Query         gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 408
No_of_seqs    150 out of 2273
Neff          5.8 
Searched_HMMs 39220
Date          Sun May 22 14:25:00 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780151.hhm -d /home/congqian_1/database/cdd/Cdd.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK00143 trmU tRNA (5-methylam 100.0       0       0  977.7  35.6  352   17-386     1-354 (355)
  2 pfam03054 tRNA_Me_trans tRNA m 100.0       0       0  962.2  34.8  347   21-383     1-354 (354)
  3 cd01998 tRNA_Me_trans tRNA met 100.0       0       0  957.1  35.1  345   22-383     1-349 (349)
  4 TIGR00420 trmU tRNA (5-methyla 100.0       0       0  934.5  24.5  355   21-383     1-394 (394)
  5 COG0482 TrmU Predicted tRNA(5- 100.0       0       0  883.0  30.4  350   18-386     1-355 (356)
  6 KOG2805 consensus              100.0       0       0  808.6  29.3  363   17-390     2-374 (377)
  7 cd01712 ThiI ThiI is required  100.0 2.1E-32 5.5E-37  252.4  10.6  169   22-227     1-175 (177)
  8 cd01990 Alpha_ANH_like_I This   99.9 1.7E-21 4.4E-26  174.3  11.1  162   23-230     1-165 (202)
  9 TIGR00884 guaA_Cterm GMP synth  99.8 7.4E-20 1.9E-24  162.7  11.2  165   13-210     9-187 (319)
 10 pfam02568 ThiI Thiamine biosyn  99.8 1.5E-18 3.9E-23  153.2  12.1  166   20-227     3-179 (197)
 11 TIGR00268 TIGR00268 conserved   99.8 1.3E-18 3.4E-23  153.7  10.0  167   18-230    13-184 (263)
 12 PRK00074 guaA GMP synthase; Re  99.8 1.4E-17 3.6E-22  146.3  11.3  167   14-211   210-383 (513)
 13 COG1606 ATP-utilizing enzymes   99.7   7E-18 1.8E-22  148.5   8.2  160   19-225    15-178 (269)
 14 cd01997 GMP_synthase_C The C-t  99.7 4.6E-16 1.2E-20  135.5  12.9  159   22-211     1-166 (295)
 15 PRK00919 GMP synthase subunit   99.7 7.6E-17 1.9E-21  141.1   8.5  158   14-211    14-178 (306)
 16 COG0519 GuaA GMP synthase, PP-  99.7 7.7E-16   2E-20  133.9  10.3  165   14-211    15-185 (315)
 17 cd01993 Alpha_ANH_like_II This  99.7 3.1E-16 7.9E-21  136.7   7.8  165   22-212     1-175 (185)
 18 pfam02540 NAD_synthase NAD syn  99.6 1.7E-14 4.4E-19  124.2  11.2  159   19-222    17-183 (243)
 19 COG0037 MesJ tRNA(Ile)-lysidin  99.6   1E-14 2.6E-19  125.8   9.0  163   20-212    21-189 (298)
 20 PRK00876 nadE NAD synthetase;   99.5 1.7E-13 4.3E-18  117.1  12.3  169   17-221    30-250 (325)
 21 cd00553 NAD_synthase NAD+ synt  99.5 2.8E-14 7.1E-19  122.7   7.5  166   16-222    19-192 (248)
 22 PRK13980 NAD synthetase; Provi  99.5 1.8E-13 4.5E-18  117.0   9.4  158   19-222    27-192 (264)
 23 pfam01171 ATP_bind_3 PP-loop f  99.5   2E-13   5E-18  116.7   7.5  167   22-222     1-174 (182)
 24 cd01992 PP-ATPase N-terminal d  99.4 4.9E-13 1.3E-17  113.8   7.6  174   22-234     1-181 (185)
 25 pfam06508 ExsB ExsB. This fami  99.4 1.4E-12 3.5E-17  110.6   9.5  113   22-145     1-120 (137)
 26 PRK08349 hypothetical protein;  99.4 9.8E-13 2.5E-17  111.7   8.5  169   21-226     1-175 (198)
 27 PRK05370 argininosuccinate syn  99.4 3.1E-12   8E-17  108.1  10.4  168   15-224     6-199 (447)
 28 PRK13820 argininosuccinate syn  99.4 2.9E-12 7.4E-17  108.3  10.1  165   19-220     2-176 (395)
 29 PRK10696 C32 tRNA thiolase; Pr  99.4 1.1E-12 2.9E-17  111.2   7.6  205   12-256    31-253 (311)
 30 PRK00509 argininosuccinate syn  99.4 4.4E-12 1.1E-16  107.0  10.5  166   20-220     2-178 (398)
 31 PRK04527 argininosuccinate syn  99.4 8.7E-12 2.2E-16  104.9  10.6  167   19-219     2-179 (397)
 32 COG0137 ArgG Argininosuccinate  99.4 2.7E-11 6.8E-16  101.4  13.0  173   18-224     2-184 (403)
 33 TIGR02432 lysidine_TilS_N tRNA  99.3 1.8E-11 4.5E-16  102.7   9.5  167   22-222     1-193 (204)
 34 PRK13981 NAD synthetase; Provi  99.3   5E-12 1.3E-16  106.6   6.6  167    3-209   264-435 (543)
 35 pfam00764 Arginosuc_synth Argi  99.3 2.7E-11 6.8E-16  101.4   9.9  160   24-219     1-171 (389)
 36 COG1365 Predicted ATPase (PP-l  99.3 9.3E-12 2.4E-16  104.7   7.2  151   13-211    52-204 (255)
 37 KOG1622 consensus               99.3 2.3E-11 5.9E-16  101.9   9.1  167   19-212   229-407 (552)
 38 PRK10660 tilS tRNA(Ile)-lysidi  99.3 3.9E-11   1E-15  100.2   8.8  168   19-223    12-187 (433)
 39 PRK01565 thiamine biosynthesis  99.2 7.1E-11 1.8E-15   98.3   9.5  167   20-226   176-351 (399)
 40 cd01999 Argininosuccinate_Synt  99.2 7.7E-11   2E-15   98.1   9.3  164   23-220     1-175 (385)
 41 COG0171 NadE NAD synthase [Coe  99.2 8.3E-11 2.1E-15   97.9   9.2  162   17-221    22-198 (268)
 42 COG0603 Predicted PP-loop supe  99.2 9.3E-11 2.4E-15   97.5   9.0  171   19-210     1-179 (222)
 43 PRK00768 nadE NAD synthetase;   99.2 1.2E-10 3.1E-15   96.7   8.8  160   19-221    39-215 (274)
 44 TIGR00364 TIGR00364 exsB prote  99.2 3.8E-11 9.6E-16  100.3   5.7  164   24-208     2-189 (227)
 45 TIGR00032 argG argininosuccina  99.2 2.9E-10 7.4E-15   94.0   9.8  171   22-225     1-191 (420)
 46 TIGR00342 TIGR00342 thiamine b  99.1 9.5E-10 2.4E-14   90.3   9.0  166   20-225   186-361 (391)
 47 PRK11106 queuosine biosynthesi  99.1 8.6E-10 2.2E-14   90.6   8.6  165   21-208     2-176 (231)
 48 PTZ00323 NAD+ synthase; Provis  99.1 3.7E-09 9.4E-14   86.1  11.3  164   19-221    45-224 (294)
 49 TIGR03573 WbuX N-acetyl sugar   99.0 2.6E-09 6.6E-14   87.2   8.5  110   21-147    60-170 (343)
 50 PRK01269 thiamine biosynthesis  99.0 2.3E-09 5.9E-14   87.5   7.8  162   20-223   177-346 (483)
 51 cd01995 ExsB ExsB is a transcr  99.0 3.5E-09   9E-14   86.2   8.6  139   22-211     1-140 (169)
 52 COG0301 ThiI Thiamine biosynth  98.9 5.3E-09 1.4E-13   84.9   8.7  153   19-212   174-336 (383)
 53 cd01996 Alpha_ANH_like_III Thi  98.9 5.5E-09 1.4E-13   84.9   8.2  113   22-151     3-116 (154)
 54 PRK02628 nadE NAD synthetase;   98.9   3E-09 7.7E-14   86.7   6.8  198   19-265   361-580 (678)
 55 pfam01507 PAPS_reduct Phosphoa  98.9 6.7E-08 1.7E-12   77.1  12.9  154   22-211     1-155 (174)
 56 KOG1706 consensus               98.8 2.7E-07 6.8E-12   72.8  11.9  164   19-222     4-186 (412)
 57 cd01986 Alpha_ANH_like Adenine  98.7 3.1E-08   8E-13   79.4   6.8   71   23-147     1-71  (103)
 58 TIGR00552 nadE NAD+ synthetase  98.7 7.1E-08 1.8E-12   76.9   8.0  169   14-224    20-209 (286)
 59 cd01713 PAPS_reductase This do  98.6 7.4E-07 1.9E-11   69.6  11.6  156   22-211     1-161 (173)
 60 PRK13795 hypothetical protein;  98.6 4.2E-07 1.1E-11   71.3   9.3  166   20-223   245-417 (630)
 61 COG2117 Predicted subunit of t  98.6 1.2E-07 3.2E-12   75.1   6.2  171   21-236     1-172 (198)
 62 PRK08557 hypothetical protein;  98.6 7.6E-07 1.9E-11   69.5   9.8  165   20-223   183-355 (420)
 63 PRK13794 hypothetical protein;  98.6 1.1E-06 2.8E-11   68.4  10.5  171   20-231   245-426 (473)
 64 cd01994 Alpha_ANH_like_IV This  98.5 1.3E-06 3.3E-11   67.8  10.3  162   22-234     1-166 (194)
 65 cd01991 Asn_Synthase_B_C The C  98.5 4.2E-07 1.1E-11   71.3   7.5  113   19-148    14-127 (269)
 66 pfam01902 ATP_bind_4 ATP-bindi  98.5 1.4E-06 3.6E-11   67.6   9.7   92   21-145     1-93  (219)
 67 pfam00733 Asn_synthase Asparag  98.4 1.2E-06 2.9E-11   68.2   7.5  110   19-146    16-126 (195)
 68 COG0175 CysH 3'-phosphoadenosi  98.3   3E-05 7.5E-10   58.1  12.4  154   22-211    41-196 (261)
 69 COG2102 Predicted ATPases of P  98.3 1.1E-05 2.7E-10   61.3   9.6   93   21-145     1-94  (223)
 70 PRK08384 thiamine biosynthesis  98.2 5.3E-06 1.4E-10   63.5   7.6  124   20-209   179-308 (310)
 71 PRK08576 hypothetical protein;  98.2 4.6E-06 1.2E-10   63.9   6.9  169   11-223   226-403 (439)
 72 TIGR01536 asn_synth_AEB aspara  98.2 7.5E-06 1.9E-10   62.4   7.7  119   19-145   310-440 (646)
 73 COG0367 AsnB Asparagine syntha  98.1 1.7E-05 4.3E-10   59.9   7.2  110   20-147   230-342 (542)
 74 KOG2840 consensus               98.0 1.8E-05 4.6E-10   59.7   6.5  123   12-148    43-174 (347)
 75 PTZ00077 asparagine synthetase  98.0 5.3E-05 1.4E-09   56.3   8.6  123   20-147   237-389 (610)
 76 TIGR00289 TIGR00289 conserved   98.0 2.4E-05 6.1E-10   58.8   6.8   97   21-145     1-97  (227)
 77 PRK05253 sulfate adenylyltrans  98.0 0.00012 3.1E-09   53.7  10.3  164   21-212    27-205 (300)
 78 TIGR03108 eps_aminotran_1 exos  98.0 4.2E-05 1.1E-09   57.0   7.5  110   20-148   258-368 (628)
 79 TIGR03104 trio_amidotrans aspa  97.9 2.6E-05 6.6E-10   58.5   6.2  110   20-145   260-371 (589)
 80 PRK09431 asnB asparagine synth  97.9 3.7E-05 9.5E-10   57.4   6.6  122   20-147   227-351 (555)
 81 PRK12563 sulfate adenylyltrans  97.9 0.00028 7.2E-09   51.1  10.5  164   21-212    38-216 (312)
 82 cd01984 AANH_like Adenine nucl  97.6 8.6E-05 2.2E-09   54.8   4.2   57   23-149     1-60  (86)
 83 KOG0571 consensus               97.2  0.0014 3.5E-08   46.2   6.5  108   18-145   223-341 (543)
 84 pfam02677 DUF208 Uncharacteriz  97.2  0.0016 4.1E-08   45.7   6.8  105   24-144     2-111 (176)
 85 PRK02090 phosphoadenosine phos  96.7   0.027 6.8E-07   37.0   9.7  159   21-219    42-202 (243)
 86 COG1636 Uncharacterized protei  96.4   0.028 7.1E-07   36.9   8.3  110   19-144     2-117 (204)
 87 TIGR03183 DNA_S_dndC putative   95.6   0.032 8.2E-07   36.4   5.5  113   22-145    15-146 (447)
 88 KOG2316 consensus               95.5   0.051 1.3E-06   34.9   6.2   73   21-94      1-74  (277)
 89 PRK06850 hypothetical protein;  95.4   0.043 1.1E-06   35.5   5.5  112   22-144    23-153 (488)
 90 KOG0573 consensus               95.3   0.049 1.3E-06   35.1   5.7   70   19-92    249-327 (520)
 91 cd01987 USP_OKCHK USP domain i  94.8    0.43 1.1E-05   28.3   9.3   92   22-148     1-96  (124)
 92 COG3969 Predicted phosphoadeno  93.4    0.11 2.9E-06   32.5   4.0   37   21-57     28-68  (407)
 93 KOG2303 consensus               92.6    0.57 1.4E-05   27.5   6.6  174   22-211   351-562 (706)
 94 pfam02353 CMAS Cyclopropane-fa  91.8     1.2 3.2E-05   25.1   8.8  141   20-212    63-213 (273)
 95 TIGR02823 oxido_YhdH putative   91.2    0.45 1.1E-05   28.2   4.7  170    9-237   139-319 (330)
 96 cd02930 DCR_FMN 2,4-dienoyl-Co  91.1     1.4 3.6E-05   24.6   7.3   16  126-141   139-154 (353)
 97 cd01523 RHOD_Lact_B Member of   90.0     0.7 1.8E-05   26.8   4.9   36   15-50     56-91  (100)
 98 TIGR02539 SepCysS Sep-tRNA:Cys  89.5    0.36 9.2E-06   28.9   3.1   67   41-149   143-213 (381)
 99 PRK10512 selenocysteinyl-tRNA-  89.5     1.9 4.9E-05   23.7   8.7  110  258-385   227-339 (615)
100 TIGR02039 CysD sulfate adenyly  89.3       2 5.1E-05   23.6   9.3  165   24-210    23-196 (295)
101 cd02931 ER_like_FMN Enoate red  89.2     1.3 3.2E-05   25.0   5.7   45  298-342   332-381 (382)
102 PRK09955 rihB ribonucleoside h  88.4     2.3 5.8E-05   23.1   8.4   57   19-85      2-59  (313)
103 TIGR01289 LPOR light-dependent  87.5     1.7 4.3E-05   24.1   5.4  106   19-147     3-116 (321)
104 cd02649 nuc_hydro_CeIAG nuc_hy  87.1     2.7 6.9E-05   22.6   8.2   58   21-88      1-62  (306)
105 cd01518 RHOD_YceA Member of th  86.5     1.4 3.5E-05   24.8   4.5   36   15-50     56-92  (101)
106 cd01524 RHOD_Pyr_redox Member   86.4    0.81 2.1E-05   26.4   3.3   35   16-50     47-81  (90)
107 cd01534 4RHOD_Repeat_3 Member   86.4     1.2 3.2E-05   25.0   4.3   33   18-50     54-86  (95)
108 TIGR02639 ClpA ATP-dependent C  86.4     1.7 4.4E-05   24.0   5.0   69   26-105   501-573 (774)
109 PRK04148 hypothetical protein;  85.6     2.5 6.4E-05   22.9   5.5   91   21-144    18-109 (135)
110 TIGR00290 MJ0570_dom MJ0570-re  85.6     0.8 2.1E-05   26.4   3.0   69   21-89      1-69  (265)
111 TIGR02017 hutG_amidohyd N-form  85.4     0.6 1.5E-05   27.3   2.3   57   83-152    14-70  (269)
112 PRK10443 rihA ribonucleoside h  85.2     3.3 8.5E-05   22.0   8.0   59   21-89      3-65  (311)
113 PRK13982 bifunctional SbtC-lik  83.5     3.4 8.6E-05   21.9   5.4   39   13-51     64-105 (476)
114 cd01522 RHOD_1 Member of the R  83.1     2.2 5.5E-05   23.3   4.3   33   18-50     62-95  (117)
115 PRK10768 ribonucleoside hydrol  81.9     4.5 0.00011   21.0   8.2   55   20-84      2-57  (304)
116 cd01976 Nitrogenase_MoFe_alpha  81.2     4.7 0.00012   20.9   6.2   55   27-92     79-138 (421)
117 cd01528 RHOD_2 Member of the R  80.7     2.8 7.2E-05   22.5   4.2   36   14-49     52-88  (101)
118 COG2895 CysN GTPases - Sulfate  80.0     5.2 0.00013   20.6  11.3  247   77-393   131-422 (431)
119 PRK00162 glpE thiosulfate sulf  79.5       3 7.7E-05   22.3   4.0   34   17-50     55-89  (104)
120 cd01444 GlpE_ST GlpE sulfurtra  78.2     3.7 9.3E-05   21.7   4.1   32   17-48     53-85  (96)
121 TIGR02884 spore_pdaA delta-lac  77.4    0.85 2.2E-05   26.2   0.7   41   97-150    36-78  (225)
122 cd01519 RHOD_HSP67B2 Member of  77.4       3 7.6E-05   22.3   3.4   32   15-46     61-92  (106)
123 PRK08305 spoVFB dipicolinate s  77.3     6.2 0.00016   20.1   5.3   36   17-52      2-41  (195)
124 COG0821 gcpE 1-hydroxy-2-methy  77.2     6.2 0.00016   20.1   6.9   90   30-139    34-125 (361)
125 PRK04000 translation initiatio  77.1     6.2 0.00016   20.0   9.8   55  329-384   355-410 (410)
126 pfam07894 DUF1669 Protein of u  77.1     6.2 0.00016   20.0   5.4   11  197-207   136-146 (284)
127 COG1103 Archaea-specific pyrid  77.1     6.2 0.00016   20.0   5.2   13  355-367   343-355 (382)
128 COG1957 URH1 Inosine-uridine n  76.9     6.3 0.00016   20.0   7.5   59   20-88      2-64  (311)
129 PRK12736 elongation factor Tu;  76.4     6.5 0.00017   19.9   8.6  112  262-386   269-392 (394)
130 PRK05579 bifunctional phosphop  75.8     6.5 0.00017   19.9   4.8   33   19-51      3-38  (392)
131 TIGR00977 LeuA_rel 2-isopropyl  75.1    0.94 2.4E-05   25.9   0.4   86   31-143    83-173 (543)
132 cd04734 OYE_like_3_FMN Old yel  74.5     7.2 0.00018   19.6   6.9   12  129-140   146-157 (343)
133 cd01526 RHOD_ThiF Member of th  74.3     5.4 0.00014   20.5   4.1   29   18-46     70-98  (122)
134 PRK07313 phosphopantothenoylcy  73.1     7.3 0.00019   19.5   4.5   32   20-51      2-36  (180)
135 cd01533 4RHOD_Repeat_2 Member   72.6     6.6 0.00017   19.9   4.2   32   19-50     65-98  (109)
136 PRK08762 molybdopterin biosynt  72.3     7.1 0.00018   19.6   4.3   67   17-106    55-129 (379)
137 KOG2594 consensus               72.2     8.2 0.00021   19.2   4.9  171   17-210    59-264 (396)
138 PRK12317 elongation factor 1-a  71.8     8.3 0.00021   19.1   8.1   70   17-115     2-74  (426)
139 PRK12769 putative oxidoreducta  71.7     8.4 0.00021   19.1   7.4   29   19-48    326-354 (654)
140 pfam02441 Flavoprotein Flavopr  71.5     8.4 0.00021   19.1   4.7   30   21-50      1-33  (118)
141 COG2910 Putative NADH-flavin r  70.5     8.8 0.00023   18.9   4.5   60   21-84      1-61  (211)
142 PRK05134 3-demethylubiquinone-  69.8     9.1 0.00023   18.8   6.6  155   17-225    46-211 (233)
