RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780145|ref|YP_003064558.1| 50S ribosomal protein L10 [Candidatus Liberibacter asiaticus str. psy62] (172 letters) >d1zava1 d.58.62.1 (A:1-177) Ribosomal protein L10 {Thermotoga maritima [TaxId: 2336]} Length = 177 Score = 118 bits (296), Expect = 3e-28 Identities = 49/175 (28%), Positives = 89/175 (50%), Gaps = 7/175 (4%) Query: 1 MNRQGKSVEISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA---GGGVKVAKNRL 57 + RQ K + + E+S+IF + I+ A + G +VA + +LR ++RE G +V KN L Sbjct: 2 LTRQQKELIVKEMSEIFKKTSLILFADFLGFTVADLTELRSRLREKYGDGARFRVVKNTL 61 Query: 58 VKIAIRDTSIRGISDLFVGQSLIVY--SDSPVIAPKISVSFSND--NNEFRVLGGVVEKG 113 + +A+++ G + G + ++Y PV A KI +F D + R+ GG +E Sbjct: 62 LNLALKNAEYEGYEEFLKGPTAVLYVTEGDPVEAVKIIYNFYKDKKADLSRLKGGFLEGK 121 Query: 114 VLNQDSIKQIASLPDLEGIRAGIISAIQSNATRLVRLLGTPQTQVVRAISAFVDK 168 + ++ IA LP E + A ++ +++ T LV L +V ++A +K Sbjct: 122 KFTAEEVENIAKLPSKEELYAMLVGRVKAPITGLVFALSGILRNLVYVLNAIKEK 176 >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Length = 321 Score = 26.2 bits (57), Expect = 1.9 Identities = 4/38 (10%), Positives = 12/38 (31%) Query: 9 EISELSKIFSSSGSIVVAHYKGISVAQIKDLRKKMREA 46 + K + ++ Y + D+ + M + Sbjct: 146 ALGGKDKYATVRFGEPLSGYNTDFNVFVDDIARAMLQH 183 >d1ezfa_ a.128.1.2 (A:) Squalene synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 333 Score = 25.4 bits (55), Expect = 2.8 Identities = 6/27 (22%), Positives = 14/27 (51%) Query: 48 GGVKVAKNRLVKIAIRDTSIRGISDLF 74 G VK+ K + V + + T++ + + Sbjct: 275 GAVKIRKGQAVTLMMDATNMPAVKAII 301 >d1jlxa2 b.42.3.1 (A:154-299) Agglutinin {Love-lies-bleeding (Amaranthus caudatus) [TaxId: 3567]} Length = 146 Score = 24.0 bits (52), Expect = 6.3 Identities = 6/20 (30%), Positives = 10/20 (50%) Query: 84 DSPVIAPKISVSFSNDNNEF 103 S PK V+F +N ++ Sbjct: 2 KSIFQFPKGYVTFKGNNGKY 21 >d1uoua1 a.46.2.1 (A:33-100) Thymidine phosphorylase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Score = 24.0 bits (52), Expect = 7.4 Identities = 3/28 (10%), Positives = 13/28 (46%) Query: 20 SGSIVVAHYKGISVAQIKDLRKKMREAG 47 ++ +G+ + + L + + ++G Sbjct: 40 GAMLMAIRLRGMDLEETSVLTQALAQSG 67 >d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Length = 251 Score = 23.5 bits (50), Expect = 9.0 Identities = 7/24 (29%), Positives = 14/24 (58%) Query: 33 VAQIKDLRKKMREAGGGVKVAKNR 56 + ++K + K++ + GG KV K Sbjct: 7 IEELKKIEKEIEQGGGPEKVEKQH 30 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.316 0.133 0.349 Gapped Lambda K H 0.267 0.0743 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 561,550 Number of extensions: 24369 Number of successful extensions: 73 Number of sequences better than 10.0: 1 Number of HSP's gapped: 72 Number of HSP's successfully gapped: 14 Length of query: 172 Length of database: 2,407,596 Length adjustment: 79 Effective length of query: 93 Effective length of database: 1,322,926 Effective search space: 123032118 Effective search space used: 123032118 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.0 bits)