HHsearch alignment for GI: 254780151 and conserved domain: cd01994

>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domainhas a strongly conserved motif SGGKD at the N terminus.
Probab=98.54  E-value=1.3e-06  Score=67.84  Aligned_cols=162  Identities=15%  Similarity=0.146  Sum_probs=89.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEE-EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999988698499999-8704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVT-LQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~-m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
T Consensus         1 Kv~~l~SGGKDS~lAl~~a~~~g~~v~~L~~~~~~~~~~-~~-----~H~~~~~l~~~qAealgiPl~~~~~~~~-----   69 (194)
T cd01994           1 KVVALISGGKDSCYALYRALEEGHEVVALLNLTPEEGSS-MM-----YHTVNHELLELQAEAMGIPLIRIEISGE-----   69 (194)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEEEECCCCCE-EE-----CCCCCHHHHHHHHHHCCCCEEEEECCCC-----
T ss_conf             989997785999999999998699259999996399880-52-----5055789999999985996699966898-----


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEE
Q ss_conf             44112678708861200001541105888887401687645225311025412678773168853157878731898630
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT  180 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l  180 (408)
T Consensus        70 ~~~~~~~------------------l~~~L~~~k~~gi~~vv~GdI~---s~-~qr-~~~e~~c~~l-------------  113 (194)
T cd01994          70 EEDEVED------------------LKELLRKLKEEGVDAVVFGAIL---SE-YQR-TRVERVCERL-------------  113 (194)
T ss_pred             CCHHHHH------------------HHHHHHHHHHCCCCEEEECCCC---CH-HHH-HHHHHHHHHC-------------
T ss_conf             7179999------------------9999999997599599999633---28-899-9999999973-------------


Q ss_pred             CCHHHCEEECCCCCCCHHHHHHHHHHCCCC-CCCHHHCCCE--EECCCCCCHHHHHH
Q ss_conf             202210033425689978989999741254-3551110230--11127751034553
Q gi|254780151|r  181 TQQQLCDLRFPLGDMKKESVRDLAREMGLD-IADKSDSQDI--CFVQQGKYFDVVKR  234 (408)
Q Consensus       181 ~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~-~a~K~eSqgI--CFi~~~~~~~Fl~~  234 (408)
T Consensus       114 ----gl~~~~PLW~~~~~~ll~e~i~~Gf~aiiv~V~a~~L~~~~lGr~id~~~~~~  166 (194)
T cd01994         114 ----GLEPLAPLWGRDQEELLREMIEAGFKAIIIKVAAEGLDESWLGREIDEMFIEL  166 (194)
T ss_pred             ----CCEEECHHCCCCHHHHHHHHHHCCCEEEEEEEECCCCCHHHCCCCCCHHHHHH
T ss_conf             ----98887001079999999999987990999995026899689598804868999