143 PRK07878 molybdopterin biosynt  69.7     7.3 0.00019   19.5   3.9  118   16-144    38-164 (392)
144 cd01532 4RHOD_Repeat_1 Member   69.2     8.9 0.00023   18.9   4.2   32   19-50     49-83  (92)
145 CHL00071 tufA elongation facto  68.9     9.5 0.00024   18.7   8.8   34  348-386   374-407 (409)
146 COG3349 Uncharacterized conser  68.8     7.6 0.00019   19.4   3.8   30   21-51      1-30  (485)
147 KOG3141 consensus               68.3     9.8 0.00025   18.6   4.4   69  240-308   163-268 (310)
148 TIGR02468 sucrsPsyn_pln sucros  66.4     1.1 2.9E-05   25.3  -0.8  312   73-403   198-642 (1072)
149 cd01521 RHOD_PspE2 Member of t  66.1     6.5 0.00017   19.9   3.1   32   16-47     60-93  (110)
150 cd02654 nuc_hydro_CjNH nuc_hyd  65.5      11 0.00028   18.3   8.0   53   22-84      1-58  (318)
151 KOG0117 consensus               64.8     4.8 0.00012   20.9   2.1  124   76-246   100-234 (506)
152 TIGR03099 dCO2ase_PEP1 pyridox  64.7      11 0.00029   18.1   4.6   28   64-96     99-126 (398)
153 cd01529 4RHOD_Repeats Member o  64.6      11 0.00029   18.1   4.4   33   17-49     53-86  (96)
154 PRK06249 2-dehydropantoate 2-r  64.2      12  0.0003   18.1   4.2   34   16-50      1-34  (313)
155 PRK05597 molybdopterin biosynt  64.1      11 0.00028   18.2   3.9  115   17-142    25-148 (355)
156 cd01447 Polysulfide_ST Polysul  62.6      11 0.00027   18.3   3.6   29   18-46     59-87  (103)
157 TIGR03471 HpnJ hopanoid biosyn  62.0      13 0.00032   17.8   6.5   28   22-51     48-75  (472)
158 cd02650 nuc_hydro_CaPnhB NH_hy  62.0      13 0.00032   17.8   7.8   53   22-84      1-54  (304)
159 COG2205 KdpD Osmosensitive K+   61.7      13 0.00033   17.8   9.0   66   21-91    249-318 (890)
160 pfam03686 UPF0146 Uncharacteri  61.7     8.8 0.00023   18.9   3.1   76   35-144    27-102 (127)
161 PRK12721 secretion system appa  61.1      13 0.00034   17.7   5.6   54  136-215   254-310 (349)
162 cd02653 nuc_hydro_3 NH_3: A su  60.8      13 0.00034   17.7   8.1   57   22-88      1-61  (320)
163 COG0607 PspE Rhodanese-related  60.4      11 0.00027   18.4   3.3   32   17-48     58-89  (110)
164 PRK08118 topology modulation p  60.2      10 0.00027   18.4   3.2   56   74-149    16-71  (167)
165 cd00455 nuc_hydro nuc_hydro: N  60.0      14 0.00035   17.6   7.5   51   24-84      2-53  (295)
166 pfam03853 YjeF_N YjeF-related   60.0      14 0.00035   17.6   7.4   64   18-92     26-92  (170)
167 cd05565 PTS_IIB_lactose PTS_II  59.9      14 0.00035   17.6   7.1   72   21-92      1-80  (99)
168 PRK08655 prephenate dehydrogen  59.7      14 0.00035   17.5   4.1   47   21-87      1-48  (441)
169 TIGR01108 oadA oxaloacetate de  59.4     3.9 9.9E-05   21.5   0.9  208   20-298   286-525 (616)
170 KOG0622 consensus               58.4      15 0.00037   17.4   4.6   72   65-140   130-209 (448)
171 TIGR01369 CPSaseII_lrg carbamo  57.4      15 0.00039   17.3   5.2   19  127-145   768-786 (1089)
172 PRK10792 bifunctional 5,10-met  56.9      15 0.00039   17.2   4.4  116   73-227    51-169 (288)
173 PRK05653 fabG 3-ketoacyl-(acyl  56.9      15 0.00039   17.2   6.9   60   18-94      3-65  (246)
174 PRK09074 consensus              56.9     9.8 0.00025   18.6   2.6   18   23-40    135-152 (1149)
175 COG1908 FrhD Coenzyme F420-red  56.2      16  0.0004   17.1   6.0  106    4-116    13-128 (132)
176 PRK12772 bifunctional flagella  55.7      16 0.00041   17.1   5.5   49  137-211   518-568 (609)
177 pfam01156 IU_nuc_hydro Inosine  55.3      16 0.00042   17.0   7.9   54   21-84      1-55  (303)
178 pfam05724 TPMT Thiopurine S-me  55.2      16 0.00042   17.0   3.9   32   18-52     21-52  (203)
179 TIGR01511 ATPase-IB1_Cu copper  55.1      16 0.00042   17.0   4.7   12   41-52    135-146 (545)
180 COG0452 Dfp Phosphopantothenoy  54.6      17 0.00043   17.0   4.5   31   20-50      4-37  (392)
181 COG0163 UbiX 3-polyprenyl-4-hy  54.0      17 0.00043   16.9   4.5   32   20-51      2-36  (191)
182 PRK10490 sensor protein KdpD;   54.0      17 0.00044   16.9   9.4   68   19-91    249-320 (895)
183 PRK08133 O-succinylhomoserine   54.0      17 0.00044   16.9   8.0  100   22-146    77-185 (391)
184 PRK06767 methionine gamma-lyas  53.8      17 0.00044   16.9   8.5   97   22-144    77-183 (386)
185 COG0458 CarB Carbamoylphosphat  53.4      17 0.00044   16.8   5.3  221   20-313     5-239 (400)
186 pfam08959 DUF1872 Domain of un  53.2      18 0.00045   16.8   4.6   30  324-353   139-168 (288)
187 cd06839 PLPDE_III_Btrk_like Ty  52.4      18 0.00046   16.7   4.8   37  244-283   254-290 (382)
188 PRK05920 aromatic acid decarbo  52.2      18 0.00046   16.7   5.1   33   19-51      3-38  (205)
189 COG2230 Cfa Cyclopropane fatty  52.0      18 0.00047   16.7   7.9  138   20-212    73-219 (283)
190 cd06843 PLPDE_III_PvsE_like Ty  52.0      18 0.00047   16.7   4.1   31   64-98     75-105 (377)
191 PRK07411 hypothetical protein;  51.9      16  0.0004   17.2   3.0  115   17-142    35-158 (390)
192 PRK07671 cystathionine beta-ly  51.6      19 0.00047   16.6   8.5   99   22-146    66-173 (377)
193 COG1852 Uncharacterized conser  50.9      11 0.00028   18.3   2.1   39  110-149   107-147 (209)
194 pfam07022 Phage_CI_repr Bacter  50.8     6.1 0.00016   20.1   0.8   44   77-145    16-61  (65)
195 KOG0336 consensus               50.7      14 0.00037   17.4   2.6  143   97-249   195-358 (629)
196 COG0309 HypE Hydrogenase matur  50.7      16 0.00041   17.1   2.9   78  197-278   255-335 (339)
197 pfam01261 AP_endonuc_2 Xylose   50.4      19 0.00049   16.5   4.6   83   38-144     2-84  (201)
198 cd02648 nuc_hydro_1 NH_1: A su  50.3      19 0.00049   16.5   7.4   56   21-86      2-59  (367)
199 cd00158 RHOD Rhodanese Homolog  50.3      14 0.00035   17.6   2.5   29   17-45     47-75  (89)
200 COG4848 Uncharacterized protei  50.0     8.4 0.00021   19.1   1.4  114  163-285   117-262 (265)
201 PRK13255 thiopurine S-methyltr  48.9      20 0.00052   16.4   3.8   32   18-52     36-67  (218)
202 PRK07667 uridine kinase; Provi  48.4      17 0.00044   16.9   2.8   40   17-56      9-54  (190)
203 cd01988 Na_H_Antiporter_C The   48.4      21 0.00053   16.3   7.5   99   22-148     1-105 (132)
204 PRK12809 putative oxidoreducta  47.8      21 0.00054   16.2   7.4   16   33-48    322-337 (639)
205 PRK06395 phosphoribosylamine--  47.7      21 0.00054   16.2   5.2   85   20-106     2-87  (435)
206 PRK12735 elongation factor Tu;  47.3      21 0.00055   16.2   9.1   34  348-386   361-394 (396)
207 COG2217 ZntA Cation transport   46.9      22 0.00055   16.1   4.5   31  361-394   515-545 (713)
208 COG1004 Ugd Predicted UDP-gluc  46.7      22 0.00056   16.1   3.9   31   21-52      1-31  (414)
209 PRK00049 elongation factor Tu;  46.7      22 0.00056   16.1   8.9   34  348-386   362-395 (397)
210 TIGR01048 lysA diaminopimelate  46.7      22 0.00056   16.1   6.0  120   64-223   107-242 (431)
211 COG1832 Predicted CoA-binding   46.5      15 0.00038   17.3   2.2   61   22-97     19-81  (140)
212 COG1179 Dinucleotide-utilizing  45.8      23 0.00058   16.0   9.4  120   19-147    29-156 (263)
213 PRK08064 cystathionine beta-ly  45.5      23 0.00058   16.0   7.2   99   23-146    71-177 (390)
214 pfam01053 Cys_Met_Meta_PP Cys/  45.4      23 0.00058   16.0   8.0   97   23-145    69-175 (381)
215 PRK00409 recombination and DNA  45.2      23 0.00058   16.0   3.0   43  104-151   410-452 (780)
216 PRK00081 coaE dephospho-CoA ki  45.1      23 0.00059   16.0   3.1   29   21-49      1-31  (199)
217 TIGR02630 xylose_isom_A xylose  44.6      14 0.00037   17.4   1.9  167   79-293    87-303 (437)
218 KOG1468 consensus               44.5      24  0.0006   15.9   4.6   14  252-265   261-274 (354)
219 PRK00455 pyrE orotate phosphor  43.7      24 0.00062   15.8   6.3   26   27-52    121-146 (200)
220 TIGR02477 PFKA_PPi diphosphate  43.4      19 0.00049   16.5   2.3  145   68-232   152-320 (566)
221 PRK06298 type III secretion sy  43.4      24 0.00062   15.8   6.0   50  137-212   256-307 (360)
222 KOG0250 consensus               43.1      25 0.00063   15.7   2.9   74   22-96     65-190 (1074)
223 PRK10287 thiosulfate:cyanide s  43.0      25 0.00063   15.7   3.6   29   18-46     58-86  (104)
224 PRK09484 3-deoxy-D-manno-octul  42.9      25 0.00063   15.7   4.5   44   32-94     56-99  (186)
225 TIGR02635 RhaI_grampos L-rhamn  42.8      18 0.00045   16.8   2.1   41   71-119    69-109 (382)
226 PRK06029 3-octaprenyl-4-hydrox  42.7      25 0.00064   15.7   4.7   30   21-50      2-35  (187)
227 TIGR01472 gmd GDP-mannose 4,6-  42.6      22 0.00057   16.0   2.6   95   30-137    10-122 (365)
228 PRK05994 O-acetylhomoserine am  42.6      25 0.00064   15.7   8.9   99   23-146    80-192 (426)
229 TIGR02855 spore_yabG sporulati  42.5      15 0.00039   17.2   1.8   41   73-119   126-166 (292)
230 PRK06849 hypothetical protein;  42.4      25 0.00064   15.7   6.8   75   21-97      5-89  (387)
231 cd02651 nuc_hydro_IU_UC_XIUA n  42.3      25 0.00065   15.7   8.2   57   23-89      2-62  (302)
232 pfam01312 Bac_export_2 FlhB Hr  42.3      25 0.00065   15.7   6.6   50  137-212   257-308 (343)
233 PRK12921 2-dehydropantoate 2-r  42.3      25 0.00065   15.7   3.7   30   21-51      1-30  (306)
234 PRK07810 O-succinylhomoserine   42.2      25 0.00065   15.7   7.7   96   22-142    89-193 (406)
235 COG0324 MiaA tRNA delta(2)-iso  42.1      23 0.00059   16.0   2.6   59   23-94      7-67  (308)
236 PRK08134 O-acetylhomoserine am  42.0      26 0.00065   15.6   7.9   94   23-142    81-184 (433)
237 COG4189 Predicted transcriptio  41.9      14 0.00036   17.5   1.5   16   76-91     40-55  (308)
238 TIGR01404 FlhB_rel_III type II  41.6      14 0.00036   17.5   1.5   13  198-210   295-307 (346)
239 cd02067 B12-binding B12 bindin  41.6      26 0.00066   15.6   8.3  103   22-143     1-108 (119)
240 PRK00885 phosphoribosylamine--  41.5      26 0.00067   15.6   4.5  116   21-147     1-121 (424)
241 PRK08247 cystathionine gamma-s  41.4      26 0.00067   15.6   7.3   98   22-145    68-174 (366)
242 KOG2666 consensus               41.4      19 0.00049   16.5   2.1   42   65-113   269-310 (481)
243 COG1435 Tdk Thymidine kinase [  41.4      26 0.00067   15.6   3.2   15   38-52     26-40  (201)
244 PRK09552 mtnX 2-hydroxy-3-keto  41.3      26 0.00067   15.6   3.4   47   73-127    78-124 (219)
245 TIGR02315 ABC_phnC phosphonate  41.3      26 0.00067   15.6   5.1   26   12-37     21-46  (253)
246 pfam09778 Guanylate_cyc_2 Guan  41.3      26 0.00067   15.6   8.2   58   36-93     51-112 (212)
247 pfam05005 Ocnus Janus/Ocnus fa  41.3      11 0.00029   18.1   0.9   12  376-387    63-74  (109)
248 PRK07811 cystathionine gamma-s  41.2      26 0.00067   15.6   9.2   99   23-146    75-182 (386)
249 cd01527 RHOD_YgaP Member of th  41.1      26 0.00067   15.5   3.8   31   16-46     50-80  (99)
250 COG2012 RPB5 DNA-directed RNA   40.8      25 0.00065   15.7   2.6   54  184-248     9-63  (80)
251 PRK12814 putative NADPH-depend  40.3      27 0.00069   15.5   7.6   32   18-50    191-222 (652)
252 PRK06176 cystathionine gamma-s  40.1      27  0.0007   15.4   7.3   95   22-142    66-169 (379)
253 cd02929 TMADH_HD_FMN Trimethyl  39.8      28  0.0007   15.4   7.8   44  300-344   318-366 (370)
254 pfam00551 Formyl_trans_N Formy  39.7      28 0.00071   15.4   5.7   57   21-94      1-60  (181)
255 TIGR00416 sms DNA repair prote  39.7     9.9 0.00025   18.6   0.4   19  128-146   229-247 (481)
256 PRK12468 flhB flagellar biosyn  39.4      28 0.00071   15.4   5.6   53  137-215   262-317 (383)
257 TIGR02653 Lon_rel_chp conserve  39.3      20 0.00051   16.4   1.9   21  185-205   420-440 (677)
258 pfam05766 NinG Bacteriophage L  39.3      13 0.00034   17.6   1.0   23   98-123    73-95  (188)
259 PRK13237 tyrosine phenol-lyase  38.7      29 0.00073   15.3   6.4   81   25-112   155-235 (459)
260 PRK08229 2-dehydropantoate 2-r  38.7      29 0.00073   15.3   3.7   30   21-51      3-32  (341)
261 PRK08156 surface presentation   38.7      29 0.00073   15.3   5.8   53  137-215   250-305 (367)
262 smart00829 PKS_ER Enoylreducta  38.6      29 0.00073   15.3   4.8   61   19-100   104-167 (288)
263 PRK10985 putative hydrolase; P  38.0      29 0.00075   15.2   6.3   33   25-57     65-100 (325)
264 TIGR01632 L11_bact ribosomal p  37.8      17 0.00042   17.0   1.3   15  192-206    98-112 (144)
265 PRK05647 purN phosphoribosylgl  37.6      30 0.00076   15.2   7.6   54   21-92      2-59  (200)
266 COG4548 NorD Nitric oxide redu  37.4      30 0.00076   15.2   3.5   18  116-133   104-121 (637)
267 PRK13210 putative L-xylulose 5  37.4      30 0.00076   15.1   6.0   93   36-143    21-113 (284)
268 PRK13109 flhB flagellar biosyn  37.4      30 0.00076   15.1   5.9   13  198-210   301-313 (358)
269 PRK08776 cystathionine gamma-s  37.3      30 0.00077   15.1   8.3   95   22-141    76-179 (405)
270 pfam02037 SAP SAP domain. The   37.2      28  0.0007   15.4   2.4   24  193-216     2-25  (35)
271 cd03087 PGM_like1 This archaea  36.9      30 0.00078   15.1   8.6   31   19-49     32-66  (439)
272 PRK13435 response regulator; P  36.8      31 0.00078   15.1   6.0   54   20-92      1-54  (141)
273 PRK12771 putative glutamate sy  36.8      31 0.00078   15.1   4.8   33   17-50    134-166 (560)
274 PRK13828 rimM 16S rRNA-process  36.7      31 0.00078   15.1   3.2   54  244-298   105-167 (177)
275 PRK06242 flavodoxin; Provision  36.1      31  0.0008   15.0   7.4   18   73-90     16-33  (150)
276 TIGR00655 PurU formyltetrahydr  36.1      23 0.00059   16.0   1.8  108   21-149    93-236 (294)
277 PRK13789 phosphoribosylamine--  36.0      31  0.0008   15.0   6.4   85   19-105     3-89  (426)
278 smart00450 RHOD Rhodanese Homo  35.8      32 0.00081   15.0   3.2   28   19-46     55-82  (100)
279 PRK13209 L-xylulose 5-phosphat  35.7      32 0.00081   15.0   5.5   94   34-142    24-117 (283)
280 PRK05506 bifunctional sulfate   35.7      32 0.00081   15.0   8.0   99  281-388   293-418 (613)
281 cd00293 USP_Like Usp: Universa  35.4      32 0.00082   14.9   7.8   98   22-148     1-104 (130)
282 cd01968 Nitrogenase_NifE_I Nit  35.3      32 0.00082   14.9   6.1   53   26-91     66-124 (410)
283 TIGR00521 coaBC_dfp phosphopan  35.1      32 0.00083   14.9   4.4   34   19-52      2-38  (418)
284 LOAD_USPA consensus             35.1      32 0.00083   14.9  10.5   97   21-148     1-108 (135)
285 KOG1198 consensus               34.7      33 0.00084   14.9   3.7   58   19-98    157-220 (347)
286 pfam07498 Rho_N Rho terminatio  33.6      20 0.00051   16.4   1.2   31  192-222     2-32  (43)
287 COG0223 Fmt Methionyl-tRNA for  33.4      34 0.00088   14.7   6.4   65   21-94      2-68  (307)
