Query gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] Match_columns 67 No_of_seqs 103 out of 909 Neff 5.6 Searched_HMMs 39220 Date Sun May 22 18:16:58 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i 254780149.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 TIGR00964 secE_bact preprotein 99.7 3.9E-18 9.9E-23 120.4 7.6 57 8-64 1-61 (61) 2 PRK05740 secE preprotein trans 99.7 1.2E-17 3.1E-22 117.7 8.7 59 6-64 66-124 (124) 3 PRK07597 secE preprotein trans 99.7 8.7E-17 2.2E-21 113.0 8.4 59 4-62 4-62 (62) 4 pfam00584 SecE SecE/Sec61-gamm 99.7 7.7E-17 2E-21 113.2 7.8 56 7-62 1-56 (56) 5 COG0690 SecE Preprotein transl 99.6 1.5E-15 3.9E-20 106.1 7.9 56 5-60 17-72 (73) 6 TIGR00327 secE_euk_arch protei 92.1 0.81 2.1E-05 25.4 6.9 55 4-58 2-59 (61) 7 KOG3498 consensus 88.5 2.1 5.5E-05 23.0 7.1 45 7-51 10-54 (67) 8 COG2443 Sss1 Preprotein transl 61.3 15 0.00039 18.4 7.4 46 6-51 9-57 (65) 9 PRK09400 secE preprotein trans 57.7 18 0.00045 18.0 7.7 47 5-51 4-53 (59) 10 TIGR00365 TIGR00365 glutaredox 50.8 3.5 9E-05 21.8 -0.5 19 13-31 56-75 (103) 11 COG3312 AtpI F0F1-type ATP syn 49.2 24 0.00062 17.2 4.3 43 20-64 2-44 (128) 12 PRK05326 potassium/proton anti 39.8 35 0.00088 16.4 3.7 45 16-63 80-127 (563) 13 TIGR01970 DEAH_box_HrpB ATP-de 38.7 8.7 0.00022 19.7 -0.0 20 12-31 825-848 (858) 14 TIGR00907 2A0304 amino acid pe 34.1 23 0.00059 17.4 1.6 30 23-52 457-486 (494) 15 pfam10766 DUF2592 Protein of u 26.8 58 0.0015 15.2 4.6 34 34-67 5-38 (41) 16 COG0278 Glutaredoxin-related p 26.1 19 0.00049 17.8 0.0 19 13-31 57-76 (105) 17 PRK09039 hypothetical protein; 22.8 69 0.0018 14.7 3.7 22 23-44 15-36 (343) No 1 >TIGR00964 secE_bact preprotein translocase, SecE subunit; InterPro: IPR005807 Secretion across the inner membrane in some Gram-negative bacteria occurs via the preprotein translocase pathway. Proteins are produced in the cytoplasm as precursors, and require a chaperone subunit to direct them to the translocase component. . From there, the mature proteins are either targeted to the outer membrane, or remain as periplasmic proteins. The translocase protein subunits are encoded on the bacterial chromosome. The translocase itself comprises 7 proteins, including a chaperone protein (SecB), an ATPase (SecA), an integral membrane complex (SecCY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD and SecF) . The chaperone protein SecB is a highly acidic homotetrameric protein that exists as a "dimer of dimers" in the bacterial cytoplasm. SecB maintains preproteins in an unfolded state after translation, and targets these to the peripheral membrane protein ATPase SecA for secretion . SecE, part of the main SecYEG translocase complex, is ~106 residues in length, and spans the inner membrane of the Gram-negative bacterial envelope. Together with SecY and SecG, SecE forms a multimeric channel through which preproteins are translocated, using both proton motive forces and ATP-driven secretion. The latter is mediated by SecA. The structure of the Escherichia coli SecYEG assembly revealed a sandwich of two membranes interacting through the extensive cytoplasmic