>cd01886 EF-G Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase). The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA. This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule. EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit. The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit. To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it. The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well. The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site. This group conta

Probab=100.00 E-value=1.7e-37 Score=251.60 Aligned_cols=134 Identities=28% Similarity=0.366 Sum_probs=117.4 Q ss_pred EEEEEECCCCCHHHHHHHHHHH------HHHHHHCCCCCCCCHHHHHCCCEEEEEEEEEECCCEEEEEEECCCCHHHHHH Q ss_conf 9999904689887899999987------6444200131268686986292063789998219908999847873024677 Q gi|254780150|r 14 GLSTIGHVDHGKTTLTAAITKY------YSEEKKEYGDIDSAPEEKLRGITIATAHVSYETDKRFYSHIDCPGHADYVKN 87 (392) Q Consensus 14 ni~~iGhvd~GKSTL~~~L~~~------~~~~~~~~~~~D~~~~E~~rGiTi~~~~~~~~~~~~~i~iiD~PGH~~f~~~ 87 (392) T Consensus 1 Niai~gH~gaGKTtL~EalL~~ag~i~r~G~v~~g~tv~D~~~eE~~R~isi~~~~~~~~w~~~~inliDTPG~~DF~~e 80 (270) T cd01886 1 NIGIIAHIDAGKTTTTERILYYTGRIHKIGEVHGGGATMDFMEQERERGITIQSAATTCFWKDHRINIIDTPGHVDFTIE 80 (270) T ss_pred CEEEEECCCCCHHHHHHHHHHHCCCCCCCCEECCCCCCCCCCHHHHHCCCEEECCEEEEEECCEEEEEEECCCCHHHHHH T ss_conf 98999689999889999999866873558155389755668488987687073366899989989999869696788999 Q ss_pred HHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCCEEEEECCCCCCC--CHHHHHHCCC Q ss_conf 987740023314520123443321067788886318760233100233356--1222110123 Q gi|254780150|r 88 MITGATQADGAILVCAAEDGPKPQTREHILLARQIGISSIVVYMNKVDAVD--DDELLDISEY 148 (392) Q Consensus 88 mi~g~~~~D~ailvVda~~G~~~QT~eh~~l~~~lgi~~iIv~iNKmD~v~--~~~~~~~i~~ 148 (392) T Consensus 81 ~~~aL~~~D~AviVv~a~~GVe~~T~~~w~~~~~~~lP~-i~fINKmDre~ad~~~~l~~i~~ 142 (270) T cd01886 81 VERSLRVLDGAVAVFDAVAGVEPQTETVWRQADRYNVPR-IAFVNKMDRTGADFFRVVEQIRE 142 (270) T ss_pred HHHHHHHHCEEEEEEECCCCHHHHHHHHHHHHHHCCCCE-EEEEECCCCCCCCCHHHHHHHHH T ss_conf 999987755599998467644263699998899849998-99998878778871668999999

HHsearch alignment for GI: 254780150 and conserved domain: cd01886