288 PRK07050 cystathionine beta-ly  33.0      35 0.00089   14.7   8.4   98   22-144    81-187 (394)
289 TIGR02764 spore_ybaN_pdaB poly  33.0      33 0.00085   14.8   2.2   83  179-266    96-196 (198)
290 TIGR01326 OAH_OAS_sulfhy O-ace  32.9      35 0.00089   14.7   6.0  188   25-286    76-275 (434)
291 TIGR02733 desat_CrtD C-3',4' d  32.7      35  0.0009   14.6   3.5   76   24-115     4-98  (499)
292 COG1089 Gmd GDP-D-mannose dehy  32.6      35  0.0009   14.6   4.3   28   25-53      8-35  (345)
293 cd00614 CGS_like CGS_like: Cys  32.5      36 0.00091   14.6   7.8   96   22-143    56-161 (369)
294 PRK13238 tnaA tryptophanase; P  32.3      36 0.00091   14.6   6.0   81   25-112   155-235 (461)
295 cd02022 DPCK Dephospho-coenzym  32.2      36 0.00092   14.6   2.5   26   24-49      1-28  (179)
296 TIGR02821 fghA_ester_D S-formy  32.2      22 0.00056   16.1   1.2   29  175-210    47-75  (279)
297 pfam04748 Polysacc_deac_2 Dive  32.0      36 0.00092   14.6   2.4   27   22-48     22-49  (213)
298 pfam12017 Transposase_37 Trans  31.9      36 0.00093   14.5   3.5   25  253-280   163-187 (236)
299 pfam01121 CoaE Dephospho-CoA k  31.8      36 0.00093   14.5   2.9   27   23-49      1-29  (179)
300 PRK03333 coaE dephospho-CoA ki  31.8      37 0.00093   14.5   3.3   52  168-222   121-173 (394)
301 pfam11684 DUF3280 Protein of u  31.7      32 0.00081   15.0   1.9   35  104-146    55-89  (140)
302 cd02647 nuc_hydro_TvIAG nuc_hy  31.7      37 0.00093   14.5   7.3   56   21-84      1-57  (312)
303 PRK12928 lipoyl synthase; Prov  31.5      34 0.00087   14.7   2.1   34   14-49     11-44  (290)
304 PRK08813 threonine dehydratase  31.2      37 0.00095   14.5   2.8   26   22-47     82-107 (349)
305 TIGR01761 thiaz-red thiazoliny  30.8      38 0.00096   14.4   6.1  101   16-137    68-182 (378)
306 cd06831 PLPDE_III_ODC_like_AZI  30.7      38 0.00097   14.4   4.5   30   64-97     86-115 (394)
307 PRK09590 celB cellobiose phosp  30.7      38 0.00097   14.4   7.0   73   21-94      2-85  (104)
308 PRK07226 fructose-bisphosphate  30.5      38 0.00097   14.4   7.2   41   43-90    105-145 (266)
309 pfam01976 DUF116 Protein of un  30.1      30 0.00076   15.2   1.6   30  116-146    66-96  (158)
310 pfam03848 TehB Tellurite resis  30.1      39 0.00099   14.3   5.1   55   21-95     32-89  (192)
311 PRK05451 dihydroorotase; Provi  30.1      39 0.00099   14.3   6.6   41  105-145    99-139 (345)
312 KOG0776 consensus               30.0      29 0.00074   15.2   1.5   22   23-44     28-49  (384)
313 TIGR02815 agaS_fam putative su  29.7      22 0.00057   16.1   0.9  139   16-207    40-195 (374)
314 pfam01933 UPF0052 Uncharacteri  29.3      40   0.001   14.3   3.1   34   24-58      1-34  (291)
315 TIGR01235 pyruv_carbox pyruvat  29.3      40   0.001   14.2   4.0  175   41-247   775-972 (1169)
316 COG3867 Arabinogalactan endo-1  29.2      40   0.001   14.2   5.2  128   73-231    65-195 (403)
317 cd03706 mtEFTU_III Domain III   29.1      40   0.001   14.2   6.4   39  343-386    54-93  (93)
318 PRK05708 2-dehydropantoate 2-r  29.1      40   0.001   14.2   3.7   32   20-52      2-33  (305)
319 cd07583 nitrilase_5 Uncharacte  28.9      41   0.001   14.2   4.3  123  125-293    20-143 (253)
320 TIGR02723 phenyl_P_alpha pheny  28.9      39 0.00098   14.4   2.0   70  117-199   112-189 (485)
321 KOG1372 consensus               28.8      41   0.001   14.2   2.8   35   19-54     26-62  (376)
322 pfam02879 PGM_PMM_II Phosphogl  28.7      41   0.001   14.2   7.5   34   19-52     19-52  (103)
323 PRK07588 hypothetical protein;  28.5      41  0.0011   14.2   3.9   29   21-50      1-29  (391)
324 pfam11303 DUF3105 Protein of u  28.4      15 0.00039   17.2  -0.1   15  193-207   103-117 (130)
325 COG4930 Predicted ATP-dependen  28.3      31 0.00079   15.0   1.4   24  184-207   425-448 (683)
326 TIGR01307 pgm_bpd_ind 2,3-bisp  28.2      42  0.0011   14.1   6.2   72   24-101   118-204 (529)
327 pfam04310 MukB MukB N-terminal  28.1      39 0.00099   14.3   1.9   30   24-54     29-62  (227)
328 PRK05967 cystathionine beta-ly  28.1      42  0.0011   14.1   9.6   97   23-144    81-186 (392)
329 pfam03447 NAD_binding_3 Homose  27.9      42  0.0011   14.1   3.2  105   29-140     3-113 (116)
330 PRK12831 putative oxidoreducta  27.8      42  0.0011   14.1   7.6   31   19-50    139-169 (464)
331 PRK06852 aldolase; Validated    27.8      42  0.0011   14.1   6.0   78    7-91     97-174 (303)
332 PRK07012 consensus              27.7      43  0.0011   14.1   2.3   19   22-40    127-145 (1173)
333 TIGR00011 YbaK_EbsC ybaK/ebsC   27.6      43  0.0011   14.0   3.6   79   36-142     3-84  (156)
334 TIGR01430 aden_deam adenosine   27.5      43  0.0011   14.0   2.5   46   76-124    19-70  (346)
335 PRK08166 NADH dehydrogenase su  27.4      28 0.00071   15.4   1.0   10  358-367   801-810 (858)
336 PRK07681 aspartate aminotransf  27.4      43  0.0011   14.0   3.9   72   39-122    26-100 (399)
337 cd01454 vWA_norD_type norD typ  27.4      43  0.0011   14.0   3.5   14   81-94     34-47  (174)
338 PRK05481 lipoyl synthase; Prov  27.0      39 0.00099   14.3   1.7   34   14-49      3-36  (289)
339 COG0665 DadA Glycine/D-amino a  26.9      44  0.0011   14.0   4.5   30   19-50      4-33  (387)
340 cd06828 PLPDE_III_DapDC Type I  26.9      44  0.0011   14.0   6.3   30   65-98     79-108 (373)
341 cd06840 PLPDE_III_Bif_AspK_Dap  26.7      44  0.0011   13.9   5.0   18  353-370   329-346 (368)
342 pfam02585 PIG-L GlcNAc-PI de-N  26.5      45  0.0011   13.9   5.4   54   38-94     19-73  (111)
343 TIGR00551 nadB L-aspartate oxi  26.4      45  0.0011   13.9   2.8   46  178-223   267-315 (546)
344 PRK06522 2-dehydropantoate 2-r  26.4      45  0.0011   13.9   4.0   30   21-51      1-30  (307)
345 PRK08961 bifunctional aspartat  26.4      45  0.0011   13.9   5.0   12  359-370   830-841 (865)
346 TIGR00151 ispF 2C-methyl-D-ery  26.4      45  0.0011   13.9   5.4   58   29-93     72-133 (159)
347 TIGR01127 ilvA_1Cterm threonin  26.3      44  0.0011   14.0   1.9   42  328-369   307-356 (381)
348 PRK12342 putative electron tra  26.3      45  0.0011   13.9   5.1   18  128-145   100-117 (254)
349 PRK05784 phosphoribosylamine--  26.2      45  0.0011   13.9   5.6   83   21-105     1-90  (485)
350 PRK06084 O-acetylhomoserine am  26.2      45  0.0012   13.9   8.6   95   22-142    74-178 (424)
351 PRK13256 thiopurine S-methyltr  26.2      45  0.0012   13.9   4.4   53   18-92     42-94  (226)
352 TIGR00017 cmk cytidylate kinas  26.1      27 0.00069   15.5   0.8   17  128-144    59-75  (223)
353 PRK00122 rimM 16S rRNA-process  26.0      45  0.0012   13.9   2.8   54  244-298   106-167 (168)
354 PRK05702 flhB flagellar biosyn  26.0      45  0.0012   13.9   6.0   50  137-212   262-313 (352)
355 COG4536 CorB Putative Mg2+ and  25.9      30 0.00076   15.2   1.0   66  176-254   246-312 (423)
356 cd00617 Tnase_like Tryptophana  25.9      46  0.0012   13.8   6.5   81   25-112   130-210 (431)
357 COG1255 Uncharacterized protei  25.6      46  0.0012   13.8   4.3   73   36-142    28-100 (129)
358 TIGR02483 PFK_mixed phosphofru  25.4      47  0.0012   13.8   2.6   34   23-58    109-143 (339)
359 pfam12396 DUF3659 Protein of u  25.4      38 0.00097   14.4   1.4   14  242-255    12-25  (64)
360 cd03084 phosphohexomutase The   25.3      47  0.0012   13.8   7.3   15   88-102    87-101 (355)
361 PRK12550 shikimate 5-dehydroge  25.3      47  0.0012   13.8   6.3   67   18-102     6-75  (272)
362 COG1231 Monoamine oxidase [Ami  25.3      47  0.0012   13.8   4.3   36   16-52      3-38  (450)
363 cd01449 TST_Repeat_2 Thiosulfa  25.2      47  0.0012   13.8   3.6   27  196-226    62-88  (118)
364 PRK01184 hypothetical protein;  25.2      47  0.0012   13.8   2.9   26   24-49      3-30  (183)
365 PRK00870 haloalkane dehalogena  24.9      48  0.0012   13.7   7.0   72   16-87     41-116 (302)
366 PRK05294 carB carbamoyl phosph  24.6      48  0.0012   13.7   4.6   30   20-49    553-592 (1063)
367 TIGR00328 flhB flagellar biosy  24.6      48  0.0012   13.7   5.6   61  129-215   246-314 (352)
368 TIGR02469 CbiT precorrin-6Y C5  24.6      40   0.001   14.3   1.4   11  195-205     2-12  (135)
369 COG3100 Uncharacterized protei  24.5      39   0.001   14.3   1.4   25  162-187    11-36  (103)
370 TIGR02078 AspKin_pair Pyrococc  24.4      42  0.0011   14.1   1.5   50  178-230    90-142 (341)
371 TIGR02638 lactal_redase lactal  24.3      41  0.0011   14.1   1.5   26  111-141    65-90  (380)
372 COG0299 PurN Folate-dependent   24.2      49  0.0012   13.6   6.1   54   21-92      1-58  (200)
373 TIGR02929 anfG_nitrog Fe-only   24.2      43  0.0011   14.0   1.5   30  178-207    55-88  (110)
374 PRK03892 ribonuclease P protei  24.2      49  0.0012   13.6   2.1   20  190-209    35-54  (210)
375 PRK09028 cystathionine beta-ly  24.1      49  0.0013   13.6   8.0   98   23-145    78-184 (394)
376 TIGR03333 salvage_mtnX 2-hydro  24.1      49  0.0013   13.6   3.4   44   73-123    75-118 (214)
377 COG0469 PykF Pyruvate kinase [  24.1      49  0.0013   13.6   5.2   64   19-91      5-69  (477)
378 cd04925 ACT_ACR_2 ACT domain-c  24.0      29 0.00073   15.3   0.6   32  364-400    41-72  (74)
379 PRK08220 2,3-dihydroxybenzoate  24.0      49  0.0013   13.6   3.9   38    9-51      1-39  (253)
380 COG2185 Sbm Methylmalonyl-CoA   23.9      49  0.0013   13.6   3.4   34   18-52     10-48  (143)
381 pfam02702 KdpD Osmosensitive K  23.8      50  0.0013   13.6   4.5   38   19-56      4-45  (211)
382 KOG2731 consensus               23.6      50  0.0013   13.5   3.2   80  142-227   106-189 (378)
383 PRK11207 tellurite resistance   23.5      50  0.0013   13.5   4.4   54   21-94     32-89  (198)
384 PRK08248 O-acetylhomoserine am  23.5      50  0.0013   13.5   7.4   95   23-142    81-184 (431)
385 pfam10989 DUF2808 Protein of u  23.2      51  0.0013   13.5   5.3   33  333-368    70-104 (142)
386 pfam08022 FAD_binding_8 FAD-bi  23.2      51  0.0013   13.5   4.2   21  348-368    17-39  (103)
387 pfam02784 Orn_Arg_deC_N Pyrido  23.2      51  0.0013   13.5   5.3   53   77-139    35-87  (245)
388 COG0205 PfkA 6-phosphofructoki  23.2      51  0.0013   13.5   2.2   32   20-51      2-39  (347)
389 PRK11508 sulfurtransferase Tus  22.4      53  0.0013   13.4   2.3   34   76-115    28-62  (109)
390 KOG3032 consensus               22.2      48  0.0012   13.7   1.4   32   98-131    20-51  (264)
391 COG2731 EbgC Beta-galactosidas  22.0      52  0.0013   13.4   1.6   27  354-380   111-137 (154)
392 COG1377 FlhB Flagellar biosynt  22.0      54  0.0014   13.3   5.6   51  137-213   262-314 (363)
393 KOG0558 consensus               21.9      54  0.0014   13.3   2.5   79  126-212   174-268 (474)
394 TIGR02173 cyt_kin_arch cytidyl  21.9      39 0.00099   14.3   0.9   34  115-151    54-97  (173)
395 COG4122 Predicted O-methyltran  21.7      34 0.00086   14.8   0.6   36  214-250   129-166 (219)
396 COG1233 Phytoene dehydrogenase  21.7      54  0.0014   13.3   4.4   28   24-51      6-33  (487)
397 TIGR01125 TIGR01125 MiaB-like   21.6      55  0.0014   13.3   2.2   20   30-49     13-32  (475)
398 KOG3467 consensus               21.6      38 0.00098   14.4   0.9   40  192-236    27-67  (103)
399 COG1565 Uncharacterized conser  21.6      10 0.00026   18.5  -2.1   20   91-110    53-72  (370)
400 pfam03180 Lipoprotein_9 NLPA l  21.4      55  0.0014   13.2   4.3   62   68-145     9-75  (236)
401 PRK06483 short chain dehydroge  21.4      55  0.0014   13.2   5.2   30   21-51      3-33  (236)
402 pfam10288 DUF2392 Protein of u  21.3      50  0.0013   13.5   1.4   25  187-211    32-56  (104)
403 pfam05579 Peptidase_S32 Equine  21.3      50  0.0013   13.6   1.4   29  244-272    99-132 (426)
404 PRK06027 purU formyltetrahydro  21.3      55  0.0014   13.2   6.4   41  242-282   186-226 (285)
405 cd03796 GT1_PIG-A_like This fa  21.2      56  0.0014   13.2   5.5   24   29-52     14-39  (398)
406 pfam04355 SmpA_OmlA SmpA / Oml  21.2      51  0.0013   13.5   1.4   22  180-204     4-25  (71)
407 PTZ00305 NADH:ubiquinone oxido  21.1      56  0.0014   13.2   3.1   12  199-210    86-97  (297)
408 cd07062 Peptidase_S66_mccF_lik  21.1      56  0.0014   13.2   2.6   27   23-49      4-36  (308)
409 cd06389 PBP1_iGluR_AMPA_GluR2   21.1      56  0.0014   13.2   4.6  108    4-142    14-122 (370)
410 TIGR01283 nifE nitrogenase MoF  21.1      56  0.0014   13.2   4.1   26   67-92    262-287 (470)
411 KOG0337 consensus               21.1      56  0.0014   13.2   2.0   98  161-276   220-331 (529)
412 PRK00377 cbiT cobalt-precorrin  21.1      42  0.0011   14.1   0.9   12   73-84     78-89  (198)
413 pfam05023 Phytochelatin Phytoc  21.0      53  0.0014   13.4   1.5   84  172-265    75-158 (208)
414 TIGR02025 BchH magnesium chela  21.0      50  0.0013   13.6   1.3   69   19-89    295-383 (1384)
415 TIGR02712 urea_carbox urea car  21.0      36 0.00093   14.5   0.6   56  112-187   239-296 (1226)
416 TIGR03342 dsrC_tusE_dsvC sulfu  20.9      56  0.0014   13.2   2.3   35   75-115    26-61  (108)
417 pfam01301 Glyco_hydro_35 Glyco  20.9      56  0.0014   13.2   6.1   50   38-88     31-80  (317)
418 TIGR01949 AroFGH_arch predicte  20.8      57  0.0014   13.2   5.2  104    8-147    76-179 (259)
419 TIGR01829 AcAcCoA_reduct aceto  20.8      57  0.0014   13.2   3.5   95   26-122     7-128 (244)
420 COG0065 LeuC 3-isopropylmalate  20.8      57  0.0014   13.2   1.8   66   23-91     29-97  (423)
421 KOG1356 consensus               20.5      57  0.0015   13.1   2.1   26   27-52    179-204 (889)
422 PRK10693 response regulator of  20.5      58  0.0015   13.1   6.3   59   14-92      1-59  (337)
423 pfam04358 DsrC DsrC like prote  20.5      58  0.0015   13.1   2.4   34   76-115    28-62  (109)
424 cd04735 OYE_like_4_FMN Old yel  20.4      58  0.0015   13.1   5.9   10  132-141   152-161 (353)
425 PRK07504 O-succinylhomoserine   20.4      58  0.0015   13.1   8.3   98   23-145    82-188 (397)
426 PRK10279 hypothetical protein;  20.4      55  0.0014   13.2   1.4   32   19-50      2-37  (300)
427 KOG3360 consensus               20.3      58  0.0015   13.1   1.6   19   76-94     27-45  (98)
428 pfam08901 DUF1847 Protein of u  20.3      58  0.0015   13.1   2.0   43   12-54     47-91  (157)
429 PRK00402 3-isopropylmalate deh  20.2      58  0.0015   13.1   2.0   14  212-225   155-168 (419)
430 pfam03721 UDPG_MGDP_dh_N UDP-g  20.2      58  0.0015   13.1   4.1   30   21-51      1-30  (185)
431 TIGR00676 fadh2 5,10-methylene  20.2      29 0.00075   15.2   0.0   22   69-90     86-107 (302)
432 TIGR00486 TIGR00486 conserved   20.2      42  0.0011   14.1   0.8   68   19-95     46-118 (325)