domains . Each membrane is composed of dimers of SecYEG. The monomeric complex contains 15 transmembrane helices. ; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0009306 protein secretion, 0016021 integral to membrane. Probab=99.74 E-value=3.9e-18 Score=120.36 Aligned_cols=57 Identities=37% Similarity=0.775 Sum_probs=54.5 Q ss_pred HHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHH Q ss_conf 9999999999998734898899999999999999999999999999999999----99971 Q gi|254780149|r 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLM----HFILG 64 (67) Q Consensus 8 i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~----~~i~~ 64 (67) +.+|++|+++|||||+||||+|+.++|.+|++++++++++++++|+++++++ +++++ T Consensus 1 ~~~F~~~~~~E~~KV~WP~r~e~~~~t~~Vi~~v~~~~~f~~~~D~~~~~l~t~~I~~~~~ 61 (61) T TIGR00964 1 IFKFFKEVKAELRKVVWPSRKELITYTLVVIVFVIFFSLFLFGVDYLFGKLVTLVISLIFG 61 (61) T ss_pred CHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 9168899998866174886899999999999999999999999999999999999987619 No 2 >PRK05740 secE preprotein translocase subunit SecE; Reviewed Probab=99.73 E-value=1.2e-17 Score=117.65 Aligned_cols=59 Identities=32% Similarity=0.694 Sum_probs=56.4 Q ss_pred HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 55999999999999873489889999999999999999999999999999999999971 Q gi|254780149|r 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 (67) Q Consensus 6 ~~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i~~ 64 (67) .+...|++|++.|+|||+||||||+.++|.+|+++++++++|+|++|.++.+++++++| T Consensus 66 k~~~~f~~e~~~E~rKVvWPtr~Et~~~T~iV~~~vii~~l~lw~~D~~l~~~v~~i~G 124 (124) T PRK05740 66 KAFFAFAKESRTEVRKVVWPTRQETLQTTLIVIAVVIVMALILWGLDSILVWLISFITG 124 (124) T ss_pred HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 99999999999999957399869988799999999999999999999999999999739 No 3 >PRK07597 secE preprotein translocase subunit SecE; Reviewed Probab=99.69 E-value=8.7e-17 Score=112.96 Aligned_cols=59 Identities=36% Similarity=0.711 Sum_probs=55.1 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 56559999999999998734898899999999999999999999999999999999999 Q gi|254780149|r 4 NRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 (67) Q Consensus 4 ~~~~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i 62 (67) ...++.+|++|+++|||||+||||+|+.++|.+|++++++++++++++|++++++++.+ T Consensus 4 ~~~~~~~f~~~v~~ElkkV~WPtr~e~~~~t~~Vi~~~~i~~~~i~~~D~~~~~l~~~i 62 (62) T PRK07597 4 KMKKLIKFFKDVKAELKKVTWPTRKELVKSTIVVLVFVAFFSLFFYLVDLLISKLISLL 62 (62) T ss_pred HHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 78899999999999964075989799886999999999999999999999999999769 No 4 >pfam00584 SecE SecE/Sec61-gamma subunits of protein translocation complex. SecE is part of the SecYEG complex in bacteria which translocates proteins from the cytoplasm. In eukaryotes the complex, made from Sec61-gamma and Sec61-alpha translocates protein from the cytoplasm to the ER. Archaea have a similar complex. Probab=99.69 E-value=7.7e-17 Score=113.24 Aligned_cols=56 Identities=38% Similarity=0.883 Sum_probs=53.0 Q ss_pred HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 59999999999998734898899999999999999999999999999999999999 Q gi|254780149|r 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 (67) Q Consensus 7 ~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i 62 (67) ++.