASVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|301794398|emb|CBW36831.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae INV104]
          Length = 122

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 85/124 (68%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   +++E  +L K +E+E+GV+A+APV+V    AA+A  A + K  F+V L
Sbjct: 4   NIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAVA---AADAADAGAAKDSFDVEL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KK+ VIK VR IT LGLKEAKELV+ AP  +K G++  EA E+K KLE+AGA+
Sbjct: 61  TS--AGDKKVGVIKVVREITGLGLKEAKELVDGAPALVKEGVATAEAEEIKTKLEEAGAS 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|221194565|ref|ZP_03567622.1| ribosomal protein L7/L12 [Atopobium rimae ATCC 49626]
 gi|221185469|gb|EEE17859.1| ribosomal protein L7/L12 [Atopobium rimae ATCC 49626]
          Length = 127

 Score = 78.4 bits (192), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 75/122 (61%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I+E L  +  +E +EL   LE  +GVSA+APV+V A  AA   +  + + +    +  
Sbjct: 6   DEIIEALKEMPALELSELVHELEDVFGVSAAAPVAVAAAPAAGGAAEGAAEEKTNFDVVL 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 KIAVIK VR +T LGLKEAKE+VE APK++  G  KD+A   K KLE+AGATV 
Sbjct: 66  EGFGANKIAVIKVVRELTSLGLKEAKEVVEGAPKAVLEGAKKDDAEAAKAKLEEAGATVT 125

Query: 125 LR 126
           L+
Sbjct: 126 LK 127


>gi|284042790|ref|YP_003393130.1| ribosomal protein L7/L12 [Conexibacter woesei DSM 14684]
 gi|283947011|gb|ADB49755.1| ribosomal protein L7/L12 [Conexibacter woesei DSM 14684]
          Length = 126

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 52/126 (41%), Positives = 81/126 (64%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+  +  +++L +++++E AE  + LE+E+GVSA+A  +         G  A+ +    V
Sbjct: 1   MATTQEWIDELKAISVLELAERIRALEEEFGVSATAVAAAAPAAGGGGGGEAAAEESSTV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            +       KKI VIK VRA T LGLKEAK LV+ APK +K G+ +DEA+++K +LE+AG
Sbjct: 61  DVVLTGAGDKKIQVIKVVRAATGLGLKEAKALVDEAPKPVKEGIERDEADKLKAELEEAG 120

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 121 ASVELK 126


>gi|222112412|ref|YP_002554676.1| 50S ribosomal protein l7/l12 [Acidovorax ebreus TPSY]
 gi|254806371|sp|B9MH48|RL7_DIAST RecName: Full=50S ribosomal protein L7/L12
 gi|221731856|gb|ACM34676.1| ribosomal protein L7/L12 [Acidovorax ebreus TPSY]
          Length = 126

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 60/125 (48%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +  A  AA  G+AA  EKTEF VV
Sbjct: 4   DKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAGGAAGGGAAAAEEKTEFNVV 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D    K+AVIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA
Sbjct: 64  LA--DAGANKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGA 121

Query: 122 TVELR 126
             EL+
Sbjct: 122 KAELK 126


>gi|93007002|ref|YP_581439.1| 50S ribosomal protein L7/L12 [Psychrobacter cryohalolentis K5]
 gi|109893788|sp|Q1Q8P8|RL7_PSYCK RecName: Full=50S ribosomal protein L7/L12
 gi|92394680|gb|ABE75955.1| LSU ribosomal protein L12P [Psychrobacter cryohalolentis K5]
          Length = 123

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 85/122 (69%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++  ++ +++++  EL   +E+++GV+A+   +     A  A +AA EK EF+VVL  
Sbjct: 6   DDVLNAIAEMSVMDIVELISAMEEKFGVTAAVAAAPA--AAGPAAAAAEEKDEFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F   +KK+ VIK VR  T LGLKEAK+LVESAP  +K G++K EA E+KKKLE+AGATVE
Sbjct: 64  F--GEKKVGVIKAVREATGLGLKEAKDLVESAPAPIKEGVNKAEAEELKKKLEEAGATVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|189502705|ref|YP_001958422.1| 50S ribosomal protein L7/L12 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|226733635|sp|B3ETZ1|RL7_AMOA5 RecName: Full=50S ribosomal protein L7/L12
 gi|189498146|gb|ACE06693.1| hypothetical protein Aasi_1397 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 127

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/129 (44%), Positives = 82/129 (63%), Gaps = 5/129 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGS---AASEKTE 57
           MS+++   E+L +LT+ E  EL+  L++E G+  +A   VV       G    AA EKT 
Sbjct: 1   MSDLKKFAEQLVNLTVKEVNELAAILKEEHGIEPAAAAPVVVAGGGAQGGDSKAAEEKTH 60

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+LK       K++V+K V+ +T LGLKEAK+LV++APK +K G  K EA  +K KLE
Sbjct: 61  FDVILKS--AGASKLSVVKLVKDLTGLGLKEAKDLVDAAPKPIKEGAPKAEAESLKSKLE 118

Query: 118 DAGATVELR 126
           +AGA VEL+
Sbjct: 119 EAGAEVELK 127


>gi|52694920|gb|AAU85611.1| 50S ribosomal protein L7/L12 [Borrelia valaisiana]
          Length = 123

 Score = 78.0 bits (191), Expect = 3e-13,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 79/124 (63%), Gaps = 4/124 (3%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+  L     +E  +L   +E+++    +A V+V    A+   + + E+TEF+V+L
Sbjct: 4   NKEDILTWLEGAKTMEVVDLVTAIEEKF--GVTAAVAVGGGAASTGSTDSEEQTEFDVIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
             F     KI VIKEVRAIT LGL EAK LVE+APK++K GLSK +A E+KKKLE  GA 
Sbjct: 62  MSF--GNSKINVIKEVRAITGLGLGEAKALVEAAPKAIKEGLSKSDAEELKKKLEAVGAK 119

Query: 123 VELR 126
           VE++
Sbjct: 120 VEVK 123


>gi|195428443|ref|XP_002062282.1| GK16748 [Drosophila willistoni]
 gi|194158367|gb|EDW73268.1| GK16748 [Drosophila willistoni]
          Length = 183

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 74/133 (55%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS---------VVAPVAAEAGSAAS 53
            ++SIV  +++L L+E AELS  L+++  +  +A              +    E  +   
Sbjct: 51  KLDSIVNNIAALNLLEVAELSTLLKQKLNLPETAFAPQIAVGGPARAASADDEEEAAPKK 110

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            +T F V L  F D K+K+A+IKEV+ +   + L +AK+ VESAP  +K  L KDEA ++
Sbjct: 111 VQTSFTVKLVKF-DEKQKVALIKEVKTLLEGMNLVQAKKFVESAPTIVKGDLPKDEAEKL 169

Query: 113 KKKLEDAGATVEL 125
           K+ L  AGA +E+
Sbjct: 170 KEALTKAGAVIEI 182


>gi|297833344|ref|XP_002884554.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297330394|gb|EFH60813.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 186

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 46/128 (35%), Positives = 66/128 (51%), Gaps = 6/128 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVA-----AEAGSAASEKTE 57
            I  + E +++L+  E  ++   L +   +     +S     A     A       EKT 
Sbjct: 59  KIMELAECIAALSPEERKQIGPALNEHLRLPKQQMISSDGIGAKQDTGAGKVEEKKEKTA 118

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V L+ F+    KI VIKEVR  T LGLKEAKELVE  P  LK G++K+EANE+  K++
Sbjct: 119 FDVKLEKFNASD-KIKVIKEVRTFTSLGLKEAKELVEKVPAILKQGVTKEEANEIIAKIK 177

Query: 118 DAGATVEL 125
             G    +
Sbjct: 178 AVGGVAVM 185


>gi|258406193|ref|YP_003198935.1| 50S ribosomal protein L7/L12 [Desulfohalobium retbaense DSM 5692]
 gi|257798420|gb|ACV69357.1| ribosomal protein L7/L12 [Desulfohalobium retbaense DSM 5692]
          Length = 128

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 60/122 (49%), Positives = 85/122 (69%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + +VE +S++T++E AE  K LE ++GVSA+APV+  AP AA  G AA+E+ + E  +  
Sbjct: 7   DQVVEFISNMTVLELAEFIKELEDKFGVSAAAPVAAAAPAAAGGGEAAAEEEQTEFDVIL 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +    KIAVIK VRAIT LGLKEAK  V+  P ++K  + K+ A+E KK+LE+AGA VE
Sbjct: 67  QEVGGNKIAVIKAVRAITGLGLKEAKAKVDELPSAMKEQVDKETADEAKKQLEEAGAKVE 126

Query: 125 LR 126
           L+
Sbjct: 127 LK 128


>gi|183597456|ref|ZP_02958949.1| hypothetical protein PROSTU_00729 [Providencia stuartii ATCC 25827]
 gi|188023205|gb|EDU61245.1| hypothetical protein PROSTU_00729 [Providencia stuartii ATCC 25827]
          Length = 122

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 81/122 (66%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++  EL   +E+++G    +  + VA     A  AA EKTEF+VVL  
Sbjct: 6   DQILDAVAEMSVMDVVELITMMEEKFG---VSAAAAVAVAPGAAAEAAEEKTEFDVVLAS 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK++VESAP ++K G SKDEA  +KK LE+AGA+VE
Sbjct: 63  V--GGNKVAVIKAVRGATGLGLKEAKDMVESAPATIKEGASKDEAEALKKSLEEAGASVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|153952852|ref|YP_001393617.1| hypothetical protein CKL_0215 [Clostridium kluyveri DSM 555]
 gi|219853517|ref|YP_002470639.1| hypothetical protein CKR_0174 [Clostridium kluyveri NBRC 12016]
 gi|189042988|sp|A5N4N8|RL7_CLOK5 RecName: Full=50S ribosomal protein L7/L12
 gi|254806274|sp|B9DYA0|RL7_CLOK1 RecName: Full=50S ribosomal protein L7/L12
 gi|146345733|gb|EDK32269.1| RplL [Clostridium kluyveri DSM 555]
 gi|219567241|dbj|BAH05225.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 123

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 62/122 (50%), Positives = 84/122 (68%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  ++++E  EL K  E+E+GVSA+APV+V    AA  G AA EKTEF+VVLK 
Sbjct: 4   EEIIQAIKGMSVLELNELVKACEEEFGVSAAAPVAVAGGAAAGGGDAAEEKTEFDVVLKA 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIK VR +T LGLKEAK LV+ APK LK  +SK++A  +K K E+ GA +E
Sbjct: 64  --SGSEKIKVIKAVREVTGLGLKEAKALVDGAPKPLKEAVSKEDAEAIKAKFEEIGAEIE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|313887248|ref|ZP_07820942.1| ribosomal protein L7/L12 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923301|gb|EFR34116.1| ribosomal protein L7/L12 [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|332176996|gb|AEE12686.1| 50S ribosomal protein L7/L12 [Porphyromonas asaccharolytica DSM
           20707]
          Length = 124

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 84/126 (66%), Gaps = 2/126 (1%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M++I++I E L +LT+ E +EL + L++E+G+  +A    VA  AA A + A EKT F+V
Sbjct: 1   MADIKAIAETLVNLTVKEVSELKELLKEEYGIEPAAAAVAVAGPAAGAAAEAEEKTSFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VLK F     K+AV+K V+    LGLKEAKELV+ AP ++K G+ K  A  +K  LE+AG
Sbjct: 61  VLKSF--GAAKLAVVKAVKEHAGLGLKEAKELVDGAPTNVKEGVDKATAEALKAALEEAG 118

Query: 121 ATVELR 126
           A VEL+
Sbjct: 119 AEVELK 124


>gi|261417597|ref|YP_003251279.1| 50S ribosomal protein L7/L12 [Geobacillus sp. Y412MC61]
 gi|297528472|ref|YP_003669747.1| ribosomal protein L7/L12 [Geobacillus sp. C56-T3]
 gi|319765255|ref|YP_004130756.1| ribosomal protein L7/L12 [Geobacillus sp. Y412MC52]
 gi|261374054|gb|ACX76797.1| ribosomal protein L7/L12 [Geobacillus sp. Y412MC61]
 gi|297251724|gb|ADI25170.1| ribosomal protein L7/L12 [Geobacillus sp. C56-T3]
 gi|317110121|gb|ADU92613.1| ribosomal protein L7/L12 [Geobacillus sp. Y412MC52]
          Length = 122

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 90/122 (73%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA A +AA  KTEF+V+L  
Sbjct: 4   EQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGAEAAAE-KTEFDVIL-- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+LV++ PK +K G++K+EA E+K KLE+AGA VE
Sbjct: 61  ADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEEAEEIKAKLEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|288801080|ref|ZP_06406536.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332014|gb|EFC70496.1| ribosomal protein L7/L12 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 125

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 60/127 (47%), Positives = 86/127 (67%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I++I E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+A   EKT F+
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKEEYGIEPAAAAVAVAAGPAAAGAAGGEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL   D    K+ V+K V+    LGLKEAK+LV+ AP ++K GLSKDEA  +KK +E+A
Sbjct: 61  VVLT--DAGAAKLQVVKAVKEACGLGLKEAKDLVDGAPATIKEGLSKDEAENLKKAIEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|32307498|gb|AAP79154.1| ribosomal protein rpL12 [Bigelowiella natans]
          Length = 150