No 1  
>PRK00143 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; Reviewed
Probab=100.00  E-value=0  Score=977.68  Aligned_cols=352  Identities=45%  Similarity=0.786  Sum_probs=332.2

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             86338899996098579999999988698499999870478766555577881899999999999809958981707886
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .|.++||+|||||||||||||+||+++||||+|+||++|+.++   ..+.||+++|+.||++||++|||||+++|++++|
T Consensus         1 ~~sk~rV~VamSGGVDSsVaA~LL~~~Gy~V~Gv~m~~w~~~~---~~~~C~~~~d~~dA~~va~~LgIp~~v~d~~~~f   77 (355)
T PRK00143          1 DPSKKRVVVGMSGGVDSSVAAALLKEQGYDVIGLFMKLWDDDD---GSGGCCAEEDIADARAVADKLGIPLYVVDFAKEF   77 (355)
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC---CCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             9988889999167899999999999779958999998876887---7789985788999999999869857996869987


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             63224411267870886120000154110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                      |++||+||+++|++|+|||||++||++|||++|+++|+++|+||||||||||+...     ++++.|.||.|.+||||||
T Consensus        78 ~~~Vi~~f~~~Y~~G~TPNPcv~CN~~IKFg~l~~~A~~lgad~iATGHYAri~~~-----~~~~~L~r~~D~~KDQSYf  152 (355)
T PRK00143         78 WDNVFDYFLDEYKAGRTPNPCVLCNKEIKFKAFLDYALELGADYIATGHYARIRDE-----DGRYELLRAVDPNKDQSYF  152 (355)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCHHCCCCCCHHHHHHHHHHCCCCEECCCCEEEEEEC-----CCEEEEEECCCCCCCCEEE
T ss_conf             67889999999976999997334087233999999998739984233525999915-----9818998678898872057


