HHsearch alignment for GI: 254780151 and conserved domain: COG3969

>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only].
Probab=93.42  E-value=0.11  Score=32.46  Aligned_cols=37  Identities=35%  Similarity=0.530  Sum_probs=27.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHH----HCCCEEEEEEEECCCC
Q ss_conf             889999609857999999998----8698499999870478
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLK----RDGYDVIGVTLQLYNS   57 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~----~~G~~V~g~~m~~~~~   57 (408)
T Consensus        28 ~~VcVSFSGGKDS~lmLhL~~~~ar~~~~~~i~VlfiD~E~   68 (407)
T COG3969          28 PRVCVSFSGGKDSGLMLHLVAEVARENGRDKISVLFIDWEA   68 (407)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHH
T ss_conf             83899923787405899999999998198865799970045