+|++|+++|+|||+||||+|+.++|.+|+++++++++++|++|++++++++.+ T Consensus 1 ~~~~f~~~v~~ElkkV~WPtr~e~~~~t~~Vi~~~~i~~~~~~~vD~~~~~~~~~i 56 (56) T pfam00584 1 KIVKFFKEVKAELKKVVWPTRKETLKTTVVVLIFVLVMALFLWLVDLVFGWLVKLI 56 (56) T ss_pred CHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 97889999999978365989799986999999999999999999999999999769 No 5 >COG0690 SecE Preprotein translocase subunit SecE [Intracellular trafficking and secretion] Probab=99.62 E-value=1.5e-15 Score=106.14 Aligned_cols=56 Identities=39% Similarity=0.748 Sum_probs=52.8 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 65599999999999987348988999999999999999999999999999999999 Q gi|254780149|r 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMH 60 (67) Q Consensus 5 ~~~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~ 60 (67) ..++.+|++|++.|+|||+||||+|+.++|.+|+.+++++++|+|++|+++++++. T Consensus 17 ~k~~~~f~~~~~~E~~KV~WPsrke~~~~t~~Vl~~v~~~s~~~~~~D~l~~~~i~ 72 (73) T COG0690 17 GKKFFNFFKEVRKELKKVVWPTRKELIRSTLIVLVVVAFFSLFLYGLDQLIGKLVS 72 (73) T ss_pred HHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC T ss_conf 17799999999999996518878999999999999999999999999999999860 No 6 >TIGR00327 secE_euk_arch protein translocase SEC61 complex gamma subunit, archaeal and eukaryotic; InterPro: IPR008158 This family is the protein translocase SEC61 complex gamma subunit of the archaeal and eukaryotic type. It does not hit bacterial SecE proteins. Sec61 is required for protein translocation in the endoplasmic reticulum. The Sec61 complex (eukaryotes) or SecY complex (prokaryotes) forms a conserved heterotrimeric integral membrane protein complex and forms a protein-conducting channel that allows polypeptides to be transferred across (or integrated into) the endoplasmic reticulum (eukaryotes) or across the cytoplasmic membrane (prokaryotes) , . This complex is itself a part of a larger translocase heterotrimeric complex composed of alpha, beta and gamma subunits. The channel is a passive conduit for polypeptides. It therefore has to associate with other components that provide a driving force. The partner proteins in bacteria and eukaryotes differ. In bacteria, the translocase complex comprises 7 proteins , including a chaperone protein (SecB) an ATPase (SecA), an integral membrane complex (SecY, SecE and SecG), and two additional membrane proteins that promote the release of the mature peptide into the periplasm (SecD) and SecF. The SecA ATPase interacts dynamically with the SecYEG integral membrane components to drive the transmembrane movement of newly synthesized preproteins . In yeast (and probably in all eukaryotes), the full translocase comprises another membrane protein subcomplex (the tetrameric Sec62/63p complex), and the lumenal protein BiP, a member of the Hsp70 family of ATPases. BiP promotes translocation by acting as a molecular ratchet, preventing the polypeptide