HHsearch alignment for GI: 254780151 and conserved domain: COG0519

>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism].
Probab=99.66  E-value=7.7e-16  Score=133.88  Aligned_cols=165  Identities=26%  Similarity=0.319  Sum_probs=115.1

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH-HHHHCCCCEEECC
Q ss_conf             788863388999960985799999999886-98499999870478766555577881899999999-9998099589817
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR-VCDTINVSHYVFD   91 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~-va~~LgI~~~~~d   91 (408)
T Consensus        15 ir~~vg~~kvi~alSGGVDSsv~a~L~~~AiGd~l~cvfVD~---GLlR~~E--------~e~V~~~f~~~~~~nl~~Vd   83 (315)
T COG0519          15 IREQVGDGKVILALSGGVDSSVAAVLAHRAIGDQLTCVFVDH---GLLRKGE--------AEQVVEMFREHLGLNLIVVD   83 (315)
T ss_pred             HHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCEEEEEECC---CCCCCCC--------HHHHHHHHHHHCCCCEEEEC
T ss_conf             999728853999833878089999999997405248999637---7434785--------69999998753298459975


Q ss_pred             HHHHHHHH---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC-CCCEEEECCCCCCCEEEEEECC
Q ss_conf             07886632---2441126787088612000015411058888874016876452253-1102541267877316885315
Q gi|254780151|r   92 YEERFRNA---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH-YIRSRLYVGDDGKRRRIMCRPM  167 (408)
Q Consensus        92 ~~~~f~~~---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~~  167 (408)
T Consensus        84 A~~~Fl~~L~GvtDPE~KRKiIG~~---------F--i~VFe~ea~k~~~~~LaQGTiYpDvIES~~g~--~-~~IKSHH  149 (315)
T COG0519          84 AKDRFLSALKGVTDPEEKRKIIGRE---------F--IEVFEEEAKKLGAEFLAQGTIYPDVIESGTGK--A-GTIKSHH  149 (315)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHH---------H--HHHHHHHHHHCCCCEEEECCCCCCEEEECCCC--C-CCCCCCC
T ss_conf             4988998843999889989998799---------9--99999999857860687044345046506888--8-8621356


Q ss_pred             CCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             78787318986302022100334256899789899997412543
Q gi|254780151|r  168 DLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       168 D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
T Consensus       150 NV--------GGLP~~m~lkLvEPLr~LfKDEVR~lg~~LGlp~  185 (315)
T COG0519         150 NV--------GGLPEDMKLKLVEPLRELFKDEVRELGRELGLPE  185 (315)
T ss_pred             CC--------CCCCCCCCEEEEHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             26--------8895014222307789886899999999859988