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 53/128 (41%), Positives = 82/128 (64%), Gaps = 6/128 (4%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTEF 58
           +  IVEKL +++LIEA++L K +E+ +GV ASA       +AA   +  +      K  F
Sbjct: 24  VSEIVEKLKTMSLIEASQLVKEIEETFGVDASAAAGGAVMMAAPGAAGGAAAEEEAKDSF 83

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V+L+G DD K ++A +K +R +T +GLKEAKE +   PK++K GLSKD+A E +K L +
Sbjct: 84  DVILEGVDDSK-RVAALKAIRGVTGVGLKEAKEFISGFPKAIKEGLSKDDAEEAQKSLAE 142

Query: 119 AGATVELR 126
           AG  V ++
Sbjct: 143 AGLKVIVK 150


>gi|320105625|ref|YP_004181215.1| 50S ribosomal protein L7/L12 [Terriglobus saanensis SP1PR4]
 gi|319924146|gb|ADV81221.1| ribosomal protein L7/L12 [Terriglobus saanensis SP1PR4]
          Length = 124

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 85/127 (66%), Gaps = 4/127 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I+ + +++ SL+L+EA+EL K+LE+  GVSA+A V+        A + A  EKTEF 
Sbjct: 1   MADIQQLEDQIVSLSLLEASELVKKLEERLGVSAAAAVAAAPAAGGGAAAPAAEEKTEFT 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK  D    KI+ IK VR  T LGLKEAK+LV+ APK +K  +SKDEA  + KK E  
Sbjct: 61  VILK--DAGANKISTIKAVREATALGLKEAKDLVDGAPKPIKENVSKDEAAAIAKKFEGI 118

Query: 120 GATVELR 126
            ATVE++
Sbjct: 119 -ATVEIK 124


>gi|229821636|ref|YP_002883162.1| ribosomal protein L7/L12 [Beutenbergia cavernae DSM 12333]
 gi|229567549|gb|ACQ81400.1| ribosomal protein L7/L12 [Beutenbergia cavernae DSM 12333]
          Length = 128

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 51/128 (39%), Positives = 78/128 (60%), Gaps = 2/128 (1%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  + ++E    LTLIE +E  K+ E+ + V+A+AP +V     A   +  +E+ + 
Sbjct: 1   MAKLSTDELIEAFKELTLIELSEFVKQFEETFEVTAAAPAAVAVAAPAGGAAEEAEEEKT 60

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           E  +        KIAVIKEVR IT LGLKEAK+LV+ APK +    +K+ A++ K+ LE 
Sbjct: 61  EFDVVLETVGSAKIAVIKEVRTITGLGLKEAKDLVDGAPKPVLEAATKEAADKAKEALEG 120

Query: 119 AGATVELR 126
           AGATV ++
Sbjct: 121 AGATVTVK 128


>gi|138893775|ref|YP_001124228.1| 50S ribosomal protein L7/L12 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196251114|ref|ZP_03149793.1| ribosomal protein L7/L12 [Geobacillus sp. G11MC16]
 gi|166222170|sp|A4IJH9|RL7_GEOTN RecName: Full=50S ribosomal protein L7/L12
 gi|134265288|gb|ABO65483.1| LSU ribosomal protein L12P (L7/L12) [Geobacillus
           thermodenitrificans NG80-2]
 gi|196209355|gb|EDY04135.1| ribosomal protein L7/L12 [Geobacillus sp. G11MC16]
          Length = 123

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 64/126 (50%), Positives = 88/126 (69%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M   E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA   +AA  KTEF+V
Sbjct: 1   MMTKEQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGGEAAAE-KTEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           +L   D   +KI VIK VR IT LGLKEAK+LV++ PK LK  +SK+EA E+K KLE+ G
Sbjct: 60  IL--ADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPLKEAVSKEEAEEIKAKLEEVG 117

Query: 121 ATVELR 126
           A VE++
Sbjct: 118 AKVEVK 123


>gi|49482770|ref|YP_039994.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257424654|ref|ZP_05601081.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257427322|ref|ZP_05603721.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257429958|ref|ZP_05606342.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257432660|ref|ZP_05609020.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257435564|ref|ZP_05611612.1| LSU ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           M876]
 gi|282903128|ref|ZP_06311019.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus C160]
 gi|282904918|ref|ZP_06312776.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282907868|ref|ZP_06315703.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910181|ref|ZP_06317985.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282913373|ref|ZP_06321162.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus M899]
 gi|282918328|ref|ZP_06326065.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282923290|ref|ZP_06330970.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           C101]
 gi|283957338|ref|ZP_06374791.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|293500419|ref|ZP_06666270.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293509364|ref|ZP_06668075.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           M809]
 gi|293523951|ref|ZP_06670638.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           M1015]
 gi|295427078|ref|ZP_06819714.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297590569|ref|ZP_06949208.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus MN8]
 gi|56749423|sp|Q6GJC8|RL7_STAAR RecName: Full=50S ribosomal protein L7/L12
 gi|49240899|emb|CAG39566.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257272224|gb|EEV04347.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257275515|gb|EEV06988.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257279155|gb|EEV09756.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257282075|gb|EEV12210.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284755|gb|EEV14874.1| LSU ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           M876]
 gi|282314158|gb|EFB44548.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           C101]
 gi|282317462|gb|EFB47834.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           C427]
 gi|282322405|gb|EFB52727.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus M899]
 gi|282325573|gb|EFB55881.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282328252|gb|EFB58530.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331743|gb|EFB61254.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282596083|gb|EFC01044.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus C160]
 gi|283790789|gb|EFC29604.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           A017934/97]
 gi|290920914|gb|EFD97975.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           M1015]
 gi|291095424|gb|EFE25685.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467461|gb|EFF09976.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           M809]
 gi|295128866|gb|EFG58496.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297576868|gb|EFH95583.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus MN8]
 gi|312439040|gb|ADQ78111.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           TCH60]
 gi|315193904|gb|EFU24298.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 122

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+    +A   V    AA    AA+EKTEF+V
Sbjct: 1   MANHEQIIETIKEMSVLELNDLVKAIEEEF--GVTAAAPVAVAGAAGGADAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  L K+EA ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|300742093|ref|ZP_07072114.1| ribosomal protein L7/L12 [Rothia dentocariosa M567]
 gi|311112011|ref|YP_003983233.1| ribosomal protein L7/L12 [Rothia dentocariosa ATCC 17931]
 gi|300381278|gb|EFJ77840.1| ribosomal protein L7/L12 [Rothia dentocariosa M567]
 gi|310943505|gb|ADP39799.1| ribosomal protein L7/L12 [Rothia dentocariosa ATCC 17931]
          Length = 125

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 64/123 (52%), Positives = 88/123 (71%), Gaps = 3/123 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           IE ++     L+L+E +E  K  E+E+ V+A+APV+VVA   A  G AA EK+EF+V+L+
Sbjct: 6   IEELIAAFKELSLVEVSEFVKAFEEEFDVTAAAPVAVVA-GGAGGGDAAEEKSEFDVILE 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                 KKIAVIKEVRA+T LGLKEAK+LV+ APK +  G SK++A + K++LE AGATV
Sbjct: 65  S--AGDKKIAVIKEVRALTSLGLKEAKDLVDGAPKPILEGASKEDAEKAKEQLEGAGATV 122

Query: 124 ELR 126
            L+
Sbjct: 123 TLK 125


>gi|14195108|sp|O99010|RK12_PROWI RecName: Full=50S ribosomal protein L12, plastid
          Length = 130

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 45/128 (35%), Positives = 75/128 (58%), Gaps = 5/128 (3%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPV----AAEAGSAASEKTE 57
           +    I+EKL ++TL+EA EL  ++EK +GV ASAP             +      EKT 
Sbjct: 3   ATTLEILEKLKAITLLEATELVSQIEKTFGVDASAPAVSGLRPILVEPIKQEDIIEEKTT 62

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLE 117
           F+V+L+      K++ ++K +RA+T L LK+AKE +   PK++  G+SK+E+   K++LE
Sbjct: 63  FDVILEEV-PSDKRVPILKVIRALTSLDLKQAKESITDLPKTILQGVSKEESEAAKQQLE 121

Query: 118 DAGATVEL 125
             G  +++
Sbjct: 122 AVGGKIKV 129


>gi|304557606|gb|ADM40270.1| LSU ribosomal protein L7/L12 (L23e) [Edwardsiella tarda FL6-60]
          Length = 122

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 84/122 (68%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ ++ +++++  EL   +E+++GVSA+A V+V    A  A  A  EKTEF+VVL  
Sbjct: 6   EQILDAVAEMSVMDVVELISMMEEKFGVSAAAAVAVA---AGGAAEAVEEKTEFDVVLTA 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK+LVESAP  LK  +SKD+A  +KK LE+AGA+VE
Sbjct: 63  --AGGNKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEAISKDDAEALKKTLEEAGASVE 120

Query: 125 LR 126
           ++
Sbjct: 121 VK 122


>gi|307946276|ref|ZP_07661611.1| ribosomal protein L7/L12 [Roseibium sp. TrichSKD4]
 gi|307769940|gb|EFO29166.1| ribosomal protein L7/L12 [Roseibium sp. TrichSKD4]
          Length = 125

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 82/127 (64%), Positives = 102/127 (80%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++E +VE+LS+LT++EAAELSK LE++WGVSA+APV+V A        AA  EKTEF+
Sbjct: 1   MADLEKLVEELSTLTVMEAAELSKLLEEKWGVSAAAPVAVAAVAGGADAGAAAEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL       KKI VIKEVRAIT LGLKEAKELVESAPK++K  +SKDEA E+KKKLE+A
Sbjct: 61  VVLAS--AGDKKINVIKEVRAITGLGLKEAKELVESAPKAVKEAVSKDEAEELKKKLEEA 118

Query: 120 GATVELR 126
           GA+VEL+
Sbjct: 119 GASVELK 125


>gi|225012653|ref|ZP_03703088.1| ribosomal protein L7/L12 [Flavobacteria bacterium MS024-2A]
 gi|225003186|gb|EEG41161.1| ribosomal protein L7/L12 [Flavobacteria bacterium MS024-2A]
          Length = 125

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 61/127 (48%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++   E+L +LT+ E  EL+  L+ E+G+  +A    VA  AA  G  A  EKTEF+
Sbjct: 1   MADLKEFAEQLVNLTVKEVNELANILKDEYGIEPAAAAVAVAGPAAAGGDDAGEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       K+AV+K V+ +T LGLKEAKELV+SAP  LK G++KDEA  + K LE+A
Sbjct: 61  VILKA--AGASKLAVVKLVKELTGLGLKEAKELVDSAPSPLKEGIAKDEAEALVKSLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|206602626|gb|EDZ39107.1| Ribosomal protein L7/L12 [Leptospirillum sp. Group II '5-way CG']
          Length = 128

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 65/124 (52%), Positives = 89/124 (71%), Gaps = 2/124 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVL 62
           ++ I+  + +LT++E   L K +E+++GVSA+APV+V A  AA A +AA  EKTEF+V+L
Sbjct: 6   VDEILTGIENLTVLELVGLIKNMEEKFGVSAAAPVAVAAAPAATAAAAATEEKTEFDVIL 65

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K      KKI +IK VR +T LGLKEAK+LVE APK LK G +K+EA  MK+KL  AGA 
Sbjct: 66  KSA-PADKKINIIKVVRELTSLGLKEAKDLVEGAPKPLKNGATKEEAASMKEKLTAAGAE 124

Query: 123 VELR 126
           VE++
Sbjct: 125 VEVK 128


>gi|116495724|ref|YP_807458.1| 50S ribosomal protein L7/L12 [Lactobacillus casei ATCC 334]
 gi|191639212|ref|YP_001988378.1| 50S ribosomal protein L7/L12 [Lactobacillus casei BL23]
 gi|227533716|ref|ZP_03963765.1| ribosomal protein L7/L12 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239630129|ref|ZP_04673160.1| ribosomal protein L7/L12 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|301067279|ref|YP_003789302.1| 50S ribosomal protein L7/L12 [Lactobacillus casei str. Zhang]
 gi|122262874|sp|Q035V6|RL7_LACC3 RecName: Full=50S ribosomal protein L7/L12
 gi|226733701|sp|B3WA01|RL7_LACCB RecName: Full=50S ribosomal protein L7/L12
 gi|116105874|gb|ABJ71016.1| LSU ribosomal protein L12P [Lactobacillus casei ATCC 334]
 gi|190713514|emb|CAQ67520.1| 50S ribosomal protein L7/L12 [Lactobacillus casei BL23]
 gi|227188700|gb|EEI68767.1| ribosomal protein L7/L12 [Lactobacillus paracasei subsp. paracasei
           ATCC 25302]
 gi|239527741|gb|EEQ66742.1| ribosomal protein L7/L12 [Lactobacillus paracasei subsp. paracasei
           8700:2]
 gi|300439686|gb|ADK19452.1| Ribosomal protein L7/L12 [Lactobacillus casei str. Zhang]
 gi|327383290|gb|AEA54766.1| hypothetical protein rplL [Lactobacillus casei LC2W]
 gi|327386473|gb|AEA57947.1| hypothetical protein rplL [Lactobacillus casei BD-II]
          Length = 122

