HHsearch alignment for GI: 254780151 and conserved domain: cd01996

>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which binds to Adenosine group. This subfamily of proteins is predicted to bind ATP. This domain has a strongly conserved motif SGGKD at the N terminus.
Probab=98.93  E-value=5.5e-09  Score=84.86  Aligned_cols=113  Identities=19%  Similarity=0.306  Sum_probs=83.4

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             8999960985799999999886-984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
T Consensus         3 DcIVpvSGGKDS~y~~~~lk~kyglnpL~Vt~~~~---~--------~t~~g~~Nl~nl~~~-g~D~~~~~~~~~~~~~l   70 (154)
T cd01996           3 DCIIGVSGGKDSSYALYLLKEKYGLNPLAVTVDNG---F--------NSEEAVKNIKNLIKK-GLDLDHLVINPEEMKDL   70 (154)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCC---C--------CCHHHHHHHHHHHHC-CCCEEEEECCHHHHHHH
T ss_conf             78996888818999999999994996599996798---7--------546899999999974-99816993288899999


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEE
Q ss_conf             441126787088612000015411058888874016876452253110254
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRL  151 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~  151 (408)
T Consensus        71 ~---~-~~~~~~~gd~~~~~~~~i-~~~~~~~A~k~~IplIi~Gen~~~e~  116 (154)
T cd01996          71 Q---L-ARFKAKVGDPCWPCDTAI-FTSLYKVALKFGIPLIITGENPAQEF  116 (154)
T ss_pred             H---H-HHHHHCCCCCHHHHHHHH-HHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             9---9-999844799348899879-98999999993999899727835514