>cd03693 EF1_alpha_II EF1_alpha_II: this family represents the domain II of elongation factor 1-alpha (EF-1a) that is found in archaea and all eukaryotic lineages. EF-1A is very abundant in the cytosol, where it is involved in the GTP-dependent binding of aminoacyl-tRNAs to the A site of the ribosomes in the second step of translation from mRNAs to proteins. Both domain II of EF1A and domain IV of IF2/eIF5B have been implicated in recognition of the 3'-ends of tRNA. More than 61% of eukaryotic elongation factor 1A (eEF-1A) in cells is estimated to be associated with actin cytoskeleton. The binding of eEF1A to actin is a noncanonical function that may link two distinct cellular processes, cytoskeleton organization and gene expression.

Probab=99.87 E-value=3.1e-23 Score=163.16 Aligned_cols=90 Identities=33% Similarity=0.544 Sum_probs=84.6 Q ss_pred CCCCCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCC Q ss_conf 00011000000013554454301487424534896799950687432125412100121144321001366641124543 Q gi|254780150|r 204 LDAPFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRA 283 (392) Q Consensus 204 ~~~p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~ 283 (392) T Consensus 1 ~dkPlRmpId~vf~i~G~GtVvtG~v~~G~i~~gd~v~i~P~~---~~~~VksI~~~~~~~~~a~aGd~v~l~L~gi~~~ 77 (91) T cd03693 1 TDKPLRLPIQDVYKIGGIGTVPVGRVETGVLKPGMVVTFAPAG---VTGEVKSVEMHHEPLEEALPGDNVGFNVKNVSKK 77 (91) T ss_pred CCCCEEEEEEEEEECCCCEEEEEEEEEECEEECCCEEEECCCC---CEEEEEEEEECCCCCCEECCCCEEEEEECCCCHH T ss_conf 9987588998899729956999999811778579997727864---3379999999884958888998999998799899 Q ss_pred EEECHHEEECCCC Q ss_conf 2202117732677 Q gi|254780150|r 284 DVPRGRVVCAPGS 296 (392) Q Consensus 284 di~rGdvl~~~~~ 296 (392) T Consensus 78 ~i~rG~Vl~~~~n 90 (91) T cd03693 78 DIKRGDVAGDSKN 90 (91) T ss_pred HCCCCCEEECCCC T ss_conf 9267689955689

HHsearch alignment for GI: 254780150 and conserved domain: cd03693