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCCEEEEE
Q ss_conf             86302022100334256899789899997412543551110230111277510345530766434671103774322335
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH  256 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~viG~H  256 (408)
                      ||+|+|++|++++||||+++|+|||++|+++||++|+||||||||||++++|++||++|++  .+||+|+|.+|++||+|
T Consensus       153 L~~l~~~~L~~~~FPLG~~~K~eVR~iA~~~gL~~a~K~dSq~ICFi~~~~y~~Fl~~~~~--~~pG~ivd~~G~vlG~H  230 (355)
T PRK00143        153 LYQLTQEQLAKLLFPLGELTKPEVREIAAEIGLPTAKKKDSTGICFIGERNFKDFLSRYLP--AQPGEIVDLDGKVLGEH  230 (355)
T ss_pred             EECCCHHHHHHEECCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCHHHHHHHHCC--CCCCCEECCCCCEEEEE
T ss_conf             6105798874207587677358999999975898899777786044048877899986357--88886885589587678


Q ss_pred             CCCEEEEECCCCCCCCC-CCCCCEEEECCCCCCEEEEECCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCC
Q ss_conf             78315310233433565-77861376317553125652355542221120022303776555445687189999801788
Q gi|254780151|r  257 NGIINYTIGQRRGLGVA-MGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQD  335 (408)
Q Consensus       257 ~G~~~yTIGQRkGL~i~-~~eP~YVv~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~  335 (408)
                      +|+|+|||||||||+|+ .++||||++||+++|+|+||++++|+++++.+.++||+++.+    +..+++|.||+||+++
T Consensus       231 ~G~~~yTIGQRkGLgi~~~~~p~yV~~id~~~N~v~Vg~~~~L~~~~~~~~~~nwi~~~~----~~~~~~~~vkiRy~~~  306 (355)
T PRK00143        231 DGLMYYTIGQRKGLGIGGSGEPWYVVGKDLKNNIVYVGDHEALYSRELIASDLNWVSGEP----PEEPFECTAKVRYRQP  306 (355)
T ss_pred             CCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCEEEEECHHHHCCCEEEEEEEEECCCCC----CCCCEEEEEEECCCCC
T ss_conf             695568704414567688998689999837889999978288435859997237778989----9998599999856997


Q ss_pred             CCEEEEEE-ECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             70089998-2997999975972000696389997388866588876897145
Q gi|254780151|r  336 PVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       336 pvp~~i~~-~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      ++||+++. .++.++|+|++|++||||||+||||++|    +|||||||..+
T Consensus       307 ~~~~~v~~~~~~~~~v~f~~p~~avaPGQ~~VfY~~d----~vLGGG~I~~~  354 (355)
T PRK00143        307 DVPCTVTPLDDGRVKVIFDEPQRAVTPGQAAVFYDGD----VCLGGGIIERA  354 (355)
T ss_pred             CCCEEEEEECCCEEEEEECCCCCCCCCCCEEEEEECC----EEEEEEEEEEE
T ss_conf             8287999925997999949997678998389999799----99986999860


No 2  
>pfam03054 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs.
Probab=100.00  E-value=0  Score=962.16  Aligned_cols=347  Identities=46%  Similarity=0.793  Sum_probs=325.4

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      |||+|||||||||||||+||+++||||+|+||++|+.++  +..+.||+++|+.||++||++|||||+++|++++||++|
T Consensus         1 mkV~VamSGGVDSsVaA~LL~~~Gy~V~Gv~m~~w~~~~--~~~~~C~~~~d~~dA~~va~~LgIp~~v~d~~~~f~~~V   78 (354)
T pfam03054         1 MKVVVAMSGGVDSSVAAYLLKEQGYEVIGVFMKNWDEED--EFGHGCCSEEDLADAQRVCEQLGIPLYVVNFEKEYWEKV   78 (354)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC--CCCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHH
T ss_conf             969999047899999999999779963999999566887--667889988999999999998699789978799875899


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCC-CCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEE
Q ss_conf             44112678708861200001541105888887401-68764522531102541267877316885315787873189863
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA  179 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~-~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~  179 (408)
                      |+||+++|++|+|||||++||++|||++|+++|++ +|+||||||||||+...     .+++.|+||.|++||||||||+
T Consensus        79 i~~fv~~Y~~G~TPNPcv~CN~~IKFg~l~~~A~~~lGad~iATGHYAri~~~-----~~~~~L~r~~D~~KDQSYfL~~  153 (354)
T pfam03054        79 FEPFLDEYKNGRTPNPDILCNREIKFGALLDYAKQVLGADYLATGHYARVSLN-----ENESELLRGKDKNKDQSYFLSG  153 (354)
T ss_pred             HHHHHHHHHCCCCCCCCHHHCCCCCHHHHHHHHHHHCCCCCCCCCCEEEEEEC-----CCEEEEEECCCCCCCCCEEEEC
T ss_conf             99999999769999841441896438999999998669981044742899904-----9938999899999980178610


