>cd04089 eRF3_II eRF3_II: domain II of the eukaryotic class II release factor (eRF3). In eukaryotes, translation termination is mediated by two interacting release factors, eRF1 and eRF3, which act as class I and II factors, respectively. eRF1 functions as an omnipotent release factor, decoding all three stop codons and triggering the release of the nascent peptide catalyzed by the ribsome. eRF3 is a GTPase, which enhances the termination efficiency by stimulating the eRF1 activity in a GTP-dependent manner. Sequence comparison of class II release factors with elongation factors shows that eRF3 is more similar to eEF1alpha whereas prokaryote RF3 is more similar to EF-G, implying that their precise function may differ. Only eukaryote RF3s are found in this group. Saccharomyces cerevisiae eRF3 (Sup35p) is a translation termination factor which is divided into three regions N, M and a C-terminal eEF1a-like region essential for translation termination. Sup35NM is a non-pathogenic prion-li

Probab=99.81 E-value=8.6e-21 Score=147.99 Aligned_cols=82 Identities=28% Similarity=0.450 Sum_probs=77.7 Q ss_pred CCCEECCCCCCCCCCCCCEEEEEEECCCCCCCEEEEEECCCCCCCEEEECCCCCCCCCCCCCCCHHHHHHHCCCCCCEEE Q ss_conf 11000000013554454301487424534896799950687432125412100121144321001366641124543220 Q gi|254780150|r 207 PFLMHIEGSCGIEGRGTVVTGCIKRGRIKAGSDVEIIGMGGKKLKVKCTDVEMFRKKLDEAIAGDNVGLLLRGVNRADVP 286 (392) Q Consensus 207 p~r~~I~~vf~i~g~G~Vv~GrV~sG~l~~Gd~i~i~p~~~~~~~~kv~si~~~~~~v~~a~aGd~v~l~Lkgi~~~di~ 286 (392) T Consensus 1 PlR~pi~dv~k--g~G~vV~G~vesG~v~~Gd~v~i~P~~---~~~~Vk~I~~~~~~v~~A~aGd~V~l~L~gvd~~~i~ 75 (82) T cd04089 1 PLRLPIIDKYK--DMGTVVLGKVESGTIKKGDKLLVMPNK---TQVEVLSIYNEDVEVRYARPGENVRLRLKGIEEEDIS 75 (82) T ss_pred CEEEEEEEEEE--CCCEEEEEEEEEEEECCCCEEEEECCC---CEEEEEEEEECCEEECEECCCCCEEEEECCCCHHHCC T ss_conf 97826878992--898899999936778299999995899---8899999999997958886997326888488888447 Q ss_pred CHHEEEC Q ss_conf 2117732 Q gi|254780150|r 287 RGRVVCA 293 (392) Q Consensus 287 rGdvl~~ 293 (392) T Consensus 76 rG~vlcs 82 (82) T cd04089 76 PGFVLCS 82 (82) T ss_pred CCCEECC T ss_conf 8879959

HHsearch alignment for GI: 254780150 and conserved domain: cd04089