chain from sliding back into the cytosol .; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0015031 protein transport, 0016020 membrane. Probab=92.13 E-value=0.81 Score=25.36 Aligned_cols=55 Identities=20% Similarity=0.199 Sum_probs=42.0 Q ss_pred HHHHHHHHHHHHHHHHHHCCCCCHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 56559999999999998734898899---99999999999999999999999999999 Q gi|254780149|r 4 NRLAVLNFFKQVRDESKKIFWPSRSE---VLVSVIVVIIMLSISSVFFLVIDQSIGWL 58 (67) Q Consensus 4 ~~~~i~~f~~ev~~ElkkV~WPt~~e---~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~ 58 (67) .+-.+.+|++|.++=+++.-=||++| +.+.|.+++..+.+.|..+..+-..+..+ T Consensus 2 ~~e~~~~f~~e~~~vL~~~kKP~~~EY~~v~Kv~~~g~~~vG~iGf~I~i~~~~l~G~ 59 (61) T TIGR00327 2 KIEEVKEFIKESKRVLKVAKKPDKEEYLKVAKVTGIGIIIVGIIGFIIKIIAELLKGV 59 (61) T ss_pred CHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCC T ss_conf 2357899999999999970699878899999999999999989999999999980311 No 7 >KOG3498 consensus Probab=88.55 E-value=2.1 Score=23.03 Aligned_cols=45 Identities=18% Similarity=0.121 Sum_probs=33.9 Q ss_pred HHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 599999999999987348988999999999999999999999999 Q gi|254780149|r 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVI 51 (67) Q Consensus 7 ~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~ 51 (67) -+.+|.+|...=.||.+=|+|+|..+....+-+--++++++=+.+ T Consensus 10 ~~~~f~k~s~rf~krC~KPdrKEf~ki~~~~aiGf~~mG~iGf~v 54 (67) T KOG3498 10 PLRDFAKDSIRFVKRCTKPDRKEFTKIAKATAIGFVIMGFIGFFV 54 (67) T ss_pred HHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 389999999999998159868999999999988899998999999 No 8 >COG2443 Sss1 Preprotein translocase subunit Sss1 [Intracellular trafficking and secretion] Probab=61.28 E-value=15 Score=18.37 Aligned_cols=46 Identities=20% Similarity=0.216 Sum_probs=32.1 Q ss_pred HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHH---HHHHHHHHHHHHHHH Q ss_conf 5599999999999987348988999999999---999999999999999 Q gi|254780149|r 6 LAVLNFFKQVRDESKKIFWPSRSEVLVSVIV---VIIMLSISSVFFLVI 51 (67) Q Consensus 6 ~~i~~f~~ev~~ElkkV~WPt~~e~~~~T~~---Vi~~~~i~~~~i~~~ 51 (67) ..+.+|++|.+.=+++..=|||+|-....-+ .++.+.+.+..+.++ T Consensus 9 e~~~~~lke~~rvl~~arKP~~eEy~~~aKi~~~Gi~liG~IGfiI~li 57 (65) T COG2443 9 EELREFLKEYRRVLKVARKPDWEEYSKIAKITGLGILLIGIIGFIIYLI 57 (65) T ss_pred HHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 9999999999999999819989999999999998999999999999999 No 9 >PRK09400 secE preprotein translocase subunit SecE; Reviewed Probab=57.65 E-value=18 Score=18.02 Aligned_cols=47 Identities=26% Similarity=0.285 Sum_probs=32.1 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCHHHHHHH---HHHHHHHHHHHHHHHHHH Q ss_conf 65599999999999987348988999999---999999999999999999 Q gi|254780149|r 5 RLAVLNFFKQVRDESKKIFWPSRSEVLVS---VIVVIIMLSISSVFFLVI 51 (67) Q Consensus 5 ~~~i~~f~~ev~~ElkkV~WPt~~e~~~~---T~~Vi~~~~i~~~~i~~~ 51 (67) ...+.+|++|.+.=++--.=|||+|-.+. |.+.++.+.+.|.++.