RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780149|ref|YP_003064562.1| hypothetical protein CLIBASIA_00140 [Candidatus Liberibacter asiaticus str. psy62] (67 letters) >gnl|CDD|181055 PRK07597, secE, preprotein translocase subunit SecE; Reviewed. Length = 64 Score = 49.5 bits (119), Expect = 2e-07 Identities = 19/53 (35%), Positives = 34/53 (64%) Query: 10 NFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 FFK V+ E KK+ WP+R E++ S IVV++ ++ ++FF ++D L+ + Sbjct: 12 KFFKDVKAELKKVTWPTRKELVRSTIVVLVFVAFFALFFYLVDLLFSKLISLL 64 >gnl|CDD|162136 TIGR00964, secE_bact, preprotein translocase, SecE subunit, bacterial. This model represents exclusively the bacterial (and some organellar) SecE protein. SecE is part of the core heterotrimer, SecYEG, of the Sec preprotein translocase system. Other components are the ATPase SecA, a cytosolic chaperone SecB, and an accessory complex of SecDF and YajC. Length = 55 Score = 47.2 bits (113), Expect = 1e-06 Identities = 22/55 (40%), Positives = 33/55 (60%) Query: 8 VLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFI 62 + FFK+V+ E KK+ WPSR E++ IVVI+ + S+F +D G L+ I Sbjct: 1 IFKFFKEVKAELKKVVWPSRKELITYTIVVIVFVIFFSLFLFGVDYVFGKLISLI 55 >gnl|CDD|180229 PRK05740, secE, preprotein translocase subunit SecE; Reviewed. Length = 92 Score = 36.7 bits (86), Expect = 0.001 Identities = 19/58 (32%), Positives = 34/58 (58%) Query: 7 AVLNFFKQVRDESKKIFWPSRSEVLVSVIVVIIMLSISSVFFLVIDQSIGWLMHFILG 64 A F K+ R E +K+ WP+R E L + ++VI ++ + ++ +D + WL+ FI G Sbjct: 35 AFFAFAKESRTEVRKVVWPTRQETLQTTLIVIAVVIVMALILWGLDSILVWLISFITG 92 >gnl|CDD|178555 PLN02972, PLN02972, Histidyl-tRNA synthetase. Length = 763 Score = 26.8 bits (59), Expect = 1.2 Identities = 12/36 (33%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Query: 1 MGVNRLAVLNFFKQVRDESKKIFWPSRSEVLVSVIV 36 +G+ R V +Q +E ++ P+ +EVLVS+I Sbjct: 644 LGIER--VFAIMEQQEEEKSQVIRPTETEVLVSIIG 677 >gnl|CDD|179328 PRK01736, PRK01736, hypothetical protein; Reviewed. Length = 190 Score = 25.7 bits (57), Expect = 2.9 Identities = 7/11 (63%), Positives = 10/11 (90%) Query: 56 GWLMHFILGIG 66 GW+ HF+LG+G Sbjct: 105 GWVNHFLLGLG 115 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.334 0.146 0.434 Gapped Lambda K H 0.267 0.0744 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,045,706 Number of extensions: 50214 Number of successful extensions: 322 Number of sequences better than 10.0: 1 Number of HSP's gapped: 318 Number of HSP's successfully gapped: 48 Length of query: 67 Length of database: 5,994,473 Length adjustment: 38 Effective length of query: 29 Effective length of database: 5,173,369 Effective search space: 150027701 Effective search space used: 150027701 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.6 bits) S2: 50 (23.0 bits)