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 49/124 (39%), Positives = 81/124 (65%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           +++ I+ +L   +++E  +L K +E E+GV A+APV      A  A  A +   +    +
Sbjct: 4   DVDGIIAQLKDASILELNDLVKSIEDEFGVKAAAPV-----AAGAAAGADAAAAKDTYDV 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           +  +  ++K+ VIK VR IT LGLK+AK +V++APK +K GLS+D+AN++K++LE  GAT
Sbjct: 59  ELTEAGQEKVKVIKAVREITGLGLKDAKGMVDAAPKVIKEGLSEDDANKLKEQLEGVGAT 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|68065716|ref|XP_674842.1| 50S ribosomal subunit protein L12 [Plasmodium berghei strain ANKA]
 gi|56493677|emb|CAH95665.1| 50S ribosomal subunit protein L12, putative [Plasmodium berghei]
          Length = 179

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 66/135 (48%), Gaps = 11/135 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTE----- 57
            ++ I+E L  LTL+EA+EL K++E  + V     +           + + +        
Sbjct: 45  KVDKIIESLKELTLLEASELVKKIEVTFSVDLKQNIGDNKDGQGNKQNESDKDANSENEE 104

Query: 58  ------FEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
                 ++++L+  +  KK   +        +L LK+AK+LV++ P +L   ++K+ A  
Sbjct: 105 EDENKVYDLILENVEPNKKIPIIKIVKEIKKELNLKQAKDLVDNLPHTLFEKINKETAEN 164

Query: 112 MKKKLEDAGATVELR 126
            KKKL +AG  V+L+
Sbjct: 165 WKKKLTEAGGIVKLK 179


>gi|312897636|ref|ZP_07757053.1| ribosomal protein L7/L12 [Megasphaera micronuciformis F0359]
 gi|310621269|gb|EFQ04812.1| ribosomal protein L7/L12 [Megasphaera micronuciformis F0359]
          Length = 123

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 61/122 (50%), Positives = 88/122 (72%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I++ +  +T++E +EL K +E+++GVSA+APV+V A  AA A +   EK++F+VVL  
Sbjct: 4   EEILQAIEGMTVLELSELVKDMEEKFGVSAAAPVAVAAAPAAGAAAGGEEKSDFDVVLAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VR +T LGLKEAK +V+ AP ++K G++K  A EMK KLE+AGA+VE
Sbjct: 64  --AGDKKINVIKVVRELTGLGLKEAKAMVDGAPATVKEGVAKAAAEEMKAKLEEAGASVE 121

Query: 125 LR 126
           L+
Sbjct: 122 LK 123


>gi|50289035|ref|XP_446947.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526256|emb|CAG59880.1| unnamed protein product [Candida glabrata]
          Length = 176

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 46/134 (34%), Positives = 70/134 (52%), Gaps = 12/134 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK------- 55
            I  IVE +S LTL+E + L   L+ +  +   +  +  +  AA     A++        
Sbjct: 43  KISKIVEDISKLTLLETSALVTELKSKLNIPDISFPAAGSAPAAAPADGAAKAEEAEEAK 102

Query: 56  ----TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANE 111
               T F + L+ F D K K  +IKE++ +  L L EAK+ VE+APK LK  ++KD+A +
Sbjct: 103 PEEKTVFGIKLESF-DAKSKAKIIKEIKGLLGLSLVEAKKFVEAAPKILKENVAKDDAEK 161

Query: 112 MKKKLEDAGATVEL 125
           +K  LE  GA V L
Sbjct: 162 IKTTLEGLGAKVSL 175


>gi|266621458|ref|ZP_06114393.1| ribosomal protein L7/L12 [Clostridium hathewayi DSM 13479]
 gi|288866899|gb|EFC99197.1| ribosomal protein L7/L12 [Clostridium hathewayi DSM 13479]
          Length = 124

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 56/128 (43%), Positives = 78/128 (60%), Gaps = 6/128 (4%)

Query: 1   MSNIE--SIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     +E +  L+++E  +L K  E+E+GVSA+A V V    A    +A  EKTEF
Sbjct: 1   MAKLTTAEFIEAIKELSVLELNDLVKACEEEFGVSAAAGVVVA--AAGAGAAAEEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L        K+ VIK VR  T LGLKEAK++V+SAPK +K G SK+EA ++K  LE 
Sbjct: 59  DVELTEV--GPNKVKVIKVVREATGLGLKEAKDVVDSAPKVVKAGASKEEAEQIKASLEA 116

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 117 EGAKVTLK 124


>gi|238897914|ref|YP_002923593.1| 50S ribosomal subunit protein L7/L12 [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
 gi|259491649|sp|C4K4F2|RL7_HAMD5 RecName: Full=50S ribosomal protein L7/L12
 gi|229465671|gb|ACQ67445.1| 50S ribosomal subunit protein L7/L12 [Candidatus Hamiltonella
           defensa 5AT (Acyrthosiphon pisum)]
          Length = 124

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 83/124 (66%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
            +  I   +  +T+    +L   +EKE+GVSA+A V+V     A    A  EKTEF+V+L
Sbjct: 7   KLVDITNSIREMTITNVLDLISIMEKEFGVSAAAAVAVA----AAPAEAVEEKTEFDVIL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K F   + K+AVIK VR  T LGLKEAKELVE+APK++K G++K+EA  +KK LE+AGA 
Sbjct: 63  KSF--GENKVAVIKAVRGATGLGLKEAKELVEAAPKNVKEGINKEEAESLKKTLEEAGAD 120

Query: 123 VELR 126
           V+++
Sbjct: 121 VDIK 124


>gi|37521171|ref|NP_924548.1| 50S ribosomal protein L7/L12 [Gloeobacter violaceus PCC 7421]
 gi|81710263|sp|Q7NK76|RL7_GLOVI RecName: Full=50S ribosomal protein L7/L12
 gi|35212167|dbj|BAC89543.1| 50S ribosomal protein L12 [Gloeobacter violaceus PCC 7421]
          Length = 137

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 59/133 (44%), Positives = 83/133 (62%), Gaps = 11/133 (8%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE--------- 54
           +E I+E L +L+L+EAAEL K +E+ +GV A AP      V       A           
Sbjct: 6   VEKILEDLKALSLLEAAELVKGIEEVFGVKAEAPAGGGMMVMPGVMPGAPAAAAPAEPVE 65

Query: 55  -KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
            +TEF V+L+      KKIA++K  R IT LGLKEAK+LVE+APK++K G++KD+A  +K
Sbjct: 66  EQTEFTVMLEEV-PADKKIAILKVAREITGLGLKEAKDLVEAAPKAVKEGVNKDDAATIK 124

Query: 114 KKLEDAGATVELR 126
           KKLE+AGA   ++
Sbjct: 125 KKLEEAGAKASIK 137


>gi|320532561|ref|ZP_08033368.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 171 str.
           F0337]
 gi|320135232|gb|EFW27373.1| ribosomal protein L7/L12 [Actinomyces sp. oral taxon 171 str.
           F0337]
          Length = 129

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 60/131 (45%), Positives = 84/131 (64%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS---EK 55
           M+ +  E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A    +   EK
Sbjct: 1   MAKLTTEELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGDEAAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+V+L+      KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++
Sbjct: 61  DEFDVILEA--AGDKKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKEAAEKAKEQ 118

Query: 116 LEDAGATVELR 126
           LE AGATV L+
Sbjct: 119 LEGAGATVTLK 129


>gi|254461215|ref|ZP_05074631.1| ribosomal protein L7/L12 [Rhodobacterales bacterium HTCC2083]
 gi|206677804|gb|EDZ42291.1| ribosomal protein L7/L12 [Rhodobacteraceae bacterium HTCC2083]
          Length = 125

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 64/127 (50%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++++ + E++  LTL+EA EL   L+ E+G+  +A  +VV     +AG AA  E+TEF+
Sbjct: 1   MADLKKLAEEIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAGGDAGGAAAEEQTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK       KI VIKEVRAIT LGLKEAKELVE+  K++K G+SK+EA ++K KLE A
Sbjct: 61  VILKA--AGASKINVIKEVRAITGLGLKEAKELVEAGGKAVKEGVSKEEAEDVKGKLEAA 118

Query: 120 GATVELR 126
           GA VE++
Sbjct: 119 GAEVEVK 125


>gi|330814207|ref|YP_004358446.1| LSU ribosomal protein L7/L12 (P1/P2) [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487302|gb|AEA81707.1| LSU ribosomal protein L7/L12 (P1/P2) [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 123

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 84/126 (66%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  IVE LS LT++EAAELSK LE++W    +A    VA   A  G AA EKT+F V
Sbjct: 1   MTDLNKIVEDLSKLTVVEAAELSKTLEEKW-GVTAAAPVAVAAAGAAGGEAAEEKTDFTV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL        KI  IKEVRA T LGLKEAK+LVE+APK LK G++K +A E++KK    G
Sbjct: 60  VLTA--AGDNKIGAIKEVRAFTGLGLKEAKDLVEAAPKELKQGVAKKDAEELQKKFAAIG 117

Query: 121 ATVELR 126
           A VEL+
Sbjct: 118 AKVELK 123


>gi|226942769|ref|YP_002797842.1| 50S ribosomal protein L7/L12 [Azotobacter vinelandii DJ]
 gi|259491638|sp|C1DKK4|RL7_AZOVD RecName: Full=50S ribosomal protein L7/L12
 gi|226717696|gb|ACO76867.1| 50S ribosomal protein L7/L12 [Azotobacter vinelandii DJ]
          Length = 122

 Score = 78.0 bits (191), Expect = 4e-13,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 81/122 (66%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  +S +++++  EL K +E+++GV+A+A V+      A A   A E+TEF VVL  
Sbjct: 6   EDIINAVSEMSVMQIVELIKAMEEKFGVTAAAAVAAG---PAAAAPVAEEQTEFTVVLA- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   KK+ VIK VR +T LGLKEAK +V+ AP  +K G+SKDEA   KK LE+AGA VE
Sbjct: 62  -EAGDKKVNVIKVVRELTGLGLKEAKAVVDGAPGVVKEGISKDEAEAAKKALEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|213693116|ref|YP_002323702.1| ribosomal protein L7/L12 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|296454903|ref|YP_003662047.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|254806262|sp|B7GNG8|RL7_BIFLI RecName: Full=50S ribosomal protein L7/L12
 gi|213524577|gb|ACJ53324.1| ribosomal protein L7/L12 [Bifidobacterium longum subsp. infantis
           ATCC 15697]
 gi|296184335|gb|ADH01217.1| ribosomal protein L7/L12 [Bifidobacterium longum subsp. longum
           JDM301]
 gi|320459294|dbj|BAJ69915.1| 50S ribosomal protein L7/L12 [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 126

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 57/122 (46%), Positives = 80/122 (65%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + ++E    +TL+E +E  K  E+++ V A+APV+ VA VA  A  A  EK EF+V+L  
Sbjct: 7   DELLEAFGEMTLVELSEFVKAFEEKFDVEAAAPVAAVAAVAGAAAPAEEEKDEFDVILSA 66

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KKI VIK VRAIT LGL EAK LV+ APK++     K++A + K +LE+AGA+VE
Sbjct: 67  V--GDKKIQVIKAVRAITSLGLAEAKALVDGAPKAVLEKAKKEDAEKAKAQLEEAGASVE 124

Query: 125 LR 126
           L+
Sbjct: 125 LK 126


>gi|121609222|ref|YP_997029.1| 50S ribosomal protein L7/L12 [Verminephrobacter eiseniae EF01-2]
 gi|166222224|sp|A1WK54|RL7_VEREI RecName: Full=50S ribosomal protein L7/L12
 gi|121553862|gb|ABM58011.1| LSU ribosomal protein L12P [Verminephrobacter eiseniae EF01-2]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 53/124 (42%), Positives = 80/124 (64%), Gaps = 3/124 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + +  +  L S+T++E  +L K +E+++GVSA+A  +  A  +    +   EKTEF V+L
Sbjct: 4   DKDVFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAA-ASGPGAAVVEEKTEFNVLL 62

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K++VIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL DAGA 
Sbjct: 63  T--EAGANKVSVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLLDAGAK 120

Query: 123 VELR 126
            EL+
Sbjct: 121 AELK 124


>gi|56477586|ref|YP_159175.1| 50S ribosomal protein L7/L12 [Aromatoleum aromaticum EbN1]
 gi|81598746|sp|Q5P340|RL7_AZOSE RecName: Full=50S ribosomal protein L7/L12
 gi|56313629|emb|CAI08274.1| 50S ribosomal protein L7/L12 [Aromatoleum aromaticum EbN1]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 86/122 (70%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + S+T++E  +L K  E+++G  ++A ++V AP A  A +   EKTEF+V+L  
Sbjct: 6   EDILEAVGSMTVMELNDLVKAFEEKFG-VSAASMAVAAPGAGAAAAPVEEKTEFDVIL-- 62

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+  IK VRA T LGLKEAK+LV+ APK++K G+SK +A  +KK+LEDAGA VE
Sbjct: 63  LAAGEKKVEAIKVVRAATGLGLKEAKDLVDGAPKAVKEGISKADAEAIKKQLEDAGAKVE 122

Query: 125 LR 126
           ++
Sbjct: 123 IK 124


>gi|224133546|ref|XP_002321601.1| predicted protein [Populus trichocarpa]
 gi|222868597|gb|EEF05728.1| predicted protein [Populus trichocarpa]
          Length = 195