Q ss_pred             ECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECC-CCCEEEEECC
Q ss_conf             020221003342568997898999974125435511102301112775103455307664346711037-7432233578
Q gi|254780151|r  180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQILGRHNG  258 (408)
Q Consensus       180 l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~-~G~viG~H~G  258 (408)
                      |+|++|++++||||+++|+|||++|+++||++|+||||||||||++++|++||++|++  ++||+|+|. +|++||+|+|
T Consensus       154 l~q~~L~~~lFPLG~~~K~eVR~iA~~~gL~~a~K~dSq~ICFi~~~~~~~Fl~~~~~--~~pG~ivd~~~G~vlG~H~G  231 (354)
T pfam03054       154 LSQEQLEKLLFPLGDLTKEEVRKIAKEAGLPTAKKKDSQGICFIGKRNFKDFLKKYLP--VKPGDIIDIDTGEVLGEHEG  231 (354)
T ss_pred             CCHHHHHHEECCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCHHHHHHHHCC--CCCCCEEECCCCCEEEEECC
T ss_conf             7898764318287688528999999976998899877787033058877999997478--99987698879929788869


Q ss_pred             CEEEEECCCCCCCCC-CCCCCEEEECCCCCCEEEEEC---CCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCC
Q ss_conf             315310233433565-778613763175531256523---5554222112002230377655544568718999980178
Q gi|254780151|r  259 IINYTIGQRRGLGVA-MGEPLFVVYLDKNSSRVIVGP---RESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQ  334 (408)
Q Consensus       259 ~~~yTIGQRkGL~i~-~~eP~YVv~id~~~N~ViVg~---~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~  334 (408)
                      +|+|||||||||+++ .++||||++||+++|+|+||+   ++.|+++++.+.++||+++.+..   ..+++|.||+||++
T Consensus       232 ~~~yTIGQRkGlgi~g~~~p~yV~~~d~~~N~v~Vg~~~~~~~L~~~~~~~~~~nw~~~~~~~---~~~~~~~vkiRy~~  308 (354)
T pfam03054       232 IWFYTIGQRKGLGIGGYGEPWYVVEKDPEKNTVYVGRGEDHEDLYSDGLRAKDLNWLGPELPT---GEVLRCTVKVRHRQ  308 (354)
T ss_pred             EEEEEECCCCCCCCCCCCCCEEEEEECCCCCEEEEECCCCCHHHHCCEEEEEEEEECCCCCCC---CCCEEEEEEECCCC
T ss_conf             068982542546658888618999981778889996698855562787999831888898888---99649999985698


Q ss_pred             CCCEEEEEEE-CCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEE
Q ss_conf             8700899982-997999975972000696389997388866588876897
Q gi|254780151|r  335 DPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGII  383 (408)
Q Consensus       335 ~pvp~~i~~~-~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI  383 (408)
                      +++||+++.. ++.+.|+|++|++||||||+||||++|    +|||||||
T Consensus       309 ~~~~~~v~~~~~~~~~v~f~~p~~avtPGQ~~V~Y~~d----~vLGGG~I  354 (354)
T pfam03054       309 PPVPCKVKLLDDNTIEVHFDEPVRAVTPGQAAVFYDGD----RCLGGGII  354 (354)
T ss_pred             CCCCEEEEEECCCEEEEEECCCCCCCCCCCEEEEEECC----EEEEEEEC
T ss_conf             29386999916998999949998777857089999699----99987789


No 3  
>cd01998 tRNA_Me_trans tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs. This family of enzyme only presents in bacteria and eukaryote. The  archaeal counterpart of this enzyme performs same function, but is completely unrelated in sequence.
Probab=100.00  E-value=0  Score=957.14  Aligned_cols=345  Identities=47%  Similarity=0.822  Sum_probs=326.9

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             89999609857999999998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      ||+|||||||||||||+||+++||||+|+||++|+.++   ..+.||+++|++||++||++|||||+++|++++||++||
T Consensus         1 kV~v~mSGGVDSsvaA~LL~~~G~~V~gv~m~~w~~~~---~~~~C~~~~d~~dA~~va~~LgIp~~v~d~~~ef~~~V~   77 (349)
T cd01998           1 KVVVAMSGGVDSSVAAALLKEQGYEVIGVFMKNWDEDD---GKGGCCSEEDLKDARRVADQLGIPHYVVNFEKEYWEKVF   77 (349)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC---CCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHHHHHHH
T ss_conf             98999077899999999998779957999999678876---678988677899999999986996799680998868889


Q ss_pred             CCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEEC
Q ss_conf             41126787088612000015411058888874016876452253110254126787731688531578787318986302
Q gi|254780151|r  102 VPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT  181 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~  181 (408)
                      +||+++|++|+|||||++||++|||++|+++|+++|+||||||||||+....    .+++.|.||.|++||||||||+|+
T Consensus        78 ~~f~~~Y~~G~TPNPcv~CN~~IKF~~l~~~A~~~g~d~iATGHYAri~~~~----~~~~~L~r~~D~~KDQSYfL~~l~  153 (349)
T cd01998          78 EPFLEEYKKGRTPNPDILCNKEIKFGALLDYAKKLGADYIATGHYARIEEDN----NGRYRLLRGVDPNKDQSYFLSQLS  153 (349)
T ss_pred             HHHHHHHHCCCCCCCCHHCCCEEEHHHHHHHHHHCCCCEECCCCEEEEEECC----CCCEEEEECCCCCCCCCEEEECCC
T ss_conf             9999999748999876211873519999999987599864135147889758----984899876899878205640124


Q ss_pred             CHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCCEEEEECCCEE
Q ss_conf             02210033425689978989999741254355111023011127751034553076643467110377432233578315
Q gi|254780151|r  182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN  261 (408)
Q Consensus       182 ~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~viG~H~G~~~  261 (408)
                      |++|++++||||+++|+|||++|+++||++|+|||||||||||+++|++||++|++  .+||+|+|.+|++||+|+|+|+
T Consensus       154 ~~~L~~~~FPLG~~~K~eVR~iA~~~gl~~a~K~dSq~ICFi~~~~~~~FL~~~~~--~~~G~ivd~~G~vlG~H~G~~~  231 (349)
T cd01998         154 QEQLSRLIFPLGDLTKPEVREIAKELGLPVAKKKDSQGICFIGERNFRDFLKEYLP--EKPGEIVDIDGKVLGEHKGLWF  231 (349)
T ss_pred             HHHHHHEECCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEECCCCHHHHHHHHCC--CCCCCEECCCCCEEEEECCEEE
T ss_conf             87661038788786538999999985999899777776033138877899986456--8988688557968888889999


Q ss_pred             EEECCCCCCCCCCCCCCEEEECCCCCCEEEEEC---CCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCCCCE
Q ss_conf             310233433565778613763175531256523---55542221120022303776555445687189999801788700
Q gi|254780151|r  262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGP---RESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVP  338 (408)
Q Consensus       262 yTIGQRkGL~i~~~eP~YVv~id~~~N~ViVg~---~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pvp  338 (408)
                      |||||||||+++.++||||++||+++|+|+||+   ++.|+++++++.++||+++.+    +..+++|.||+||+++++|
T Consensus       232 yTIGQRkGLgi~~~~p~yV~~~d~~~N~v~Vg~~~~~~~L~~~~~~~~~~nwi~~~~----~~~~~~~~vkiRy~~~~~~  307 (349)
T cd01998         232 YTIGQRKGLGIASGEPWYVVEKDPETNIVVVGPGSDHEALYSDGLIAKDFNWIGDPP----PLEPLECEVKIRYRQPPVP  307 (349)
T ss_pred             EEECCCCCCCCCCCCCEEEEEECCCCCEEEEECCCCCHHHCCCEEEEEEEEECCCCC----CCCCEEEEEEECCCCCCCC
T ss_conf             981330567788897179999817889899966987501224679997137778988----8998599999877995807


Q ss_pred             EEEEEE-CCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEE
Q ss_conf             899982-997999975972000696389997388866588876897
Q gi|254780151|r  339 VFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGII  383 (408)
Q Consensus       339 ~~i~~~-~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI  383 (408)
                      |+++.. ++.++|+|++|++||||||+||||++|    +|||||||
T Consensus       308 ~~v~~~~~~~~~V~f~~p~~avaPGQ~~V~Y~~d----~vLGGG~I  349 (349)
T cd01998         308 CTIEPLDDGRLEVIFDEPQRAVAPGQAAVFYDGD----RVLGGGII  349 (349)
T ss_pred             EEEEEECCCEEEEEECCCCCCCCCCCEEEEEECC----EEEEEEEC
T ss_conf             7999935987999949998677987489999799----99988889


No 4  
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase; InterPro: IPR004506 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (2.1.1.61 from EC) catalyses the addition of 5-methylaminomethyl-2-thiouridylate to tRNAs using S-adenosyl-L-methionine as a substrate and releasing S-adenosyl-L-homocysteine. The enzyme is cytoplasmic and is involved in tRNA processing.; GO: 0004808 tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase activity, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=100.00  E-value=0  Score=934.52  Aligned_cols=355  Identities=38%  Similarity=0.705  Sum_probs=328.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCC---------CCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             8899996098579999999988698499999870478766555---------5778818999999999998099589817
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR---------KGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~---------~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      |||+|||||||||||||+||++||++|.|+||++|......+.         ...||+.+|+.||++||++||||++++|
T Consensus         1 ~kv~VglSGGVDSSVsA~lL~~qg~~v~G~ylk~W~~~~~~d~~GH~~~N~~K~~C~~~~dl~~a~~ic~~LGi~l~~~n   80 (394)
T TIGR00420         1 KKVIVGLSGGVDSSVSAYLLKQQGYEVVGVYLKNWDEDEKNDILGHKKINENKSGCSSAEDLRDAQAICEKLGIPLEKVN   80 (394)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEEEEECCCCCCCCCHHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             94899806854789999999714965899987765124666644316562467788368879999999985598189855


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCC-C--CCCEECCCCCCCEE-EECCCCCCCEEEEEECC
Q ss_conf             07886632244112678708861200001541105888887401-6--87645225311025-41267877316885315
Q gi|254780151|r   92 YEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-L--GADVLATGHYIRSR-LYVGDDGKRRRIMCRPM  167 (408)
Q Consensus        92 ~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~-~--g~~~iATGHYar~~-~~~~~~~~~~~~L~r~~  167 (408)
                      |.++||++||+|||++|.+|.|||||+.||+.||||+|+|+|.+ .  |+++||||||||+. ..   ++..++.|.||.
T Consensus        81 f~~~Y~~~Vf~~~i~~y~~G~TPnPDi~CN~~iKFG~~~e~~~~~~Gtg~~~~aTGHYAr~~q~~---~~~~~~~L~~~~  157 (394)
T TIGR00420        81 FQKEYWNKVFEPFIQEYKEGLTPNPDILCNKLIKFGLLLEYAKQLLGTGNDKIATGHYARIAQEI---ENKSLFELLRAL  157 (394)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEECCHHHHHHHHH---CCCCHHHHHCCC
T ss_conf             07887888889999987367777862004712003789999998528995434424476544342---131014443046


Q ss_pred             CCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCC--CCCCC-HHHCCCEEECCCC----CCHHHHHHCCCCCC
Q ss_conf             78787318986302022100334256899789899997412--54355-1110230111277----51034553076643
Q gi|254780151|r  168 DLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMG--LDIAD-KSDSQDICFVQQG----KYFDVVKRINAGIA  240 (408)
Q Consensus       168 D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~g--l~~a~-K~eSqgICFi~~~----~~~~Fl~~~~~~~~  240 (408)
                      |..||||||||.|+++||++++||||+|+|++||.||++++  |+||+ ||||||||||+++    +|+|||++|++  +
T Consensus       158 D~~KDQSYFL~~l~~~~~~~~~FPlG~L~K~~vR~iA~~~~PfL~ta~tkKDSqgICFig~~qhGGkf~dFLk~Ylp--~  235 (394)
T TIGR00420       158 DKNKDQSYFLYHLSQEQLAKLLFPLGELLKPEVRQIAKNAGPFLSTAETKKDSQGICFIGERQHGGKFKDFLKKYLP--V  235 (394)
T ss_pred             CCCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHCC--C
T ss_conf             78886117376401898887505301036778999998648632344568864450210351568846888764257--6


