HHsearch alignment for GI: 254780151 and conserved domain: cd01991

>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .
Probab=98.52  E-value=4.2e-07  Score=71.34  Aligned_cols=113  Identities=24%  Similarity=0.229  Sum_probs=73.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             338899996098579999999988698-4999998704787665555778818999999999998099589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
T Consensus        14 sd~~vg~~LSGGlDSs~ia~~~~~~~~~~~~~~s~~~~~~-----------~~de~~~a~~va~~~~~~~~~i~~~~~~~   82 (269)
T cd01991          14 SDVPVGVLLSGGLDSSLVAALAARLLPEPVKTFSIGFGFE-----------GSDEREYARRVAEHLGTEHHEVEFTPADL   82 (269)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEECCCC-----------CCCHHHHHHHHHHHCCCCCEEEECCHHHH
T ss_conf             4885686513569999999999983689984799862899-----------97378999999998098824531434889


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             322441126787088612000015411058888874016876452253110
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
T Consensus        83 ~~~~~~~---~~~~~~p~~~~~~--~~-~~~l~~~a~~~g~~VllsG~GgD  127 (269)
T cd01991          83 LAALPDV---IWELDEPFADSSA--IP-LYLLSRLARKHGIKVVLSGEGAD  127 (269)
T ss_pred             HHHHHHH---HHHHCCCCHHHHH--HH-HHHHHHHHHHCCCEEEEECCCHH
T ss_conf             9999999---9986396012547--89-99999999853977999677614