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 49/133 (36%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG----------SAA 52
            I  I E++++L   E +++   L  +       P+S         G             
Sbjct: 63  KIIEIAERIAALPPEERSQIGSALGYKLKHPKLQPISTEGMGLGSQGGEAAAGAAKVEEK 122

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F+V L+ FD    KI VIKEVRA T+LGLKEAK+LVE  P  LK G++KDEAN +
Sbjct: 123 KEKTAFDVKLEKFDAAA-KIKVIKEVRAFTNLGLKEAKDLVEKVPCVLKQGVTKDEANGI 181

Query: 113 KKKLEDAGATVEL 125
            +K++ AG    +
Sbjct: 182 IEKIKAAGGVAVM 194


>gi|121596185|ref|YP_988081.1| 50S ribosomal protein L7/L12 [Acidovorax sp. JS42]
 gi|166222128|sp|A1WCN0|RL7_ACISJ RecName: Full=50S ribosomal protein L7/L12
 gi|120608265|gb|ABM44005.1| LSU ribosomal protein L12P [Acidovorax sp. JS42]
          Length = 126

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 59/125 (47%), Positives = 85/125 (68%), Gaps = 3/125 (2%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVV 61
           + ++ +  L S+T++E  +L + +E+++GVSA+A  +  A  AA  G+AA  EKTEF VV
Sbjct: 4   DKDAFLTALDSMTVLELNDLVEAIEEKFGVSAAAMAAPAAGGAAGGGAAAAEEKTEFNVV 63

Query: 62  LKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGA 121
           L   D    K+AVIK VR IT LGLKEAK+LV+ APK++K G++K +A    KKL +AGA
Sbjct: 64  LA--DAGANKVAVIKAVREITGLGLKEAKDLVDGAPKNVKEGIAKADAEAAVKKLVEAGA 121

Query: 122 TVELR 126
             EL+
Sbjct: 122 KAELK 126


>gi|325067667|ref|ZP_08126340.1| 50S ribosomal protein L7/L12 [Actinomyces oris K20]
          Length = 129

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 60/131 (45%), Positives = 83/131 (63%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA---SEK 55
           M+ +  E ++E+   LTLIE +E  K  E+ + V+A+AP +V    A  A        EK
Sbjct: 1   MAKLTTEELIEQFKELTLIELSEFVKAFEETFDVTAAAPAAVAVAAAPGAAGGDAAAEEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
            EF+V+L+      KKI VIKEVRA+T LGLKEAKELV+ APK +  G +K+ A + K++
Sbjct: 61  DEFDVILEA--AGDKKIQVIKEVRALTSLGLKEAKELVDGAPKPVLEGANKEAAEKAKEQ 118

Query: 116 LEDAGATVELR 126
           LE AGATV L+
Sbjct: 119 LEGAGATVTLK 129


>gi|15923530|ref|NP_371064.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|15926218|ref|NP_373751.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           N315]
 gi|21282224|ref|NP_645312.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49485405|ref|YP_042626.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57651416|ref|YP_185472.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           COL]
 gi|87161455|ref|YP_493228.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|88194302|ref|YP_499094.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           NCTC 8325]
 gi|148267000|ref|YP_001245943.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           JH9]
 gi|150393047|ref|YP_001315722.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           JH1]
 gi|156978869|ref|YP_001441128.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|161508780|ref|YP_001574439.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|221141023|ref|ZP_03565516.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           str. JKD6009]
 gi|253315650|ref|ZP_04838863.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           str. CF-Marseille]
 gi|253731145|ref|ZP_04865310.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253732548|ref|ZP_04866713.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|255005334|ref|ZP_05143935.2| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Mu50-omega]
 gi|257795361|ref|ZP_05644340.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A9781]
 gi|258408952|ref|ZP_05681233.1| 50S ribosomal protein L12 [Staphylococcus aureus A9763]
 gi|258420410|ref|ZP_05683353.1| LSU ribosomal protein L7/L12 [Staphylococcus aureus A9719]
 gi|258422613|ref|ZP_05685519.1| LSU ribosomal protein L7/L12 [Staphylococcus aureus A9635]
 gi|258439331|ref|ZP_05690263.1| ribosomal protein L7/L12 [Staphylococcus aureus A9299]
 gi|258444071|ref|ZP_05692408.1| ribosomal protein L7/L12 [Staphylococcus aureus A8115]
 gi|258446339|ref|ZP_05694497.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A6300]
 gi|258448432|ref|ZP_05696547.1| ribosomal protein L7/L12 [Staphylococcus aureus A6224]
 gi|258452727|ref|ZP_05700725.1| LSU ribosomal protein L12P [Staphylococcus aureus A5948]
 gi|258453788|ref|ZP_05701762.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A5937]
 gi|262049583|ref|ZP_06022452.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus D30]
 gi|262052428|ref|ZP_06024628.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus 930918-3]
 gi|269202163|ref|YP_003281432.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|282894975|ref|ZP_06303198.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A8117]
 gi|282915863|ref|ZP_06323628.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282924454|ref|ZP_06332126.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A9765]
 gi|282928877|ref|ZP_06336468.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A10102]
 gi|283769696|ref|ZP_06342588.1| rpl12 ribosomal protein L12 [Staphylococcus aureus subsp. aureus
           H19]
 gi|284023550|ref|ZP_06377948.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           132]
 gi|294850316|ref|ZP_06791050.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A9754]
 gi|295406917|ref|ZP_06816720.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A8819]
 gi|296275786|ref|ZP_06858293.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MR1]
 gi|297208746|ref|ZP_06925174.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297246259|ref|ZP_06930108.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A8796]
 gi|300912836|ref|ZP_07130278.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|304381861|ref|ZP_07364508.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|54039229|sp|P66062|RL7_STAAW RecName: Full=50S ribosomal protein L7/L12
 gi|54039238|sp|P99154|RL7_STAAN RecName: Full=50S ribosomal protein L7/L12
 gi|54041599|sp|P66061|RL7_STAAM RecName: Full=50S ribosomal protein L7/L12
 gi|56749394|sp|Q6GBU7|RL7_STAAS RecName: Full=50S ribosomal protein L7/L12
 gi|81695153|sp|Q5HID5|RL7_STAAC RecName: Full=50S ribosomal protein L7/L12
 gi|109893804|sp|Q2FJA0|RL7_STAA3 RecName: Full=50S ribosomal protein L7/L12
 gi|109940147|sp|P48860|RL7_STAA8 RecName: Full=50S ribosomal protein L7/L12
 gi|166222215|sp|A7WYW4|RL7_STAA1 RecName: Full=50S ribosomal protein L7/L12
 gi|189043013|sp|A6TZ17|RL7_STAA2 RecName: Full=50S ribosomal protein L7/L12
 gi|189043014|sp|A5IQ94|RL7_STAA9 RecName: Full=50S ribosomal protein L7/L12
 gi|189043015|sp|A8YZN8|RL7_STAAT RecName: Full=50S ribosomal protein L7/L12
 gi|13700431|dbj|BAB41729.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           N315]
 gi|14246308|dbj|BAB56702.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Mu50]
 gi|21203660|dbj|BAB94360.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MW2]
 gi|49243848|emb|CAG42273.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57285602|gb|AAW37696.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus COL]
 gi|87127429|gb|ABD21943.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           USA300_FPR3757]
 gi|87201860|gb|ABD29670.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus NCTC
           8325]
 gi|147740069|gb|ABQ48367.1| LSU ribosomal protein L12P [Staphylococcus aureus subsp. aureus
           JH9]
 gi|149945499|gb|ABR51435.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus JH1]
 gi|156721004|dbj|BAF77421.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           Mu3]
 gi|160367589|gb|ABX28560.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253725110|gb|EES93839.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|253729477|gb|EES98206.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           TCH130]
 gi|257789333|gb|EEV27673.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A9781]
 gi|257840303|gb|EEV64766.1| 50S ribosomal protein L12 [Staphylococcus aureus A9763]
 gi|257843600|gb|EEV68006.1| LSU ribosomal protein L7/L12 [Staphylococcus aureus A9719]
 gi|257847185|gb|EEV71193.1| LSU ribosomal protein L7/L12 [Staphylococcus aureus A9635]
 gi|257847668|gb|EEV71667.1| ribosomal protein L7/L12 [Staphylococcus aureus A9299]
 gi|257850741|gb|EEV74686.1| ribosomal protein L7/L12 [Staphylococcus aureus A8115]
 gi|257854933|gb|EEV77878.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A6300]
 gi|257858301|gb|EEV81188.1| ribosomal protein L7/L12 [Staphylococcus aureus A6224]
 gi|257859600|gb|EEV82450.1| LSU ribosomal protein L12P [Staphylococcus aureus A5948]
 gi|257864044|gb|EEV86798.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A5937]
 gi|259159674|gb|EEW44718.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus 930918-3]
 gi|259162323|gb|EEW46896.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus D30]
 gi|262074453|gb|ACY10426.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           ED98]
 gi|269940113|emb|CBI48489.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282320159|gb|EFB50504.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           D139]
 gi|282589485|gb|EFB94574.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A10102]
 gi|282592865|gb|EFB97869.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A9765]
 gi|282762657|gb|EFC02794.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A8117]
 gi|283459843|gb|EFC06933.1| rpl12 ribosomal protein L12 [Staphylococcus aureus subsp. aureus
           H19]
 gi|283469832|emb|CAQ49043.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           ST398]
 gi|285816241|gb|ADC36728.1| LSU ribosomal protein L7/L12 (L23e) [Staphylococcus aureus
           04-02981]
 gi|294822828|gb|EFG39263.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A9754]
 gi|294968148|gb|EFG44174.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A8819]
 gi|296886691|gb|EFH25596.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus ATCC
           51811]
 gi|297176857|gb|EFH36115.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus A8796]
 gi|298693871|gb|ADI97093.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           ED133]
 gi|300885940|gb|EFK81143.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           TCH70]
 gi|302332253|gb|ADL22446.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           JKD6159]
 gi|302750431|gb|ADL64608.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           str. JKD6008]
 gi|304339647|gb|EFM05594.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|312829036|emb|CBX33878.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus ECT-R
           2]
 gi|315128833|gb|EFT84832.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           CGS03]
 gi|315196648|gb|EFU26995.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           CGS01]
 gi|320141595|gb|EFW33434.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320141776|gb|EFW33604.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323439810|gb|EGA97527.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus O11]
 gi|323443088|gb|EGB00708.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus O46]
 gi|329313260|gb|AEB87673.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727908|gb|EGG64357.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           21172]
 gi|329731054|gb|EGG67427.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           21189]
 gi|329731990|gb|EGG68346.1| ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           21193]
          Length = 122

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 55/126 (43%), Positives = 81/126 (64%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+    +A   V    AA    AA+EKTEF+V
Sbjct: 1   MANHEQIIEAIKEMSVLELNDLVKAIEEEF--GVTAAAPVAVAGAAGGADAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  L K+EA ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVEL+
Sbjct: 117 ATVELK 122


>gi|51244968|ref|YP_064852.1| 50S ribosomal protein L7 /L12 [Desulfotalea psychrophila LSv54]
 gi|81642550|sp|Q6AP79|RL7_DESPS RecName: Full=50S ribosomal protein L7/L12
 gi|50876005|emb|CAG35845.1| probable 50S ribosomal protein L7 /L12 [Desulfotalea psychrophila
           LSv54]
          Length = 123

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 64/122 (52%), Positives = 87/122 (71%), Gaps = 4/122 (3%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E +++ ++ ++++E +EL    E+++GVSA+APV+V    A  A  A  EKTEF+V+L  
Sbjct: 6   EDVIDFIAGMSVLELSELIGEFEEKFGVSAAAPVAVA--AAGVAAEAVEEKTEFDVILAS 63

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                +KI VIKEVRAIT LGLKEAK LVESAP +LK G+SKDEA E+K KLE  GAT E
Sbjct: 64  --AGSEKIKVIKEVRAITGLGLKEAKSLVESAPAALKEGVSKDEAAELKAKLEAVGATAE 121

Query: 125 LR 126
           ++
Sbjct: 122 VK 123


>gi|269926925|ref|YP_003323548.1| ribosomal protein L7/L12 [Thermobaculum terrenum ATCC BAA-798]
 gi|269790585|gb|ACZ42726.1| ribosomal protein L7/L12 [Thermobaculum terrenum ATCC BAA-798]
          Length = 133

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 59/126 (46%), Positives = 85/126 (67%), Gaps = 6/126 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEK----TEFEV 60
           E I++ + ++T++E ++L K LE+ +GV+A APV+     AA   +A +E+    TEF+V
Sbjct: 10  EEIIQAIENMTVLELSQLVKALEERFGVTAVAPVAAAGVAAAPGAAAPAEEQEEQTEFDV 69

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL   D    KIAVIK VR +T LGLKEAK+LVESAP  +K G+SK+EA     KL++AG
Sbjct: 70  VLT--DVGANKIAVIKAVRELTSLGLKEAKDLVESAPAPVKQGVSKEEAQAAVAKLQEAG 127

