HHsearch alignment for GI: 254780151 and conserved domain: COG0367

>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism].
Probab=98.07  E-value=1.7e-05  Score=59.89  Aligned_cols=110  Identities=25%  Similarity=0.257  Sum_probs=68.2

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCC-CEEEE-EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH-H
Q ss_conf             3889999609857999999998869-84999-9987047876655557788189999999999980995898170788-6
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDG-YDVIG-VTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER-F   96 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G-~~V~g-~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~-f   96 (408)
T Consensus       230 dvpvg~~lSGGlDSS~Iaa~a~~~~~~~~~~~fsvg~~~~~-----------~~D~~~a~~~A~~lg~~h~~~~~~~~e~  298 (542)
T COG0367         230 DVPVGVFLSGGLDSSLIAAIAAEELGKEGKTTFTVGFEDSD-----------SPDAKYARAVAKFLGTPHHEIILTNEEL  298 (542)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCC-----------CCHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             88789996776229999999998623455215898548999-----------7079999999998599857996178999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             632244112678708861200001541105888887401687645225311
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
T Consensus       299 ~~~----~~~vv~~~~~p~~~~~~---~ply~~~~~a~~~g~kVvLSGeGA  342 (542)
T COG0367         299 LNA----LPEVVKALDTPGGMAAS---IPLYLLSRKARAEGEKVVLSGEGA  342 (542)
T ss_pred             HHH----HHHHHHHHCCCCCCHHH---HHHHHHHHHHHHCCCEEEECCCCH
T ss_conf             999----99999870788620045---799999987653387898238748