>cd00349 Ribosomal_L11 Ribosomal protein L11. Ribosomal protein L11, together with proteins L10 and L7/L12, and 23S rRNA, form the L7/L12 stalk on the surface of the large subunit of the ribosome. The homologous eukaryotic cytoplasmic protein is also called 60S ribosomal protein L12, which is distinct from the L12 involved in the formation of the L7/L12 stalk. The C-terminal domain (CTD) of L11 is essential for binding 23S rRNA, while the N-terminal domain (NTD) contains the binding site for the antibiotics thiostrepton and micrococcin. L11 and 23S rRNA form an essential part of the GTPase-associated region (GAR). Based on differences in the relative positions of the L11 NTD and CTD during the translational cycle, L11 is proposed to play a significant role in the binding of initiation factors, elongation factors, and release factors to the ribosome. Several factors, including the class I release factors RF1 and RF2, are known to interact directly with L11. In eukaryotes, L11 has been im

Probab=100.00 E-value=0 Score=344.05 Aligned_cols=131 Identities=48% Similarity=0.893 Sum_probs=129.0 Q ss_pred EEEEEECCCCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEEEECCCCHHHHHHHHCCCCC Q ss_conf 99999445566897044686642999899999999997754379751389998389529999859748999996337666 Q gi|254780147|r 9 VKLQIESGSAKPSPPVGPAIGQAGIPIMAFCKAFNAATEGMEKGIPIPTTVTCYKDKSFTFTMSQPPVSFFLKKEVGIKS 88 (142) Q Consensus 9 ikl~v~aG~A~p~PplGp~LG~~Gini~~f~k~fN~~T~~~~~g~~v~V~i~v~~dksf~~~i~~P~~s~likk~~g~~k 88 (142) T Consensus 1 ikl~i~aG~A~p~PplGp~LG~~Gini~~f~k~fN~~T~~~~-g~~vpV~Itv~~drsf~~~v~~Pp~s~likkaag~~k 79 (131) T cd00349 1 IKLQVPAGKASPAPPLGPALGQLGVNIMKFCKEFNARTKDYK-GLPVPVKITVYNDRSFTFEVKTPPASALLKKAAGIEK 79 (131) T ss_pred CEEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCC-CCEEEEEEEEECCCCEEEEEECCCHHHHHHHHHCCCC T ss_conf 968985576479998751014679899999999999873358-9767799999818967999937976999999856677 Q ss_pred CCCCCCCCEEEEECHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHEEECCEEE Q ss_conf 7889996301012599999999998854067878999999774302145289 Q gi|254780147|r 89 GSKLPGKESCGSITRENIRKIAQLKMQDMGAIDIEGAMRMVEGSACSMGISV 140 (142) Q Consensus 89 gs~~p~~~~~g~it~~~i~eIAk~K~~d~~~~~l~~~vk~VlGTa~SmGi~V 140 (142) T Consensus 80 gs~~p~~~~~g~it~~qv~eIAk~K~~dl~~~~l~~~vk~V~GTa~SmGi~V 131 (131) T cd00349 80 GSKKPNKEKVGNITLDQVYEIAKIKLPDLNAKTLKSAVKEILGTARSMGITV 131 (131) T ss_pred CCCCCCCEEECEEEHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCEEC T ss_conf 8789877474206099999999998776478889999999883361381699

HHsearch alignment for GI: 254780147 and conserved domain: cd00349