++ T Consensus 4 ~e~~k~~~~~~~RVl~~a~KP~~~Ef~~i~kvtglgi~liG~iGfiI~li 53 (59) T PRK09400 4 LERVKNFLKDCKRVLKVAKKPSREEFLTIAKVTGLGILLIGLIGFIIQLI 53 (59) T ss_pred HHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 89999999999999999649998999999999999999999999999999 No 10 >TIGR00365 TIGR00365 glutaredoxin homolog; InterPro: IPR004480 Glutaredoxins , , , also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system . Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond . It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro. This family groups a number of hypothetical proteins from different organisms which are related to glutaredoxin proteins.. Probab=50.83 E-value=3.5 Score=21.84 Aligned_cols=19 Identities=21% Similarity=0.534 Sum_probs=16.0 Q ss_pred HHHHHHHHH-CCCCCHHHHH Q ss_conf 999999987-3489889999 Q gi|254780149|r 13 KQVRDESKK-IFWPSRSEVL 31 (67) Q Consensus 13 ~ev~~Elkk-V~WPt~~e~~ 31 (67) .|+|+|+|+ -.|||-.|+- T Consensus 56 ~~iR~~lk~ysnWPT~PQLy 75 (103) T TIGR00365 56 PEIRQGLKEYSNWPTFPQLY 75 (103) T ss_pred CHHHHHCHHCCCCCCCCCEE T ss_conf 13322010003579998356 No 11 >COG3312 AtpI F0F1-type ATP synthase, subunit I [Energy production and conversion] Probab=49.22 E-value=24 Score=17.24 Aligned_cols=43 Identities=16% Similarity=0.364 Sum_probs=26.4 Q ss_pred HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 873489889999999999999999999999999999999999971 Q gi|254780149|r 20 KKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 (67) Q Consensus 20 kkV~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i~~ 64 (67) .+|.-|+|+.-++.-.+=+..++..++.+++-+ ..|.++.+.| T Consensus 2 ~~v~~~srk~ar~lLliql~~~ivaa~~f~v~~--~~~~vSal~G 44 (128) T COG3312 2 MSVSLQSRKVARKLLLIQLLVVIVAALLFAVWQ--PQWGVSALLG 44 (128) T ss_pred CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHC T ss_conf 315676578899999999999999999999863--6878888852 No 12 >PRK05326 potassium/proton antiporter; Reviewed Probab=39.81 E-value=35 Score=16.40 Aligned_cols=45 Identities=20% Similarity=0.335 Sum_probs=27.9 Q ss_pred HHHHHHCCCCCHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHH Q ss_conf 9999873489889999999999999999---99999999999999999997 Q gi|254780149|r 16 RDESKKIFWPSRSEVLVSVIVVIIMLSI---SSVFFLVIDQSIGWLMHFIL 63 (67) Q Consensus 16 ~~ElkkV~WPt~~e~~~~T~~Vi~~~~i---~~~~i~~~D~~~~~~~~~i~ 63 (67) ..|+|++.||...- .|+-|+++..+ .+-++..+||..+.++..++ T Consensus 80 ~~~~r~~~~p~~~L---aTlGV~iT~~~~g~~a~~llgl~w~~alLlGAIv 127 (563) T PRK05326 80 WSSFRPALWPALSL---ATLGVLITAGLTGLFAHWLLGLSWLEGLLLGAIV 127 (563) T ss_pred HHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHEEE T ss_conf 89998776666899---9999999999999999999748799999883443 No 13 >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB; InterPro: IPR010225 This entry represents HrpB, one of two related predicted DEAH-box ATP-dependent helicases of unknown function found in many proteobacteria, but also in a few species of other lineages. The member from Rhizobium meliloti, designated HelO, has been studied but is not essential for growth and mutants have no obvious phenotype . HrpB is typically about 800 residues in length, while its paralog HrpA (IPR010222 from INTERPRO), also uncharacterised, is about 1300 amino acids long. Related characterised eukaryotic proteins are RNA helicases associated with pre-mRNA processing .. Probab=38.69 E-value=8.7 Score=19.68 Aligned_cols=20 Identities=30% Similarity=0.694 Sum_probs=15.1 Q ss_pred HHHHHHHHH----HCCCCCHHHHH Q ss_conf 999999998----73489889999 Q gi|254780149|r 12 FKQVRDESK----KIFWPSRSEVL 31 (67) Q Consensus 12 ~~ev~~Elk----kV~WPt~~e~~ 31 (67) ++|||.