Query: 121 ATVELR 126
           A  E++
Sbjct: 128 AKAEMK 133


>gi|254465953|ref|ZP_05079364.1| ribosomal protein L7/L12 [Rhodobacterales bacterium Y4I]
 gi|206686861|gb|EDZ47343.1| ribosomal protein L7/L12 [Rhodobacterales bacterium Y4I]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 64/126 (50%), Positives = 85/126 (67%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSA-SAPVSVVAPVAAEAGSAASEKTEFE 59
           M++++++ E +  LTL+EA EL   L+ E+G+   +    V+A      G+A  EKTEF+
Sbjct: 1   MADLKALAESIVGLTLLEAQELKTILKDEYGIEPAAGGAVVMAAAGDAGGAAEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK  +    KI VIKEVR IT LGLKEAKELVE+  K +K G+SKDEA ++K KLE A
Sbjct: 61  VVLK--NAGASKINVIKEVRGITGLGLKEAKELVEAGGK-IKEGVSKDEAEDIKGKLEAA 117

Query: 120 GATVEL 125
           GA VEL
Sbjct: 118 GAEVEL 123


>gi|169837724|ref|ZP_02870912.1| LSU ribosomal protein L12P (L7/L12) [candidate division TM7
           single-cell isolate TM7a]
          Length = 122

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 63/124 (50%), Positives = 85/124 (68%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E  +E L +++++E  E+ + +E+ +GVSA           A AG+AA EKTEF+VVL
Sbjct: 4   NKEQFIEDLKAMSVLELKEVVEAIEETFGVSAQPVAVAG---GAAAGAAAEEKTEFDVVL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                   K+AVIKEVR IT LGLKEAKELVE+  K++K G+SK+EA E+K KLE AGAT
Sbjct: 61  --VSAGGAKLAVIKEVRGITGLGLKEAKELVEAGGKAVKEGVSKEEAEEIKGKLEAAGAT 118

Query: 123 VELR 126
           VE++
Sbjct: 119 VEVK 122


>gi|156084081|ref|XP_001609524.1| ribosomal protein L7/L12 [Babesia bovis T2Bo]
 gi|154796775|gb|EDO05956.1| ribosomal protein L7/L12 [Babesia bovis]
          Length = 221

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 48/163 (29%), Positives = 77/163 (47%), Gaps = 42/163 (25%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWG-------------------------------- 31
           +  +V+++ +LTLIE+A+L    ++                                   
Sbjct: 59  VIRLVDEILNLTLIESADLCDLCQERLAGPNVNGGFIPGRSPFPHPHTFFSGVGMMPERL 118

Query: 32  ---------VSASAPVSVVAPVAAEAGSAASEKTEFEVVLKGFDDPKKKIAVIKEVRAIT 82
                    V+A+   +   P      +  ++K+   + L GFD  K KIA+IK VR IT
Sbjct: 119 SPMGVMPQPVAATVETAEPPPAETPQPTKPAQKSTGTLTLVGFDATK-KIALIKLVRTIT 177

Query: 83  DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVEL 125
            LGL+E+KELVESAP+ LK  L  +E  ++ + LE AGAT+++
Sbjct: 178 GLGLRESKELVESAPRQLKKDLPLEEVQKLAQDLEAAGATIKI 220


>gi|323344619|ref|ZP_08084843.1| 50S ribosomal protein L7/L12 [Prevotella oralis ATCC 33269]
 gi|323093889|gb|EFZ36466.1| 50S ribosomal protein L7/L12 [Prevotella oralis ATCC 33269]
          Length = 125

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 58/127 (45%), Positives = 83/127 (65%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M++I++I E+L +LT+ E  EL+  L+ E+G+  +A    VA   A   +AA  EKT F+
Sbjct: 1   MADIKAIAEELVNLTVKEVNELATVLKDEYGIEPAAAAVAVAAGPAAGDAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVL        K+ V+K V+    LGLKEAK+LV+ AP ++K GLSKDEA  +KK +E+A
Sbjct: 61  VVLAEV--GATKLQVVKAVKEACGLGLKEAKDLVDGAPATIKEGLSKDEAENLKKAIEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|28377498|ref|NP_784390.1| ribosomal protein L12/L7 [Lactobacillus plantarum WCFS1]
 gi|254555728|ref|YP_003062145.1| ribosomal protein L12/L7 [Lactobacillus plantarum JDM1]
 gi|308179709|ref|YP_003923837.1| ribosomal protein L12/L7 [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|81632013|sp|Q88YW7|RL7_LACPL RecName: Full=50S ribosomal protein L7/L12
 gi|28270330|emb|CAD63231.1| ribosomal protein L12/L7 [Lactobacillus plantarum WCFS1]
 gi|254044655|gb|ACT61448.1| ribosomal protein L12/L7 [Lactobacillus plantarum JDM1]
 gi|308045200|gb|ADN97743.1| ribosomal protein L12/L7 [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 122

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 52/124 (41%), Positives = 80/124 (64%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++I++ L   ++ +  +L K +E+E+ VSASAPV+V     A  G AA+ K  ++V L
Sbjct: 4   DKDAIIDSLKEASISDLNDLVKAIEEEFDVSASAPVAVA---GAAGGDAAAAKDSYDVEL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +   +K+  IK VR IT LGLK+AK LV++ P  +K G+S+DEAN+MK KLE+ G  
Sbjct: 61  T--ESGDQKVKAIKAVRDITGLGLKDAKGLVDNVPSIIKEGVSEDEANDMKAKLEEVGGV 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|225420368|ref|ZP_03762671.1| hypothetical protein CLOSTASPAR_06713 [Clostridium asparagiforme
           DSM 15981]
 gi|225040987|gb|EEG51233.1| hypothetical protein CLOSTASPAR_06713 [Clostridium asparagiforme
           DSM 15981]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 60/128 (46%), Positives = 83/128 (64%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     +E +  L+++E  +L K  E+E+GVSA+A V V    A  A +A  EKTEF
Sbjct: 1   MAKLTTAEFIEAIKELSVLELNDLVKACEEEFGVSAAAGVVVA--AAGGAAAAEEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L        K+ VIK VR  T LGLKEAKE+V+SAPK++K+G+SK+EA E+K KLE 
Sbjct: 59  DVELTEV--GPNKVKVIKVVREATGLGLKEAKEVVDSAPKAVKSGVSKEEAEELKTKLEA 116

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 117 EGAKVTLK 124


>gi|92112546|ref|YP_572474.1| 50S ribosomal protein L12P [Chromohalobacter salexigens DSM 3043]
 gi|122990613|sp|Q1R0I3|RL7_CHRSD RecName: Full=50S ribosomal protein L7/L12
 gi|91795636|gb|ABE57775.1| LSU ribosomal protein L12P [Chromohalobacter salexigens DSM 3043]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 55/122 (45%), Positives = 80/122 (65%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ ++++E AEL   +E+++   ++A   V  P A   G AA E+TEF++VL G
Sbjct: 6   EDIINAVAEMSVMEVAELISAMEEKF-GVSAAAAVVAGPGAGGEGEAAEEQTEFDLVLTG 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                KK+ VIK VR IT LGLKEAK  V+  P +LK G+SK++A   K KLE+AGA+VE
Sbjct: 65  --AGDKKVNVIKVVREITGLGLKEAKGAVDGVPATLKEGMSKEDAEAAKTKLEEAGASVE 122

Query: 125 LR 126
           L+
Sbjct: 123 LK 124


>gi|262340956|ref|YP_003283811.1| 50S ribosomal protein L7+L12 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
 gi|262272293|gb|ACY40201.1| 50S ribosomal protein L7+L12 [Blattabacterium sp. (Blattella
           germanica) str. Bge]
          Length = 123

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 47/124 (37%), Positives = 74/124 (59%), Gaps = 3/124 (2%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV-SVVAPVAAEAGSAASEKTEFEVVL 62
           IE + E+L +LT+ +  EL+  L+K++G+  S+ V S       E  S   EK  F ++L
Sbjct: 2   IEKLAEQLVNLTVKQVNELALILKKKYGIEPSSLVKSENLSSQEEKISKKEEKNIFNIIL 61

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
           K       K++V+K V+  T  GLKE+K+LV++ P  LK  ++K EA ++K K E+ GA 
Sbjct: 62  KS--SGNSKLSVVKLVKETTGKGLKESKDLVDNIPSVLKESVNKKEAEDLKNKFEEIGAE 119

Query: 123 VELR 126
           VEL+
Sbjct: 120 VELK 123


>gi|227874630|ref|ZP_03992793.1| 50S ribosomal protein L7/L12 [Mobiluncus mulieris ATCC 35243]
 gi|269977571|ref|ZP_06184538.1| ribosomal protein L7/L12 [Mobiluncus mulieris 28-1]
 gi|306817914|ref|ZP_07451653.1| ribosomal protein L7/L12 [Mobiluncus mulieris ATCC 35239]
 gi|307701288|ref|ZP_07638309.1| ribosomal protein L7/L12 [Mobiluncus mulieris FB024-16]
 gi|227844839|gb|EEJ54985.1| 50S ribosomal protein L7/L12 [Mobiluncus mulieris ATCC 35243]
 gi|269934174|gb|EEZ90741.1| ribosomal protein L7/L12 [Mobiluncus mulieris 28-1]
 gi|304649393|gb|EFM46679.1| ribosomal protein L7/L12 [Mobiluncus mulieris ATCC 35239]
 gi|307613449|gb|EFN92697.1| ribosomal protein L7/L12 [Mobiluncus mulieris FB024-16]
          Length = 129

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 49/131 (37%), Positives = 84/131 (64%), Gaps = 7/131 (5%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---K 55
           M+ +  + +++    +TLIE ++  K+ E+ + V+A+AP +V     A  G        K
Sbjct: 1   MAKMTADELIDVFKEMTLIEISDFVKKFEEVFDVTAAAPAAVAVAAPAAGGDEGGAADEK 60

Query: 56  TEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKK 115
           TEF+V+L+  +    K+ VIK V+++T LGLKEAK+LV++APK +  G+ K+EA++ K +
Sbjct: 61  TEFDVILE--NPGAGKVPVIKVVKSLTGLGLKEAKDLVDNAPKPILEGVKKEEADKAKAE 118

Query: 116 LEDAGATVELR 126
           LE+AGA V ++
Sbjct: 119 LEEAGAEVTVK 129


>gi|15901208|ref|NP_345812.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae TIGR4]
 gi|111656889|ref|ZP_01407720.1| hypothetical protein SpneT_02001861 [Streptococcus pneumoniae
           TIGR4]
 gi|116516621|ref|YP_816654.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae D39]
 gi|148985699|ref|ZP_01818853.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP3-BS71]
 gi|148989470|ref|ZP_01820829.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP6-BS73]
 gi|148993090|ref|ZP_01822684.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP9-BS68]
 gi|148997595|ref|ZP_01825200.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP11-BS70]
 gi|149002720|ref|ZP_01827652.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP14-BS69]
 gi|149006998|ref|ZP_01830667.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP18-BS74]
 gi|149011585|ref|ZP_01832781.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP19-BS75]
 gi|149019305|ref|ZP_01834667.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP23-BS72]
 gi|161410745|ref|NP_358804.2| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae R6]
 gi|168484617|ref|ZP_02709569.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC1873-00]
 gi|168487610|ref|ZP_02712118.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC1087-00]
 gi|168490386|ref|ZP_02714585.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP195]
 gi|168491255|ref|ZP_02715398.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC0288-04]
 gi|168493255|ref|ZP_02717398.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC3059-06]
 gi|168575813|ref|ZP_02721728.1| ribosomal protein L7/L12 [Streptococcus pneumoniae MLV-016]
 gi|169833159|ref|YP_001694789.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae
           Hungary19A-6]
 gi|194398613|ref|YP_002038002.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae G54]
 gi|221232096|ref|YP_002511249.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae ATCC 700669]
 gi|225854802|ref|YP_002736314.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae JJA]
 gi|225856989|ref|YP_002738500.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae P1031]
 gi|225859120|ref|YP_002740630.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae 70585]
 gi|225860864|ref|YP_002742373.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae
           Taiwan19F-14]
 gi|237650907|ref|ZP_04525159.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae CCRI 1974]
 gi|237822282|ref|ZP_04598127.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae CCRI 1974M2]
 gi|298231059|ref|ZP_06964740.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254177|ref|ZP_06977763.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502698|ref|YP_003724638.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae TCH8431/19A]
 gi|307127077|ref|YP_003879108.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae 670-6B]
 gi|61233355|sp|P0A471|RL7_STRPN RecName: Full=50S ribosomal protein L7/L12
 gi|61233362|sp|P0A472|RL7_STRR6 RecName: Full=50S ribosomal protein L7/L12
 gi|122278460|sp|Q04JZ4|RL7_STRP2 RecName: Full=50S ribosomal protein L7/L12
 gi|226734481|sp|B5E5F0|RL7_STRP4 RecName: Full=50S ribosomal protein L7/L12
 gi|226734482|sp|B1ICF4|RL7_STRPI RecName: Full=50S ribosomal protein L7/L12
 gi|254806396|sp|C1C7V4|RL7_STRP7 RecName: Full=50S ribosomal protein L7/L12
 gi|254806397|sp|B8ZKK3|RL7_STRPJ RecName: Full=50S ribosomal protein L7/L12
 gi|254806399|sp|C1CEU3|RL7_STRZJ RecName: Full=50S ribosomal protein L7/L12
 gi|254806400|sp|C1CL62|RL7_STRZP RecName: Full=50S ribosomal protein L7/L12
 gi|254806401|sp|C1CR01|RL7_STRZT RecName: Full=50S ribosomal protein L7/L12
 gi|14972838|gb|AAK75452.1| ribosomal protein L7/L12 [Streptococcus pneumoniae TIGR4]
 gi|116077197|gb|ABJ54917.1| ribosomal protein L7/L12 [Streptococcus pneumoniae D39]
 gi|147756650|gb|EDK63691.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP11-BS70]
 gi|147759331|gb|EDK66324.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP14-BS69]
 gi|147761302|gb|EDK68268.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP18-BS74]
 gi|147764016|gb|EDK70948.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP19-BS75]
 gi|147922180|gb|EDK73302.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP3-BS71]
 gi|147925013|gb|EDK76094.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP6-BS73]
 gi|147928291|gb|EDK79308.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP9-BS68]
 gi|147931175|gb|EDK82154.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP23-BS72]
 gi|168995661|gb|ACA36273.1| ribosomal protein L7/L12 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042183|gb|EDT50229.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC1873-00]
 gi|183569599|gb|EDT90127.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC1087-00]
 gi|183571293|gb|EDT91821.1| ribosomal protein L7/L12 [Streptococcus pneumoniae SP195]
 gi|183574395|gb|EDT94923.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC0288-04]
 gi|183576615|gb|EDT97143.1| ribosomal protein L7/L12 [Streptococcus pneumoniae CDC3059-06]
 gi|183578156|gb|EDT98684.1| ribosomal protein L7/L12 [Streptococcus pneumoniae MLV-016]
 gi|194358280|gb|ACF56728.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae G54]
 gi|220674557|emb|CAR69120.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae ATCC 700669]
 gi|225720014|gb|ACO15868.1| ribosomal protein L7/L12 [Streptococcus pneumoniae 70585]
 gi|225723421|gb|ACO19274.1| ribosomal protein L7/L12 [Streptococcus pneumoniae JJA]
 gi|225724953|gb|ACO20805.1| ribosomal protein L7/L12 [Streptococcus pneumoniae P1031]
 gi|225726885|gb|ACO22736.1| ribosomal protein L7/L12 [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238293|gb|ADI69424.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae TCH8431/19A]
 gi|301800224|emb|CBW32842.1| 50S ribosomal protein L7/L12 [Streptococcus pneumoniae OXC141]
 gi|306484139|gb|ADM91008.1| ribosomal protein L7/L12 [Streptococcus pneumoniae 670-6B]
 gi|327389539|gb|EGE87884.1| ribosomal protein L7/L12 [Streptococcus pneumoniae GA04375]
 gi|332073661|gb|EGI84140.1| ribosomal protein L7/L12 [Streptococcus pneumoniae GA17570]
 gi|332074677|gb|EGI85151.1| ribosomal protein L7/L12 [Streptococcus pneumoniae GA17545]
 gi|332074934|gb|EGI85406.1| ribosomal protein L7/L12 [Streptococcus pneumoniae GA41301]
          Length = 122