Q ss_pred             -CCCCEECCCCC-----EEEEECCCEEEEECCCCCCCCC-----CCCCCEEEECCCCCCEEEEEC---CCCCCCCCEEEC
Q ss_conf             -46711037743-----2233578315310233433565-----778613763175531256523---555422211200
Q gi|254780151|r  241 -LEGDIVHLNGQ-----ILGRHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGP---RESLEVHRIYLR  306 (408)
Q Consensus       241 -~~G~ivd~~G~-----viG~H~G~~~yTIGQRkGL~i~-----~~eP~YVv~id~~~N~ViVg~---~~~L~~~~i~l~  306 (408)
                       +||.|+|.+|+     +||+|+|+|+||||||+||+|+     ..+||||+++|+++|+|+|+.   ++.|+++++.+.
T Consensus       236 ek~G~I~~~~~~~Gakt~iG~H~G~w~yTiGQR~Gl~~~~~~~g~~~~~FVv~kD~~~N~l~v~~g~d~~~l~~~~~~~~  315 (394)
T TIGR00420       236 EKPGNIIDVDTEKGAKTVIGEHDGLWFYTIGQRKGLGLGGAKEGAAEPWFVVEKDLETNELVVSQGEDKEDLASRGLLVQ  315 (394)
T ss_pred             CCCCEEEECCCCCCCEEEEEEECCEEEEEEEEEECCCCCCCCCCCCCCCCEEEEECCCCEEEEECCCCHHHHHCCCEEEE
T ss_conf             77820475488975403632246678982014414776356843357632354203148799971888188613744787


Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEEECCCCCC---EEEEE-EECCE-EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEE
Q ss_conf             2230377655544568718999980178870---08999-82997-9999759720006963899973888665888768
Q gi|254780151|r  307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPV---PVFVQ-RNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG  381 (408)
Q Consensus       307 d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pv---p~~i~-~~~~~-~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGG  381 (408)
                      .+||+...........+.+|.||+||+|.|+   +|++. ..++. ++|.|++|+.||||||+||||.+|   .+|||||
T Consensus       316 ~~~w~~~~edtp~~~~~~~~~vk~Ry~q~~~qik~~~~~~~~Dn~di~v~f~~P~~~vtpGQ~~vlY~~d---~~~LGgG  392 (394)
T TIGR00420       316 QLNWLDDEEDTPKPFENIRCTVKIRYRQKPVQIKSCKLKLLKDNLDIEVIFDEPQQGVTPGQSAVLYKDD---QICLGGG  392 (394)
T ss_pred             EECCCCCCCCCCCCCCCCEEEEEEEECCCCCEEEEEEEEEECCCCEEEEEECCCCCEECCCEEEEEECCC---CEEECCC
T ss_conf             4045674446766677737999983257750243467785058841799843885202586269998578---2781555


Q ss_pred             EE
Q ss_conf             97
Q gi|254780151|r  382 II  383 (408)
Q Consensus       382 iI  383 (408)
                      +|
T Consensus       393 ~I  394 (394)
T TIGR00420       393 II  394 (394)
T ss_pred             CC
T ss_conf             69


No 5  
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=0  Score=882.98  Aligned_cols=350  Identities=44%  Similarity=0.767  Sum_probs=328.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             63388999960985799999999886984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      +++|||+|||||||||||||+||++|||||+|+||++|++    ...+.||+++|+.||++||++|||||+++||+++||
T Consensus         1 ~~~~kV~v~mSGGVDSSVaA~lLk~QGyeViGl~m~~~~~----~~~~~C~s~~d~~da~~va~~LGIp~~~vdf~~~y~   76 (356)
T COG0482           1 MKKKKVLVGMSGGVDSSVAAYLLKEQGYEVIGLFMKNWDE----DGGGGCCSEEDLRDAERVADQLGIPLYVVDFEKEFW   76 (356)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEEEECC----CCCCCCCCHHHHHHHHHHHHHHCCCEEEECHHHHHH
T ss_conf             9876799990577789999999997697499999996414----788867725678999999998099559984689988


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEE
Q ss_conf             32244112678708861200001541105888887401687645225311025412678773168853157878731898
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL  177 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL  177 (408)
                      ++||+||+++|.+|+||||||+||+.|||++|+++|+++|+||||||||||++...+     ++.|.|+.|.+|||||||
T Consensus        77 ~~V~~~f~~~Y~~G~TPNPci~CN~~iKF~~~l~~a~~lgad~iATGHYar~~~~~~-----~~~l~r~~D~~KDQsYfL  151 (356)
T COG0482          77 NKVFEYFLAEYKAGKTPNPCILCNKEIKFKALLDYAKELGADYIATGHYARQREDEG-----IELLLRGVDLNKDQSYFL  151 (356)
T ss_pred             HHHHHHHHHHHHCCCCCCCCHHCCHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCC-----CCCCCCCCCCCCCHHHEE
T ss_conf             888887789985799999651048788999999999975998578744676543776-----000146787420300020


Q ss_pred             EEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCCEEEEEC
Q ss_conf             63020221003342568997898999974125435511102301112775103455307664346711037743223357
Q gi|254780151|r  178 FATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN  257 (408)
Q Consensus       178 ~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~viG~H~  257 (408)
                      +.++++||++++||||+|+|++||+||++.||++|+||||||||||++++|++||.+|++.  +||+|++.+|+++|+|+
T Consensus       152 ~~~~~~ql~~~lFPlG~l~K~evR~iA~~~gL~~a~KkdS~~ICFi~~~~~~~fl~~~~p~--~~G~ii~~~G~v~g~H~  229 (356)
T COG0482         152 YALSQEQLERLLFPLGDLEKLEVRPIAAEKGLPTAKKKDSQGICFIGERKFKDFLGRYLPA--KPGEIIDKDGKVLGEHD  229 (356)
T ss_pred             CCCCHHHHHHCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCHHHHHHHHCCC--CCCEEEECCCCEEEECC
T ss_conf             1268877753225677777789999999759976676667762213787789998731877--88527924881800128


Q ss_pred             CCEEEEECCCCCCCCCC--CCCCEEEECCCCCCEEEEECCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCC
Q ss_conf             83153102334335657--7861376317553125652355542221120022303776555445687189999801788
Q gi|254780151|r  258 GIINYTIGQRRGLGVAM--GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQD  335 (408)
Q Consensus       258 G~~~yTIGQRkGL~i~~--~eP~YVv~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~  335 (408)
                      |+|+||||||+||+|++  ++||||+++|+++|+++|++++.|+..++.+.++||+.+    ..+..+++|.||+||+++
T Consensus       230 G~~~yTiGQR~Gl~I~~~~~~p~yVv~kd~~~n~~~V~~~~~l~~~~l~~~~~~~~~~----~~~~~~~~~~~k~R~~~~  305 (356)
T COG0482         230 GLMYYTIGQRKGLGIGGLKGEPWYVVGKDLKKNRLYVGQGEALLSVGLIAEDLNWLDD----APPEEPLECTAKVRYRQG  305 (356)
T ss_pred             CEEEEECCCCCCCCCCCCCCCCEEEEEEECCCCEEEEECCHHHEEEEEEEECCCCCCC----CCCCCCCEEEEEEECCCC
T ss_conf             7788842663356768888887799987166675999640441122566111532366----667888169999822689


Q ss_pred             CCEEEEEEECC---EEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             70089998299---7999975972000696389997388866588876897145
Q gi|254780151|r  336 PVPVFVQRNDD---GVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       336 pvp~~i~~~~~---~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      +.||+++...+   .+.|.|++|++||||||++|||++|    +|||||+|+.+
T Consensus       306 ~~~~~~~~~~~~~~~~~v~f~~~~~avtpGQ~~v~Y~~d----~~lGgg~I~~~  355 (356)
T COG0482         306 DEPCKVKVLSDEDVELAVKFDEPQRAVTPGQAAVLYDGD----ICLGGGIIDTS  355 (356)
T ss_pred             CCCEEEEECCCCCCEEEEEECCCCCCCCCCCEEEEECCC----EEEEEEEEECC
T ss_conf             874368972477615899955852112699589996599----99700786315


No 6  
>KOG2805 consensus
Probab=100.00  E-value=0  Score=808.56  Aligned_cols=363  Identities=34%  Similarity=0.579  Sum_probs=328.9

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             86338899996098579999999988698499999870478766555577881899999999999809958981707886
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      +.+..+|+|||||||||||||+||+++||+|+|+||+||+..  .+....||+++||+||++||++|+||++.+||++||
T Consensus         2 p~~~~~VvvamSgGVDSsVaa~Ll~~~g~~v~gv~M~nWd~~--de~~s~cp~e~D~~da~~Vc~~LnI~~~~Vnf~kEY   79 (377)
T KOG2805           2 PEKPDRVVVAMSGGVDSSVAARLLAARGYNVTGVFMKNWDSL--DEFGSQCPAERDWKDAKRVCKQLNIPLHQVNFVKEY   79 (377)
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCC--CCCCCCCCCHHHHHHHHHHHHHHCCEEEEEEEHHHH
T ss_conf             866654899953771189999999741887169966220122--235668981120899999998709702787437999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCC-CCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             632244112678708861200001541105888887401-6876452253110254126787731688531578787318
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~-~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      |+.||+||+++|+.|+||||||.||++|||++|+++|.+ +|+||||||||||+.....+  +...+|+++.|..|||||
T Consensus        80 W~~Vfs~~L~~Y~~G~TPNPDI~CN~~IKFg~~~~~a~en~~~d~latGHYAr~~~~~~~--~~~~~l~~~~d~~KDQt~  157 (377)
T KOG2805          80 WNDVFSPFLEEYENGRTPNPDILCNKHIKFGKFFKHAIENLGYDWLATGHYARVVLEDED--NAESHLLISKDMVKDQTY  157 (377)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCEEECCHHHHHHHHHCCCCEEEEEEEEEEECCCCC--CCCEEEEECCCCCCCCEE
T ss_conf             999999998887658999997134451421178999987558873774212144037556--762357612566677326


Q ss_pred             EEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCC-CHHHHHHCCCCCCCCCCEECCC-CCEE
Q ss_conf             9863020221003342568997898999974125435511102301112775-1034553076643467110377-4322
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGK-YFDVVKRINAGIALEGDIVHLN-GQIL  253 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~-~~~Fl~~~~~~~~~~G~ivd~~-G~vi  253 (408)
                      ||+.++|++|++++||||+++|+|||.+|++.||++|+||||||||||++.+ |++||++|++  ++||+|++++ |.++
T Consensus       158 FL~~in~~~L~r~lfPlg~~~K~eVk~lA~~~gf~~aeK~eSqGICFvgk~~~F~dFl~~yi~--~~~g~Il~i~~gs~v  235 (377)
T KOG2805         158 FLSTINQTQLKRLLFPLGCLTKSEVKKLAKQAGFPNAEKPESQGICFVGKIKHFSDFLQRYIG--SSPGPILEIDSGSVV  235 (377)
T ss_pred             EEECCCHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCCCCCCCEEEEECCCHHHHHHHHHHCC--CCCCCEEEECCCCCC
T ss_conf             763036999986206676567799999998659864568665026885362347899998547--899871883288622


Q ss_pred             EEECCCEEEEECCCCCCCCCC---CCCCEEEECCCCCCEEEEE---CCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEE
Q ss_conf             335783153102334335657---7861376317553125652---3555422211200223037765554456871899
Q gi|254780151|r  254 GRHNGIINYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVG---PRESLEVHRIYLREINWLGDGLFEDAVVDGFKCF  327 (408)
Q Consensus       254 G~H~G~~~yTIGQRkGL~i~~---~eP~YVv~id~~~N~ViVg---~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~  327 (408)
                      |+|.|+|.||||||.|++-+.   +-||||++||.++|.|+|+   .+++|+++.+++++++|++..+.. .....+.|.
T Consensus       236 g~h~G~h~~TIGqR~g~sqa~~~~~g~wfV~~k~~~~n~i~i~rg~~~p~l~s~~~~i~~~kw~~~k~~~-i~t~~l~c~  314 (377)
T KOG2805         236 GNHRGIHSYTIGQRCGISQALSLYGGPWFVSEKDTKNNVIYICRGYNNPDLYSRIFRIGSPKWLGTKPQG-IKTGALRCK  314 (377)
T ss_pred             CCCCCEEEEEECHHCCCHHHHHCCCCCEEEEEEECCCCEEEEECCCCCHHHHHCEEEECCHHHCCCCCCC-CCCCCEEEE
T ss_conf             3332357787020027202200247964899860678729998587997775024881680221767676-764656899


Q ss_pred             EEEECCCCCCEEEEEEECC-EEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCCCC
Q ss_conf             9980178870089998299-79999759720006963899973888665888768971455530
Q gi|254780151|r  328 VKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSD  390 (408)
Q Consensus       328 vkiR~~~~pvp~~i~~~~~-~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~~~  390 (408)
                      +|++|.+++++|+++..++ ..+|+|+++|||+||||+||||++|    +|||||+|..++...
T Consensus       315 ~R~qh~~p~~~c~~~~~~~~~~~Ihl~~~~RaitpGQ~~~fY~~~----~cLGsG~I~~v~~~~  374 (377)
T KOG2805         315 VRSQHTPPLYSCKLEMSGDNLAVIHLDAKQRAITPGQFCAFYEDD----TCLGSGVILEVNPDK  374 (377)
T ss_pred             EEECCCCCCCCCEEEECCCCCEEEECCCHHCCCCCCCEEEEEECC----EEECCCEEEECCCCC
T ss_conf             971158997341688538973788704301156887279998288----675561465327445


