HHsearch alignment for GI: 254780151 and conserved domain: PRK09431

>PRK09431 asnB asparagine synthetase B; Provisional.
Probab=97.91  E-value=3.7e-05  Score=57.40  Aligned_cols=122  Identities=18%  Similarity=0.166  Sum_probs=62.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCE-EEEEEE-ECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             388999960985799999999886984-999998-704787665555778818999999999998099589817078866
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYD-VIGVTL-QLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~-V~g~~m-~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
T Consensus       227 DvpvG~~LSGGLDSSlIaala~k~~~~~~~~~~~~~~~~~~l~tFsiG~~-~s~D~~~Ar~vA~~lgt~h~ei~~t~~d~  305 (555)
T PRK09431        227 DVPYGVLLSGGLDSSLISAIAKKYAARRIEDDERSEAWWPQLHSFAVGLE-GSPDLKAAREVADYLGTVHHEIHFTVQEG  305 (555)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCC-CCCHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             88624320577067999999998520244332222234678753660479-98149999999998299565999547999


Q ss_pred             HHCCCCCHHHHHCCCCCCCEE-CCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             322441126787088612000-01541105888887401687645225311
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCV-DCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~-~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
T Consensus       306 ~~~l~~vi~~---lE~~d~~~~~a--sip~yllsk~i~~~gvKVvLSGeGA  351 (555)
T PRK09431        306 LDALRDVIYH---LETYDVTTIRA--STPMYLMSRKIKAMGIKMVLSGEGA  351 (555)
T ss_pred             HHHHHHHHHH---HHCCCCCCHHH--HHHHHHHHHHHHHCCCEEEEECCCH
T ss_conf             9999999987---41468750256--8999999999996398799927750