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 85/124 (68%), Gaps = 5/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   +++E  +L K +E+E+GV+A+APV+V    AA+A  A + K  F+V L
Sbjct: 4   NIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAVA---AADAADAGAAKDSFDVEL 60

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KK+ VIK VR IT LGLKEAKELV+ AP  +K G++  EA E+K KLE+AGA+
Sbjct: 61  TS--AGDKKVGVIKVVREITGLGLKEAKELVDGAPALVKEGVATAEAEEIKAKLEEAGAS 118

Query: 123 VELR 126
           V L+
Sbjct: 119 VTLK 122


>gi|56416545|ref|YP_153619.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. St. Maries]
 gi|222474913|ref|YP_002563328.1| ribosomal protein L7/L12 (rplL) [Anaplasma marginale str. Florida]
 gi|254994765|ref|ZP_05276955.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. Mississippi]
 gi|255002886|ref|ZP_05277850.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. Puerto Rico]
 gi|255004017|ref|ZP_05278818.1| 50S ribosomal protein L7/L12 [Anaplasma marginale str. Virginia]
 gi|56387777|gb|AAV86364.1| ribosomal protein L7/L12 [Anaplasma marginale str. St. Maries]
 gi|222419049|gb|ACM49072.1| ribosomal protein L7/L12 (rplL) [Anaplasma marginale str. Florida]
          Length = 134

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 52/131 (39%), Positives = 73/131 (55%), Gaps = 8/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSA----SAPVSVVAPVAAEAGSAASEKTEF 58
           +++S+ E++  L L  AA L ++LE + G       +A  +  +       S  +E+TEF
Sbjct: 5   DLDSLAEQICGLDLCSAAALVEKLEDKLGFPKGGLLTAMPAAGSAAQGAEDSGGAEQTEF 64

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPK---SLKTGLSKDEANEMKKK 115
            V+  G+  P KKI+VIK VR  T LGLKEAK+ VE              K EA E+KKK
Sbjct: 65  VVMFDGY-APDKKISVIKAVRECTTLGLKEAKDFVEQEGSRELVEGKKYKKAEAEEVKKK 123

Query: 116 LEDAGATVELR 126
           LEDAGATV ++
Sbjct: 124 LEDAGATVSIK 134


>gi|257063574|ref|YP_003143246.1| LSU ribosomal protein L12P [Slackia heliotrinireducens DSM 20476]
 gi|256791227|gb|ACV21897.1| LSU ribosomal protein L12P [Slackia heliotrinireducens DSM 20476]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E L  +TL++A+EL K +E+ +GVSA+AP +V    A +A +AA  +TEF+V+L+G
Sbjct: 6   EEIIEALKEMTLLQASELVKAIEETFGVSAAAPAAVAVAPAGDAPAAAE-QTEFDVILEG 64

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
           F     KIAVIK VR IT LGLKEAK  VESAP  +K  ++K+EA ++K KLE AGA V 
Sbjct: 65  F--GDNKIAVIKAVREITGLGLKEAKAAVESAPAPIKEKVAKEEAEDLKAKLEAAGAAVT 122

Query: 125 LR 126
           ++
Sbjct: 123 VK 124


>gi|114798365|ref|YP_761537.1| 50S ribosomal protein L7/L12 [Hyphomonas neptunium ATCC 15444]
 gi|123027738|sp|Q0BYA6|RL7_HYPNA RecName: Full=50S ribosomal protein L7/L12
 gi|114738539|gb|ABI76664.1| ribosomal protein L7/L12 [Hyphomonas neptunium ATCC 15444]
          Length = 125

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 75/127 (59%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N+E IVE LS+LT++EAAEL+K LE++WGVSA+APV+V A   A   +AA EKTEF+V
Sbjct: 1   MANLEKIVEDLSALTVLEAAELAKMLEEKWGVSAAAPVAVAAAGGAAPAAAAEEKTEFDV 60

Query: 61  VLKGFDDPKKKIAVIKEVRAITD-LGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VL   +   KKI VIK VR +   LGLKEAK+LVE APK++K  +SK +A E+KKK E A
Sbjct: 61  VLT--EAGAKKIEVIKLVREVVPALGLKEAKDLVEGAPKTVKEAVSKADAEELKKKFEAA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAKVELK 125


>gi|133083|sp|P02395|RL7_MICLU RecName: Full=50S ribosomal protein L7/L12; AltName: Full=MA1/MA2
          Length = 118

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 67/124 (54%), Positives = 92/124 (74%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           N E I+E + ++T++E  +L K +E+E+GV+A+APV     VA  A +AA EKTEF+VVL
Sbjct: 2   NKEQILEAIKAMTVLELNDLVKAIEEEFGVTAAAPV-----VAGGAAAAAEEKTEFDVVL 56

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  +KI VIK VR IT LGLKEAKE+V++APK+LK G+SKDEA E+K KLE+ GA+
Sbjct: 57  AS--AGAEKIKVIKVVREITGLGLKEAKEVVDNAPKALKEGVSKDEAEEIKAKLEEVGAS 114

Query: 123 VELR 126
           VE++
Sbjct: 115 VEVK 118


>gi|146318637|ref|YP_001198349.1| 50S ribosomal protein L7/L12 [Streptococcus suis 05ZYH33]
 gi|146320844|ref|YP_001200555.1| 50S ribosomal protein L7/L12 [Streptococcus suis 98HAH33]
 gi|223933020|ref|ZP_03625014.1| ribosomal protein L7/L12 [Streptococcus suis 89/1591]
 gi|253751758|ref|YP_003024899.1| 50S ribosomal protein L7/L12 [Streptococcus suis SC84]
 gi|253753582|ref|YP_003026723.1| 50S ribosomal protein L7/L12 [Streptococcus suis P1/7]
 gi|253755537|ref|YP_003028677.1| 50S ribosomal protein L7/L12 [Streptococcus suis BM407]
 gi|330832816|ref|YP_004401641.1| 50S ribosomal protein L7/L12 [Streptococcus suis ST3]
 gi|166222217|sp|A4W1B6|RL7_STRS2 RecName: Full=50S ribosomal protein L7/L12
 gi|166222219|sp|A4VV10|RL7_STRSY RecName: Full=50S ribosomal protein L7/L12
 gi|145689443|gb|ABP89949.1| Ribosomal protein L7/L12 [Streptococcus suis 05ZYH33]
 gi|145691650|gb|ABP92155.1| Ribosomal protein L7/L12 [Streptococcus suis 98HAH33]
 gi|223898337|gb|EEF64704.1| ribosomal protein L7/L12 [Streptococcus suis 89/1591]
 gi|251816047|emb|CAZ51667.1| 50S ribosomal protein L7/L12 [Streptococcus suis SC84]
 gi|251818001|emb|CAZ55783.1| 50S ribosomal protein L7/L12 [Streptococcus suis BM407]
 gi|251819828|emb|CAR45797.1| 50S ribosomal protein L7/L12 [Streptococcus suis P1/7]
 gi|319758107|gb|ADV70049.1| 50S ribosomal protein L7/L12 [Streptococcus suis JS14]
 gi|329307039|gb|AEB81455.1| 50S ribosomal protein L7/L12 [Streptococcus suis ST3]
          Length = 121

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 57/124 (45%), Positives = 80/124 (64%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   T++E  +L K +E+E+GV+A+        VAA  G+A   K  F+V L
Sbjct: 4   NIENIIAEIKEATILELNDLVKAIEEEFGVTAA----APVAVAAAGGAAEEAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KK+ VIK VR IT LGLKEAKELV+ AP  +K G++  EA E+K KLE+AGA+
Sbjct: 60  TS--AGDKKVGVIKVVREITGLGLKEAKELVDGAPAMVKEGVATAEAEEIKAKLEEAGAS 117

Query: 123 VELR 126
           V L+
Sbjct: 118 VTLK 121


>gi|317052111|ref|YP_004113227.1| 50S ribosomal protein L7/L12 [Desulfurispirillum indicum S5]
 gi|316947195|gb|ADU66671.1| ribosomal protein L7/L12 [Desulfurispirillum indicum S5]
          Length = 126

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 66/123 (53%), Positives = 92/123 (74%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFEVVLK 63
           E  +  L +++++E AEL K LE+++GVSA+APV+V A   A   +A   EKTEF+V+L 
Sbjct: 6   EDFISYLENMSVLELAELVKELEEKFGVSAAAPVAVAAAGPAAGPAAAEEEKTEFDVIL- 64

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
             +  +KKI VIK VR +T LGLKEAK+LVE APK++K G+SKD+ANE+K KLE+AGA V
Sbjct: 65  -VNAGEKKINVIKVVREVTGLGLKEAKDLVEGAPKAVKEGVSKDQANELKAKLEEAGAKV 123

Query: 124 ELR 126
           E++
Sbjct: 124 EVK 126


>gi|283798912|ref|ZP_06348065.1| ribosomal protein L7/L12 [Clostridium sp. M62/1]
 gi|291073375|gb|EFE10739.1| ribosomal protein L7/L12 [Clostridium sp. M62/1]
 gi|295092668|emb|CBK78775.1| LSU ribosomal protein L12P [Clostridium cf. saccharolyticum K10]
 gi|295115910|emb|CBL36757.1| LSU ribosomal protein L12P [butyrate-producing bacterium SM4/1]
          Length = 124

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 61/128 (47%), Positives = 81/128 (63%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     +E +  L+++E  EL K  E+E+GVSA+A V V    A  A  AA EKTEF
Sbjct: 1   MAKLTTAEFIEAIKELSVLELNELVKACEEEFGVSAAAGVVVA--AAGGAAEAAEEKTEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L   D    K+ VIK VR  T LGLKEAKE+V+ APK +K G+SK+EA ++K KLE 
Sbjct: 59  DVELT--DVGANKVKVIKVVREATGLGLKEAKEVVDGAPKVVKAGVSKEEAEDLKTKLEA 116

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 117 EGAKVTLK 124


>gi|50954152|ref|YP_061440.1| 50S ribosomal protein L7/L12 [Leifsonia xyli subsp. xyli str.
           CTCB07]
 gi|71649270|sp|Q6AH10|RL7_LEIXX RecName: Full=50S ribosomal protein L7/L12
 gi|50950634|gb|AAT88335.1| 50S ribosomal protein L7/L12 [Leifsonia xyli subsp. xyli str.
           CTCB07]
          Length = 132

