HHsearch alignment for GI: 254780151 and conserved domain: cd01523

>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily. This CD includes predicted proteins with rhodanese-like domains found N-terminal of the metallo-beta-lactamase domain.
Probab=90.05  E-value=0.7  Score=26.84  Aligned_cols=36  Identities=39%  Similarity=0.458  Sum_probs=28.5

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             888633889999609857999999998869849999
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
T Consensus        56 ~~lp~d~~ivv~C~~G~rS~~aa~~L~~~G~~v~~L   91 (100)
T cd01523          56 DQLPDDQEVTVICAKEGSSQFVAELLAERGYDVDYL   91 (100)
T ss_pred             HHCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             647899839999289656999999999879837983