||| |=.||+=.=+. T Consensus 825 Y~EVkKEMKGRYPkH~WPDDPa~a 848 (858) T TIGR01970 825 YREVKKEMKGRYPKHVWPDDPANA 848 (858) T ss_pred CHHHHHHCCCCCCCCCCCCCHHHH T ss_conf 733531047886788788882330 No 14 >TIGR00907 2A0304 amino acid permease; InterPro: IPR004756 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell. A number of such proteins have been found to be evolutionary related , , . These proteins seem to contain up to 12 transmembrane segments. The best conserved region in this family is located in the second transmembrane segment.; GO: 0006865 amino acid transport, 0016021 integral to membrane. Probab=34.07 E-value=23 Score=17.36 Aligned_cols=30 Identities=20% Similarity=0.321 Sum_probs=26.1 Q ss_pred CCCCHHHHHHHHHHHHHHHHHHHHHHHHHH Q ss_conf 489889999999999999999999999999 Q gi|254780149|r 23 FWPSRSEVLVSVIVVIIMLSISSVFFLVID 52 (67) Q Consensus 23 ~WPt~~e~~~~T~~Vi~~~~i~~~~i~~~D 52 (67) .-|=-+|..+|+.+|+..+++++++-|..| T Consensus 457 ~~PVT~~NmNY~~Vv~~gvl~~sl~yW~~~ 486 (494) T TIGR00907 457 VLPVTPENMNYAVVVFAGVLIISLVYWLVK 486 (494) T ss_pred CCCCCCCCCCHHHHHHHHHHHHHHHHHHHC T ss_conf 899887644327899999999999998788 No 15 >pfam10766 DUF2592 Protein of unknown function (DUF2592). This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. Probab=26.82 E-value=58 Score=15.17 Aligned_cols=34 Identities=18% Similarity=0.374 Sum_probs=21.2 Q ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC Q ss_conf 9999999999999999999999999999971179 Q gi|254780149|r 34 VIVVIIMLSISSVFFLVIDQSIGWLMHFILGIGR 67 (67) Q Consensus 34 T~~Vi~~~~i~~~~i~~~D~~~~~~~~~i~~lgr 67 (67) -...++++-++...+.++=++++.++..+-++|| T Consensus 5 l~favimVPvvma~iLG~IyGLGEvfNifS~iG~ 38 (41) T pfam10766 5 LAFAVVMVPVVMAVILGLIYGLGEVFNIFSKIGR 38 (41) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC T ss_conf 8779988999999999999807999999974075 No 16 >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Probab=26.07 E-value=19 Score=17.79 Aligned_cols=19 Identities=21% Similarity=0.534 Sum_probs=15.6 Q ss_pred HHHHHHHHH-CCCCCHHHHH Q ss_conf 999999987-3489889999 Q gi|254780149|r 13 KQVRDESKK-IFWPSRSEVL 31 (67) Q Consensus 13 ~ev~~Elkk-V~WPt~~e~~ 31 (67) .|+|+++|+ -.|||-.|+. T Consensus 57 ~eiR~~lk~~s~WPT~PQLy 76 (105) T COG0278 57 PEIRQGLKEYSNWPTFPQLY 76 (105) T ss_pred HHHHHCCHHHCCCCCCCEEE T ss_conf 98985246445999864145 No 17 >PRK09039 hypothetical protein; Validated Probab=22.82 E-value=69 Score=14.74 Aligned_cols=22 Identities=27% Similarity=0.736 Sum_probs=18.8 Q ss_pred CCCCHHHHHHHHHHHHHHHHHH Q ss_conf 4898899999999999999999 Q gi|254780149|r 23 FWPSRSEVLVSVIVVIIMLSIS 44 (67) Q Consensus 23 ~WPt~~e~~~~T~~Vi~~~~i~ 44 (67) .||.+-+....-..|++|++.+ T Consensus 15 ~WPGfVDamAtLLmViIFvL~I 36 (343) T PRK09039 15 YWPGFVDALSTLLLVIMFLLTV 36 (343) T ss_pred CCHHHHHHHHHHHHHHHHHHHH T ss_conf 7734999999999999999999 Done!