HHsearch alignment for GI: 254780151 and conserved domain: cd01997

>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes.
Probab=99.70  E-value=4.6e-16  Score=135.46  Aligned_cols=159  Identities=29%  Similarity=0.372  Sum_probs=109.1

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH-HHCCCCEEECCHHHHHHHH
Q ss_conf             8999960985799999999886-9849999987047876655557788189999999999-9809958981707886632
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC-DTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va-~~LgI~~~~~d~~~~f~~~   99 (408)
T Consensus         1 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVDn---GlmRk~--------E~e~V~~~~~~~~~~~~~~vdas~~Fl~~   69 (295)
T cd01997           1 KVILALSGGVDSTVAAVLLHKAIGDRLTCVFVDN---GLLRKN--------EAERVEELFSKLLGINLIVVDASERFLSA   69 (295)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHCCEEEEEECC---CCCCCC--------CHHHHHHHHHHHCCCCEEEECHHHHHHHH
T ss_conf             9899905782899999999988650569999858---978888--------29999999987069977995669999998


Q ss_pred             ---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCC-CCEECCCC-CCCEEEECCCCCCCEEEEEECCCCCCCCE
Q ss_conf             ---24411267870886120000154110588888740168-76452253-11025412678773168853157878731
Q gi|254780151|r  100 ---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG-ADVLATGH-YIRSRLYVGDDGKRRRIMCRPMDLERDQS  174 (408)
Q Consensus       100 ---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g-~~~iATGH-Yar~~~~~~~~~~~~~~L~r~~D~~KDQS  174 (408)
T Consensus        70 L~gv~DPE~KRKiIG~~---------Fi--~vf~~~~~~~~~~~~L~QGTlyPDvIES~~~~~~-a~~IKsHHNv-----  132 (295)
T cd01997          70 LKGVTDPEEKRKIIGET---------FI--EVFEEEAKKLGLAEYLAQGTLYPDVIESGSGKGS-ADTIKSHHNV-----  132 (295)
T ss_pred             HCCCCCHHHHHHHHHHH---------HH--HHHHHHHHHCCCCCEEEECCCCCCEEECCCCCCC-CCEEEEECCC-----
T ss_conf             65877925636565389---------99--9999999755886189724302625750788888-7514522456-----


Q ss_pred             EEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             8986302022100334256899789899997412543
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
T Consensus       133 ---ggLp~~~~~kliEPLr~LfKDEVR~lG~~LGlp~  166 (295)
T cd01997         133 ---GGLPEDMKLKLIEPLRDLFKDEVRELGRELGLPE  166 (295)
T ss_pred             ---CCCCHHCCCCCCHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             ---7772322654001678874599999999868978