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 81/133 (60%), Gaps = 8/133 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAG-----SAAS 53
           M+ +  + ++E    LTLIE +E  K+ E+ + V+A+AP   VA   A  G       A 
Sbjct: 1   MAKLSTDELLEAFKDLTLIELSEFVKKFEETFEVTAAAPPVAVAAAPAAGGAGAAAEDAE 60

Query: 54  EKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
           +K  F++VL+  D  K KI VIKEVRA+T LGL EAK LV+ AP ++  G +K+ A++ K
Sbjct: 61  QKDSFDIVLESVDASK-KIQVIKEVRALTSLGLGEAKALVDGAPSTVLEGANKEAADKAK 119

Query: 114 KKLEDAGATVELR 126
            +LE AG T+ L+
Sbjct: 120 TQLEGAGGTINLK 132


>gi|325956084|ref|YP_004286694.1| 50S ribosomal protein L7/L12 [Lactobacillus acidophilus 30SC]
 gi|325332649|gb|ADZ06557.1| 50S ribosomal protein L7/L12 [Lactobacillus acidophilus 30SC]
 gi|327182899|gb|AEA31346.1| 50S ribosomal protein L7/L12 [Lactobacillus amylovorus GRL 1118]
          Length = 120

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 55/124 (44%), Positives = 85/124 (68%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + + I+E+L   +++E  +L K +E E+ V+A+APV      AA AG AA+ K+EF+V L
Sbjct: 4   DTDKIIEELKGASILELNDLVKAIEDEFDVTAAAPV-----AAAGAGDAAAAKSEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D  ++K+ VIKE+R IT  GL +AK+LV+ AP  +K G S+D+AN++K++LE  GAT
Sbjct: 59  T--DAGQEKVKVIKEIRDITGKGLLDAKKLVDGAPVIVKEGASEDDANKIKEQLEGVGAT 116

Query: 123 VELR 126
           V L+
Sbjct: 117 VTLK 120


>gi|255719570|ref|XP_002556065.1| KLTH0H04202p [Lachancea thermotolerans]
 gi|238942031|emb|CAR30203.1| KLTH0H04202p [Lachancea thermotolerans]
          Length = 170

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 52/132 (39%), Positives = 72/132 (54%), Gaps = 10/132 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            IE IV+ +S LTL+E + L   L+ +  +   A     A  A  A  AA E        
Sbjct: 39  KIEKIVQDISKLTLLETSALISELKTQLNIPDIAMPVAGAAPAGAAAPAAEEAKEEEVKE 98

Query: 55  -KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
            KT F + L+ F D K K  VIKEV+ +  L L EAK+ VE+APK LK  ++K++A+++K
Sbjct: 99  EKTIFAIKLESF-DAKSKPKVIKEVKNLLGLSLVEAKKFVEAAPKILKDNVAKEDADKIK 157

Query: 114 KKLEDAGATVEL 125
             LE  GA V L
Sbjct: 158 ASLEALGAKVAL 169


>gi|104779747|ref|YP_606245.1| 50S ribosomal protein L7/L12 [Pseudomonas entomophila L48]
 gi|123381075|sp|Q1IFX4|RL7_PSEE4 RecName: Full=50S ribosomal protein L7/L12
 gi|95108734|emb|CAK13428.1| 50S ribosomal protein L7/L12 [Pseudomonas entomophila L48]
          Length = 122

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E +   T++E  EL K +E+ +GV+A+A V+      A A +AA E+TEF VVL  
Sbjct: 6   EQIIEAIGQKTVLEIVELIKAMEETFGVTAAAAVAA---GPAVAAAAAEEQTEFNVVLT- 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            +   KK+ VIK VR +T LGLKEAKE V+ AP+ +  G+SK+ A + KKKLE+AGA VE
Sbjct: 62  -EAGDKKVNVIKAVRELTGLGLKEAKEKVDGAPQVIAEGVSKEAAEDAKKKLEEAGAKVE 120

Query: 125 LR 126
           L+
Sbjct: 121 LK 122


>gi|91790276|ref|YP_551228.1| 50S ribosomal protein L7/L12 [Polaromonas sp. JS666]
 gi|123059300|sp|Q123G2|RL7_POLSJ RecName: Full=50S ribosomal protein L7/L12
 gi|91699501|gb|ABE46330.1| LSU ribosomal protein L12P [Polaromonas sp. JS666]
          Length = 125

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 59/124 (47%), Positives = 84/124 (67%), Gaps = 2/124 (1%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + ++ +  L S+T++E  +L K +E+++GVSA+A  +  A     A +AA EKTEF VVL
Sbjct: 4   DKDAFLTALDSMTVLELNDLVKAIEEKFGVSAAAMAAPAAAGGGGAAAAAEEKTEFNVVL 63

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              +    K++VIK VR IT LGLKEAK+LV+ APK++K    K +A+  KKKLEDAGA 
Sbjct: 64  --LEAGANKVSVIKAVREITGLGLKEAKDLVDGAPKNVKEAAPKADADAAKKKLEDAGAK 121

Query: 123 VELR 126
           VEL+
Sbjct: 122 VELK 125


>gi|297172384|gb|ADI23359.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0770_27O18]
 gi|297181149|gb|ADI17346.1| hypothetical protein [uncultured Oceanospirillales bacterium
           HF0070_21F08]
          Length = 126

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 61/123 (49%), Positives = 86/123 (69%), Gaps = 3/123 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFEVVLK 63
           E I+  ++ +++++  EL + +E+++GV+A+A V+     A     AA  E+TEF+VVL 
Sbjct: 6   EDILSAVADMSVMDLVELIEAMEEKFGVTAAAAVAAAPAAAGGDAGAAAEEQTEFDVVLT 65

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
           GF    KK+ VIK VR +T LGLKEAKELVESAP  +K G SKDEA E+KKK+E+AG T 
Sbjct: 66  GF--GDKKVGVIKAVREVTGLGLKEAKELVESAPAPVKEGASKDEAEEIKKKIEEAGGTA 123

Query: 124 ELR 126
           EL+
Sbjct: 124 ELK 126


>gi|189460676|ref|ZP_03009461.1| hypothetical protein BACCOP_01323 [Bacteroides coprocola DSM 17136]
 gi|189432635|gb|EDV01620.1| hypothetical protein BACCOP_01323 [Bacteroides coprocola DSM 17136]
          Length = 125

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 58/127 (45%), Positives = 85/127 (66%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAA-SEKTEFE 59
           M+++++  E+L +LT+ E  EL+  L++E+G+  +A    VA   A AG+AA  EKT F+
Sbjct: 1   MADLKAFAEQLVNLTVKEVNELATILKEEYGIEPAAAAVAVAAGPAAAGAAAAEEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           VVLK       K+ V+K V+    LGLKEAK++V+ AP  +K GL+KDEA  +KK LE+A
Sbjct: 61  VVLKS--AGAAKLQVVKAVKEACGLGLKEAKDMVDGAPSVVKEGLAKDEAESLKKVLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|313835999|gb|EFS73713.1| ribosomal protein L7/L12 [Propionibacterium acnes HL037PA2]
 gi|314929675|gb|EFS93506.1| ribosomal protein L7/L12 [Propionibacterium acnes HL044PA1]
 gi|314970502|gb|EFT14600.1| ribosomal protein L7/L12 [Propionibacterium acnes HL037PA3]
 gi|328906255|gb|EGG26030.1| 50S ribosomal protein L7/L12 [Propionibacterium sp. P08]
          Length = 131

 Score = 77.6 bits (190), Expect = 5e-13,   Method: Composition-based stats.
 Identities = 57/133 (42%), Positives = 82/133 (61%), Gaps = 9/133 (6%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE---- 54
           M+ +  E +++    +TLIE +E  K+ E+ + VSA+APV+V A   A A    +     
Sbjct: 1   MAKLSNEELLDAFKEMTLIELSEFVKQFEETFDVSAAAPVAVAAAAGAPAAGGEAAAAEE 60

Query: 55  -KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMK 113
            K EF+V+L+      KKI VIKEVR +T LGLK+AK+LVE APK +     K++A + K
Sbjct: 61  EKDEFDVILES--AGDKKIQVIKEVRGLTSLGLKDAKDLVEGAPKPVLEKAKKEDAEKAK 118

Query: 114 KKLEDAGATVELR 126
           + LE AGATV L+
Sbjct: 119 EALEAAGATVTLK 131


>gi|297587470|ref|ZP_06946114.1| ribosomal protein L7/L12 [Finegoldia magna ATCC 53516]
 gi|297574159|gb|EFH92879.1| ribosomal protein L7/L12 [Finegoldia magna ATCC 53516]
          Length = 123

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 59/123 (47%), Positives = 88/123 (71%), Gaps = 2/123 (1%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLK 63
           I+ I+E +  LT++E  EL ++ E+++GVSA+APV+V     A  G+AA EK+EF+V+L 
Sbjct: 3   IDEILEAVEGLTVLELNELVEKAEEKFGVSAAAPVAVAGAAPAAGGAAAEEKSEFDVILA 62

Query: 64  GFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATV 123
                  K+ VIK V+ +T LGLK+AK +V+ APK++K G SK+EA E+K KLE+ GAT+
Sbjct: 63  S--AGDAKMKVIKAVKDLTGLGLKDAKAIVDEAPKAIKEGASKEEAEELKAKLEEVGATI 120

Query: 124 ELR 126
           EL+
Sbjct: 121 ELK 123


>gi|116251531|ref|YP_767369.1| 50S ribosomal protein L7/L12 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|241204156|ref|YP_002975252.1| 50S ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|123261677|sp|Q1MIF0|RL7_RHIL3 RecName: Full=50S ribosomal protein L7/L12
 gi|115256179|emb|CAK07260.1| putative 50S ribosomal protein L7/L12 (L8) [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|240858046|gb|ACS55713.1| ribosomal protein L7/L12 [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 125

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 73/127 (57%), Positives = 98/127 (77%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSA-ASEKTEFE 59
           M+++  IV+ LSSLT++EAAELSK LE++WGVSA+APV+V A     A +    EKTEF+
Sbjct: 1   MADLAKIVDDLSSLTVLEAAELSKLLEEKWGVSAAAPVAVAAAAGGAAAAVVEEEKTEFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L   +    KI VIKEVRAIT LGLKEAK+LVE+APK++K G++K EA ++KKKLEDA
Sbjct: 61  VIL--VEAGANKINVIKEVRAITGLGLKEAKDLVEAAPKAVKEGVNKAEAADIKKKLEDA 118

Query: 120 GATVELR 126
           GA  +++
Sbjct: 119 GAKADVK 125


>gi|151220714|ref|YP_001331536.1| 50S ribosomal protein L7/L12 [Staphylococcus aureus subsp. aureus
           str. Newman]
 gi|172048777|sp|A6QEJ2|RL7_STAAE RecName: Full=50S ribosomal protein L7/L12
 gi|150373514|dbj|BAF66774.1| 50S ribosomal protein L7 [Staphylococcus aureus subsp. aureus str.
           Newman]
          Length = 122

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 54/126 (42%), Positives = 81/126 (64%), Gaps = 4/126 (3%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+N E I+E +  ++++E  +L K +E+E+    +A   V    AA    AA+EKTEF+V
Sbjct: 1   MANHEQIIEAIKEMSVLELNDLVKAIEEEF--GVTAAAPVAVAGAAGGADAAAEKTEFDV 58

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
            L        KI V+K V+  T LGLK+AKELV+ APK +K  L K+EA ++K++LE+ G
Sbjct: 59  ELTS--AGSSKIKVVKAVKEATGLGLKDAKELVDGAPKVIKEALPKEEAEKLKEQLEEVG 116

Query: 121 ATVELR 126
           ATVE++
Sbjct: 117 ATVEIK 122


>gi|268592960|ref|ZP_06127181.1| ribosomal protein L7/L12 [Providencia rettgeri DSM 1131]
 gi|291311431|gb|EFE51884.1| ribosomal protein L7/L12 [Providencia rettgeri DSM 1131]
          Length = 121

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 58/122 (47%), Positives = 83/122 (68%), Gaps = 6/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           + I++ ++ +++++  EL   +E+++GVSA+        VAA    AA EKTEF+VVL  
Sbjct: 6   DQILDAVAEMSVMDVVELITMMEEKFGVSAA----AAVAVAAGPAEAAEEKTEFDVVLSA 61

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
                 K+AVIK VR  T LGLKEAK++VESAP ++K G SKDEA  +KK LE+AGA+VE
Sbjct: 62  V--GGNKVAVIKAVRGATGLGLKEAKDMVESAPATIKEGASKDEAEALKKSLEEAGASVE 119

Query: 125 LR 126
           L+
Sbjct: 120 LK 121


>gi|50556266|ref|XP_505541.1| YALI0F17556p [Yarrowia lipolytica]
 gi|49651411|emb|CAG78350.1| YALI0F17556p [Yarrowia lipolytica]
          Length = 163

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 44/131 (33%), Positives = 75/131 (57%), Gaps = 9/131 (6%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-------- 54
            I +IV++++ L L+E + L   L+    +   +  +  A  AA   +AA E        
Sbjct: 33  KITAIVDQIAQLNLLETSSLVTELKSRLNIPDISFPAAGAAPAAAPAAAAEEAAPEPVEE 92

