HHsearch alignment for GI: 254780151 and conserved domain: PRK00074

>PRK00074 guaA GMP synthase; Reviewed.
Probab=99.75  E-value=1.4e-17  Score=146.29  Aligned_cols=167  Identities=23%  Similarity=0.308  Sum_probs=116.6

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH-HHCCCCEEECC
Q ss_conf             788863388999960985799999999886-9849999987047876655557788189999999999-98099589817
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC-DTINVSHYVFD   91 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va-~~LgI~~~~~d   91 (408)
T Consensus       210 Ik~~Vg~~kVi~~lSGGVDStV~A~Ll~kAIGd~l~cvfVD~---GllRk--------nE~~~V~~~~~~~lgl~~~~vd  278 (513)
T PRK00074        210 IREQVGDKKVILGLSGGVDSSVAAVLLHKAIGDQLTCVFVDH---GLLRK--------NEAEQVMEMFREHFGLNLIHVD  278 (513)
T ss_pred             HHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCEEEEEECC---CCCCC--------CCHHHHHHHHHHHCCCCEEEEE
T ss_conf             999838762899723883089999999998511248999537---71116--------7299999999886199679922


Q ss_pred             HHHHHHHH---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC-CCCEECCCC-CCCEEEECCCCCCCEEEEEEC
Q ss_conf             07886632---2441126787088612000015411058888874016-876452253-110254126787731688531
Q gi|254780151|r   92 YEERFRNA---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL-GADVLATGH-YIRSRLYVGDDGKRRRIMCRP  166 (408)
Q Consensus        92 ~~~~f~~~---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~-g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~  166 (408)
T Consensus       279 A~~~Fl~~L~gv~DPE~KRKIIG~~---------FI--~vfe~~a~~~~~~~~L~QGTlYPDvIES~~~~-~~a~~IKsH  346 (513)
T PRK00074        279 ASDRFLSALAGVTDPEEKRKIIGRE---------FI--EVFEEEAKKLGGVKFLAQGTLYPDVIESASGT-GKAATIKSH  346 (513)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHH---------HH--HHHHHHHHHCCCCCEEECCCCCCCEEEECCCC-CCCCCCCCC
T ss_conf             4899999737998979967887789---------99--99999997579983996467655068847989-998860487


Q ss_pred             CCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             578787318986302022100334256899789899997412543
Q gi|254780151|r  167 MDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       167 ~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
T Consensus       347 HN--------Vgglp~~~~~~lvEPlr~lfKDEVR~lg~~Lglp~  383 (513)
T PRK00074        347 HN--------VGGLPEDMKLKLVEPLRELFKDEVRKLGLELGLPE  383 (513)
T ss_pred             CC--------CCCCHHHCCCEEEEEHHHHCCHHHHHHHHHHCCCH
T ss_conf             75--------87885664875450317561589999999968977