HHsearch alignment for GI: 254780151 and conserved domain: PRK08557

>PRK08557 hypothetical protein; Provisional.
Probab=98.57  E-value=7.6e-07  Score=69.51  Aligned_cols=165  Identities=18%  Similarity=0.193  Sum_probs=106.0

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
T Consensus       183 ~~pV~VSfSGGKDS~a~L~La~~a~~~~~vvF~DTGl---E--------fPeT~eyve~~~~~~~~~l~~~~-~~~fw~~  250 (420)
T PRK08557        183 GYAINASFSGGKDSAVSTLLSKEVIPDLDVVFIDTGL---E--------YPETLNYVKDFAKKYDINLDTVD-GDNFWDN  250 (420)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCC---C--------CHHHHHHHHHHHHHCCCCEEEEC-CHHHHHH
T ss_conf             9746996068789999999999854881699962887---7--------72389999999998099679965-4668988


Q ss_pred             CCCCCHHHHHCCCCCCCE-ECCCCEEEHHHHHHHHCCC-CCCEE--CCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             244112678708861200-0015411058888874016-87645--2253110254126787731688531578787318
Q gi|254780151|r  100 VIVPFASSYAAGETPLPC-VDCNRTVKFSDLLSVTRQL-GADVL--ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc-~~CN~~iKF~~l~~~a~~~-g~~~i--ATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
T Consensus       251 ~~-------~~G-pP~rd~RWCc~v~Kl~Pl~~~i~~~~~~~~vl~~~G~--R~~-----ES-----~~R~~~~~~~~~-  309 (420)
T PRK08557        251 LE-------KEG-IPTKDNRWCNSACKLMPLKRYLKKKYGNKKVLTIDGS--RKY-----ES-----FTRANLDYERKS-  309 (420)
T ss_pred             HH-------HCC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEE--CHH-----HH-----HHHHCCCCCCCC-
T ss_conf             77-------549-9976672507431017899999985789875999970--145-----40-----766058741347-


Q ss_pred             EEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCH-HHCCCEEEC
Q ss_conf             98630202210033425689978989999741254---3551-110230111
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADK-SDSQDICFV  223 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K-~eSqgICFi  223 (408)
T Consensus       310 ---~~v~~q~--~~~PI~~Wsa~~VwLYI~~~~l~~NplY~~Gf~RvG-C~~  355 (420)
T PRK08557        310 ---GFIDFQT--NVFPILDWNSLDIWSYIFSNDILYNPMYDKGFERIG-CYL  355 (420)
T ss_pred             ---CCCCCCE--EEEHHHCCCHHHHHHHHHHCCCCCCHHHHCCCCCCC-EEE
T ss_conf             ---7766650--353153260769999999759999848866876367-770