Query: 55  KTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKK 114
           KT F + L+ + D K K  VIKE++ +  L L +AK++V++APK +K  + K++A+++KK
Sbjct: 93  KTIFNIKLESY-DAKAKPKVIKEIKTLLGLSLVDAKKIVDAAPKMVKESVPKEDADKIKK 151

Query: 115 KLEDAGATVEL 125
            LED GA + L
Sbjct: 152 VLEDLGAKITL 162


>gi|114570353|ref|YP_757033.1| 50S ribosomal protein L12P [Maricaulis maris MCS10]
 gi|122315779|sp|Q0ANP2|RL7_MARMM RecName: Full=50S ribosomal protein L7/L12
 gi|114340815|gb|ABI66095.1| LSU ribosomal protein L12P [Maricaulis maris MCS10]
          Length = 123

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 89/126 (70%), Gaps = 3/126 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEV 60
           M+++  + ++L +LT++EA EL+  LE++ G+ A+A V+V  P       AA EK EF+V
Sbjct: 1   MADVAKLCDELLALTILEAKELNDLLEEK-GIKAAAAVAVAGPAGGGDAPAAEEKDEFDV 59

Query: 61  VLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAG 120
           VL G     KKI VIKEVRAIT LGLKEAK+LVE APK++K   SK EA E+K KLE AG
Sbjct: 60  VLTG--AGDKKINVIKEVRAITGLGLKEAKDLVEGAPKAVKEAASKTEAEEIKAKLEAAG 117

Query: 121 ATVELR 126
           A+VEL+
Sbjct: 118 ASVELK 123


>gi|90417543|ref|ZP_01225464.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2207]
 gi|90330635|gb|EAS45925.1| ribosomal protein L7/L12 [marine gamma proteobacterium HTCC2207]
          Length = 125

 Score = 77.6 bits (190), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 87/122 (71%), Gaps = 2/122 (1%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+  ++ +++++  EL   +E+++GVSA A V+V A  AA   +AA EKT+F+VVL  
Sbjct: 6   EDILNAIAEMSVMDVVELVSAMEEKFGVSAQAAVAVAAGPAAGGEAAAEEKTDFDVVLAA 65

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
               +KK+ VIK VRAIT LGLKEAKELV+ AP ++K   SKD+A E KK LE+AGATVE
Sbjct: 66  V--GEKKVNVIKAVRAITGLGLKEAKELVDGAPSTIKEAASKDDAEEAKKALEEAGATVE 123

Query: 125 LR 126
           L+
Sbjct: 124 LK 125


>gi|329116502|ref|ZP_08245219.1| ribosomal protein L7/L12 [Streptococcus parauberis NCFD 2020]
 gi|326906907|gb|EGE53821.1| ribosomal protein L7/L12 [Streptococcus parauberis NCFD 2020]
          Length = 121

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 6/124 (4%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           NIE+I+ ++   +++E  +L K +E+E+GV+A+APV+      A  G+  + K  F+V L
Sbjct: 4   NIENIIAEIKEASILELNDLVKAIEEEFGVTAAAPVAAA----AAGGAEEAAKDSFDVEL 59

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
                  KK+ VIK VR IT LGLKEAK LV+ AP ++K G++  EA E+K KLE+AGAT
Sbjct: 60  TAV--GDKKVGVIKVVREITGLGLKEAKGLVDGAPANVKEGVTAAEAEELKVKLEEAGAT 117

Query: 123 VELR 126
           + L+
Sbjct: 118 ITLK 121


>gi|227894593|ref|ZP_04012398.1| ribosomal protein L7/L12 [Lactobacillus ultunensis DSM 16047]
 gi|227863584|gb|EEJ71005.1| ribosomal protein L7/L12 [Lactobacillus ultunensis DSM 16047]
          Length = 120

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 54/124 (43%), Positives = 82/124 (66%), Gaps = 7/124 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVL 62
           + + I+E L   +++E  +L K +E E+ VSA+APV      AA A  A + K+EF+V L
Sbjct: 4   DKDKIIEDLKGASILELNDLVKAIEDEFDVSAAAPV-----AAAGAADAGAAKSEFDVEL 58

Query: 63  KGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGAT 122
              D  ++K+ VIKE+R IT  GL +AK+LV+ AP  +K G S+D+AN++K++LE  GAT
Sbjct: 59  T--DAGQEKVKVIKEIRDITGKGLLDAKKLVDGAPVVVKEGASEDDANKIKEQLEGVGAT 116

Query: 123 VELR 126
           V L+
Sbjct: 117 VTLK 120


>gi|328855004|gb|EGG04133.1| hypothetical protein MELLADRAFT_37607 [Melampsora larici-populina
           98AG31]
          Length = 141

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 46/133 (34%), Positives = 64/133 (48%), Gaps = 10/133 (7%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSV----------VAPVAAEAGSAA 52
            IE IV+ +S LTLIEA+EL   L+    ++  A                P         
Sbjct: 8   KIEEIVKSISQLTLIEASELVDALKTRLNITEIAAPISHSVNESKPIESQPSTPIEAEKP 67

Query: 53  SEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEM 112
            EKT F + L   D  +K   + +    + ++ L EAK+ VES PK LK   SK+E  ++
Sbjct: 68  KEKTTFNLTLTKIDATQKAKVIKEVKTIMPNMNLVEAKKFVESLPKVLKENGSKEEIEKL 127

Query: 113 KKKLEDAGATVEL 125
           KK LE  GATV+L
Sbjct: 128 KKTLESIGATVQL 140


>gi|239788601|dbj|BAH70973.1| ACYPI008498 [Acyrthosiphon pisum]
          Length = 175

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 43/129 (33%), Positives = 71/129 (55%), Gaps = 7/129 (5%)

Query: 3   NIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASE-----KTE 57
            +E +  +++SLT+IE +E ++ L+    +      +VV+  A        E     KT 
Sbjct: 47  KLEKLYTEITSLTMIEVSEFTELLKVRLNLKDIPMGAVVSAPATAGQDDEEEVAATVKTS 106

Query: 58  FEVVLKGFDDPKKKIAVIKEVRAIT-DLGLKEAKELVESAPKSLKTGLSKDEANEMKKKL 116
           F V L  FDD K+K+A+IKEV+ +   + L +AK+ VESAP  +K+ + KDEA ++K+  
Sbjct: 107 FTVKLMKFDD-KQKVALIKEVKNLMEGMNLVQAKKFVESAPTVIKSDIGKDEAKKLKEAF 165

Query: 117 EDAGATVEL 125
              GA   +
Sbjct: 166 TKVGAECVI 174


>gi|226501436|ref|NP_001150377.1| 50S ribosomal protein L12-2 [Zea mays]
 gi|195638766|gb|ACG38851.1| 50S ribosomal protein L12-2 [Zea mays]
          Length = 167

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 52/135 (38%), Positives = 76/135 (56%), Gaps = 14/135 (10%)

Query: 4   IESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVS-------------VVAPVAAEAGS 50
           + ++V+++  LTL+EA+ L+  L    GV    P++             V    A E   
Sbjct: 33  VSALVDEICGLTLLEASSLADALRGRLGVDQLPPLAILTGGGAPLVGGGVGPGAAGEEAK 92

Query: 51  AASEKTEFEVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEAN 110
           A  EK  F+V L+GFD    K+ +IKE+RA T+LGLKEAK+LVE AP  LK G+ K+EA 
Sbjct: 93  AKEEKMAFDVKLEGFDAAA-KLKIIKELRAFTNLGLKEAKDLVEKAPAVLKAGVPKEEAE 151

Query: 111 EMKKKLEDAGATVEL 125
            + +K+   GA + L
Sbjct: 152 SIAEKMRALGAKIVL 166


>gi|133073|sp|P05392|RL7_BACST RecName: Full=50S ribosomal protein L7/L12; AltName: Full=BL13;
           AltName: Full=Ribosomal protein 'A'
          Length = 122

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 63/122 (51%), Positives = 89/122 (72%), Gaps = 3/122 (2%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64
           E I+E + ++T++E  EL K +E+E+GV+A+APV V    AA A +AA  KTEF+V+L  
Sbjct: 4   EQIIEAVKNMTVLELNELVKAIEEEFGVTAAAPVVVAGGAAAGAEAAAE-KTEFDVIL-- 60

Query: 65  FDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDAGATVE 124
            D   +KI VIK VR IT LGLKEAK+LV++ PK +K G++K+EA E+K  LE+AGA VE
Sbjct: 61  ADAGAQKIKVIKVVREITGLGLKEAKDLVDNTPKPIKEGIAKEEAEEIKAALEEAGAKVE 120

Query: 125 LR 126
           ++
Sbjct: 121 IK 122


>gi|291516063|emb|CBK65273.1| LSU ribosomal protein L12P [Alistipes shahii WAL 8301]
          Length = 125

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 56/127 (44%), Positives = 88/127 (69%), Gaps = 3/127 (2%)

Query: 1   MSNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAAS-EKTEFE 59
           M++++ + E+L +L + E  EL++ L++E+G+  +A    VA  AA AG AA+ EKT F+
Sbjct: 1   MADVKKLAEELVNLKVTEVNELAQILKEEYGIEPAAAAVAVAAPAAGAGEAAAAEKTSFD 60

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+LK     + K+ VIK V+ I  L L +AK LV+ APK++K G+SK+EA ++K +LE+A
Sbjct: 61  VILKA--AGQAKLQVIKVVKDIAGLSLGDAKALVDGAPKAVKEGVSKEEAEQIKGQLEEA 118

Query: 120 GATVELR 126
           GA VEL+
Sbjct: 119 GAEVELK 125


>gi|291547340|emb|CBL20448.1| LSU ribosomal protein L12P [Ruminococcus sp. SR1/5]
          Length = 124

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 58/128 (45%), Positives = 78/128 (60%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +  E  +  +  L+++E  +L K  E+E+GVSA+A V V    A  AG AA EK EF
Sbjct: 1   MAKLTTEEFIAAIKELSVLELNDLVKACEEEFGVSAAAGVVVA--AAGAAGEAAEEKDEF 58

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L        K+ VIK VR +T LGLKEAK +V+ APK +K G SK EA ++K KLE 
Sbjct: 59  DVELTEV--GANKVKVIKVVREVTGLGLKEAKAIVDGAPKVVKEGASKAEAEDIKTKLEA 116

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 117 EGAKVTLK 124


>gi|226322720|ref|ZP_03798238.1| hypothetical protein COPCOM_00492 [Coprococcus comes ATCC 27758]
 gi|225208881|gb|EEG91235.1| hypothetical protein COPCOM_00492 [Coprococcus comes ATCC 27758]
          Length = 129

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 6/128 (4%)

Query: 1   MSNI--ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEF 58
           M+ +     +E +  L+++E  +L K  E+E+GVSA+A V V    AAE G+AA EK EF
Sbjct: 6   MAKLTTAEFIEAIKELSVLELNDLVKACEEEFGVSAAAGVVVA--AAAEGGAAAEEKDEF 63

Query: 59  EVVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLED 118
           +V L        K+ VIK VR IT LGLKEAKELV+ APK +K G+SK EA E+K KLE 
Sbjct: 64  DVEL--VSAGASKVKVIKVVREITGLGLKEAKELVDGAPKVVKEGVSKAEAEEIKTKLEA 121

Query: 119 AGATVELR 126
            GA V L+
Sbjct: 122 EGAEVNLK 129


>gi|300867214|ref|ZP_07111877.1| 50S ribosomal protein L7/L12 [Oscillatoria sp. PCC 6506]
 gi|300334828|emb|CBN57043.1| 50S ribosomal protein L7/L12 [Oscillatoria sp. PCC 6506]
          Length = 128

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 59/127 (46%), Positives = 90/127 (70%), Gaps = 3/127 (2%)

Query: 2   SNIESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPV--SVVAPVAAEAGSAASEKTEFE 59
           +  + I+E+L SLTL+EA+EL K++E+ +GVSA+AP    ++A     A     E+TEF+
Sbjct: 3   AATDQILEQLKSLTLLEASELVKQIEEAFGVSAAAPTGTMMMAGPGPAAVEEVEEQTEFD 62

Query: 60  VVLKGFDDPKKKIAVIKEVRAITDLGLKEAKELVESAPKSLKTGLSKDEANEMKKKLEDA 119
           V+L+      KKIA++KEVR IT LGLKEAK+LVE+APK++K  ++K  A ++KK+LE  
Sbjct: 63  VILEEV-PADKKIAILKEVRTITGLGLKEAKDLVEAAPKAVKEAIAKAAAEDIKKQLEAV 121

Query: 120 GATVELR 126
           GA + ++
Sbjct: 122 GAKIAIK 128


>gi|23097565|ref|NP_691031.1| 50S ribosomal protein L7/L12 [Oceanobacillus iheyensis HTE831]
 gi|81747271|sp|Q8ETZ0|RL7_OCEIH RecName: Full=50S ribosomal protein L7/L12
 gi|22775788|dbj|BAC12066.1| 50S ribosomal protein L7/L12 [Oceanobacillus iheyensis HTE831]
          Length = 120

 Score = 77.3 bits (189), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 52/122 (42%), Positives = 80/122 (65%), Gaps = 5/122 (4%)

Query: 5   ESIVEKLSSLTLIEAAELSKRLEKEWGVSASAPVSVVAPVAAEAGSAASEKTEFEVVLKG 64