No 7  
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway. It belongs to the Adenosine Nucleotide Hydrolysis suoerfamily and predicted to bind to Adenosine nucleotide.
Probab=99.98  E-value=2.1e-32  Score=252.39  Aligned_cols=169  Identities=20%  Similarity=0.276  Sum_probs=131.4

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC---C--CCEEECCHHHHH
Q ss_conf             89999609857999999998869849999987047876655557788189999999999980---9--958981707886
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI---N--VSHYVFDYEERF   96 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~L---g--I~~~~~d~~~~f   96 (408)
                      ||+++||||+||+|||+||+++|++|+|+||+++..          ++++..+.+.++++.|   +  ++.+.+.+... 
T Consensus         1 kvl~L~SGGiDS~VAa~ll~krG~~V~~l~f~~~~~----------~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~-   69 (177)
T cd01712           1 KALALLSGGIDSPVAAWLLMKRGIEVDALHFNSGPF----------TSEKAREKVEDLARKLARYSPGHKLVVIIFTFF-   69 (177)
T ss_pred             CEEEEECCCCHHHHHHHHHHHCCCEEEEEEEECCCC----------CCHHHHHHHHHHHHHHHHHCCCCEEEEEECCHH-
T ss_conf             989995778169999999998799899999989998----------888999999999999999489962899945389-


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             63224411267870886120000154110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                            .+.+.|..|.|||||++||+.+ |....+.|+++|+++|+|||+.....+                   .|.+-
T Consensus        70 ------~~~~~~~~g~~~npcv~ckr~m-~r~a~~~A~~~ga~~IvTGe~lGQvas-------------------qt~~n  123 (177)
T cd01712          70 ------VQKEIYGYGKEKYRCILCKRMM-YRIAEKLAEELGADAIVTGESLGQVAS-------------------QTLEN  123 (177)
T ss_pred             ------HHHHHHHHCCCCCCCEEHHHHH-HHHHHHHHHHCCCCEEEECCCHHHHHH-------------------HHHHH
T ss_conf             ------9999997088889863629999-999999999869989986652220447-------------------68999


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC-CCCCHHHCCCEEECCCCC
Q ss_conf             863020221003342568997898999974125-435511102301112775
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGL-DIADKSDSQDICFVQQGK  227 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl-~~a~K~eSqgICFi~~~~  227 (408)
                      |+.+.+.....++.||+.++|+||+++|++.|+ +++.|++|+.+||+|+..
T Consensus       124 l~~i~~~~~~~ilRPL~~~dK~EI~~~A~~igt~~~s~~~~~~~~~f~p~~p  175 (177)
T cd01712         124 LLVISSGTDLPILRPLIGFDKEEIIGIARRIGTYDISIRPRECCCLFAPKNP  175 (177)
T ss_pred             HHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCCCCEEEECCCC
T ss_conf             9999874256421488899989999999980967440589544237608999


No 8  
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily. Adenine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.
Probab=99.87  E-value=1.7e-21  Score=174.32  Aligned_cols=162  Identities=29%  Similarity=0.431  Sum_probs=125.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             999960985799999999886-9849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      |+||+|||||||+.|+++.++ |.+|+++|+..-           ...+.+.++|+++|+++||+|.+++..+..     
T Consensus         1 V~vA~SGGVDSs~la~la~~alG~~v~aV~~~s~-----------~~~~~E~e~a~~~a~~~gi~~~~i~~~~l~-----   64 (202)
T cd01990           1 VAVAFSGGVDSTLLLKAAVDALGDRVLAVTATSP-----------LFPRRELEEAKRLAKEIGIRHEVIETDELD-----   64 (202)
T ss_pred             CEEECCCCHHHHHHHHHHHHHHCCCEEEEEEECC-----------CCCHHHHHHHHHHHHHCCCCEEEEECCHHH-----
T ss_conf             9898238599999999999976878799997279-----------899789999999998639857997341110-----


Q ss_pred             CCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEEC
Q ss_conf             41126787088612000015411058888874016876452253110254126787731688531578787318986302
Q gi|254780151|r  102 VPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT  181 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~  181 (408)
                          +..-.+..||.|..|.+.+ |..|.+.|.+.|+++|+.|+-+    .  |-+..++-+..                
T Consensus        65 ----~~~~~~N~~~RCy~CK~~l-~~~l~~~a~~~g~~~v~dGtn~----d--Dl~d~RPGl~A----------------  117 (202)
T cd01990          65 ----DPEFAKNPPDRCYLCKKAL-YEALKEIAEELGLDVVLDGTNA----D--DLGDYRPGLKA----------------  117 (202)
T ss_pred             ----HHHHCCCCHHHHHHHHHHH-HHHHHHHHHHCCCCEEEECCCC----C--CCCCCCCCHHH----------------
T ss_conf             ----1655459755622998999-9999999996799789415757----6--32355786889----------------


Q ss_pred             CHHHCEEECCCCC--CCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHH
Q ss_conf             0221003342568--997898999974125435511102301112775103
Q gi|254780151|r  182 QQQLCDLRFPLGD--MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFD  230 (408)
Q Consensus       182 ~~~L~~~~FPlg~--~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~  230 (408)
                       ..-..++.||-+  ++|+|||++|+++|||+++|| | +-|....-.|..
T Consensus       118 -~~e~~v~sPL~e~gl~K~eVR~la~~lgLp~~~kp-~-~~CLasRip~g~  165 (202)
T cd01990         118 -LRELGVRSPLAEAGLGKAEIRELARELGLPTWDKP-A-MACLASRIPYGT  165 (202)
T ss_pred             -HHHCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCC-C-CCCEEEECCCCC
T ss_conf             -98769988526519788999999998399856689-9-875466657888


No 9  
>TIGR00884 guaA_Cterm GMP synthase, C-terminal domain; InterPro: IPR001674   The amidotransferase family of enzymes utilises the ammonia derived from the hydrolysis of glutamine for a subsequent chemical reaction catalyzed by the same enzyme. The ammonia intermediate does not dissociate into solution during the chemical transformations . GMP synthetase is a glutamine amidotransferase from the de novo purine biosynthetic pathway. The C-terminal domain is specific to the GMP synthases 6.3.5.2 from EC. In prokaryotes this domain mediates dimerisation. Eukaryotic GMP synthases are monomers. This domain in eukaryotes includes several large insertions that may form globular domains .; GO: 0003922 GMP synthase (glutamine-hydrolyzing) activity, 0005524 ATP binding, 0006164 purine nucleotide biosynthetic process, 0006177 GMP biosynthetic process.
Probab=99.83  E-value=7.4e-20  Score=162.65  Aligned_cols=165  Identities=27%  Similarity=0.378  Sum_probs=123.9

Q ss_pred             CCCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH-HHHCCCCEEEC
Q ss_conf             6788863388999960985799999999886-984999998704787665555778818999999999-99809958981
Q gi|254780151|r   13 DLDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV-CDTINVSHYVF   90 (408)
Q Consensus        13 ~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~v-a~~LgI~~~~~   90 (408)
                      .+.+...+.||++||||||||||||.|++++ |-+.+++|+   |++.....+        -+.+++. -++||+++.++
T Consensus         9 ~ir~~VGD~~vi~ALSGGVDSsV~A~L~hrAIGD~L~~vFV---D~GLlR~gE--------~E~V~~~F~~~lg~nl~~V   77 (319)
T TIGR00884         9 EIREQVGDAKVIIALSGGVDSSVAAVLLHRAIGDRLTCVFV---DHGLLRKGE--------AERVVKTFSDKLGLNLVVV   77 (319)
T ss_pred             HHHHHCCCCEEEEEECCCHHHHHHHHHHHHHHCCCEEEEEE---CCCCCCCCC--------HHHHHHHHHHHHCCCCEEE
T ss_conf             99852288468998108815899999998642276048982---278887663--------7899999875308982787


Q ss_pred             CHHHHHHHH---CCCCCHHHHHC---CCCCCCEECCCCEEEHHHHHHHHCCCC----CCEECCCC-CCCEEEECCCCCCC
Q ss_conf             707886632---24411267870---886120000154110588888740168----76452253-11025412678773
Q gi|254780151|r   91 DYEERFRNA---VIVPFASSYAA---GETPLPCVDCNRTVKFSDLLSVTRQLG----ADVLATGH-YIRSRLYVGDDGKR  159 (408)
Q Consensus        91 d~~~~f~~~---V~~~~~~~y~~---G~TPNPc~~CN~~iKF~~l~~~a~~~g----~~~iATGH-Yar~~~~~~~~~~~  159 (408)
                      |.+++|-+.   |-||   +-+|   |++         +|  ..|=+.|++++    ++|+|.|. |.-+.++...++..
T Consensus        78 DA~e~FL~~L~GV~DP---E~KRKIIG~~---------FI--~VFE~~A~~~~~~~~a~yL~QGTlYPDvIES~~~kG~~  143 (319)
T TIGR00884        78 DAKERFLSALKGVTDP---EEKRKIIGRV---------FI--EVFEREAEKIGDKKKAEYLVQGTLYPDVIESASSKGTS  143 (319)
T ss_pred             CCCHHHHHHCCCCCCC---HHHCCHHHHH---------HH--HHHHHHHHHCCCCCEEEEEEECCCCCCEEEECCCCCCC
T ss_conf             6107988752889870---3413112256---------67--77888998507997799997343447464602304776


Q ss_pred             EEE-EEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             168-853157878731898630202210033425689978989999741254
Q gi|254780151|r  160 RRI-MCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       160 ~~~-L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      ... +...++.        .+||...==+|+-||-+|.|+|||++|+++|||
T Consensus       144 ~a~~IKsHHNV--------GGLP~~m~l~LvEPLR~LfKDEVR~lG~~LGlP  187 (319)
T TIGR00884       144 GAATIKSHHNV--------GGLPEDMKLKLVEPLRELFKDEVRKLGKELGLP  187 (319)
T ss_pred             CCCCCCCCCCC--------CCCCCCCEEEEECCCHHCCHHHHHHHHHHCCCC
T ss_conf             47645631066--------888542602587540230217899999871886


No 10 
>pfam02568 ThiI Thiamine biosynthesis protein (ThiI). ThiI is required for thiazole synthesis, required for thiamine biosynthesis.
Probab=99.79  E-value=1.5e-18  Score=153.22  Aligned_cols=166  Identities=24%  Similarity=0.368  Sum_probs=119.3

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-------CCCEEECCH
Q ss_conf             3889999609857999999998869849999987047876655557788189999999999980-------995898170
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI-------NVSHYVFDY   92 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~L-------gI~~~~~d~   92 (408)
                      +-|+++.||||+||.|||+++.++|.+|+++|+..+          .+.+++..+.++.+++.|       .++++++|+
T Consensus         3 ~gk~l~LlSGGiDSpVAa~lmmkRG~~V~~vhf~~~----------p~~~~~~~~k~~~l~~~l~~y~~~~~~~l~vv~~   72 (197)
T pfam02568         3 QGKVLALLSGGIDSPVAAYLMMRRGCRVVALHFINE----------PGTSEEAIEKVRKLAELLAEYGTSCEGKLVVVDF   72 (197)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHCCCEEEEEEEECC----------CCCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECC
T ss_conf             771898866871299999999987997999998799----------9998999999999999999737887544999574


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC-CCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             78866322441126787088612000015411058888874016876452253-11025412678773168853157878
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH-YIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                      .+.+.. +.+.       .....+|+.|.+.+ +...-+.|++.|+++|+||+ ..++.- ..-+  +            
T Consensus        73 ~~~~~~-i~~~-------~~~~~~cv~cKr~M-~r~A~~iA~~~ga~~IVTGEsLGQVaS-QTl~--n------------  128 (197)
T pfam02568        73 TKVQKE-IIEK-------APEKYRCVLCKRCM-YRAAEKVAEEEGADALVTGESLGQVAS-QTLD--N------------  128 (197)
T ss_pred             HHHHHH-HHHC-------CCCCCEEHHHHHHH-HHHHHHHHHHCCCCEEEECCCHHHHHH-CCCC--H------------
T ss_conf             999999-9962-------89876545699999-999999999849989984730312100-4531--0------------


Q ss_pred             CCEEEEEEECCHHHCE-EECCCCCCCHHHHHHHHHHCCC-CCCCHHHCCCEE-ECCCCC
Q ss_conf             7318986302022100-3342568997898999974125-435511102301-112775
Q gi|254780151|r  172 DQSYFLFATTQQQLCD-LRFPLGDMKKESVRDLAREMGL-DIADKSDSQDIC-FVQQGK  227 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~-~~FPlg~~~K~eVR~~A~~~gl-~~a~K~eSqgIC-Fi~~~~  227 (408)
                           |..+++ ..+. ++-||-.+.|+||+++|++.|. +++.+++  +.| |+++..
T Consensus       129 -----l~~i~~-~~~~pilRPLig~DK~EIi~~Ar~IGt~~~s~~~~--~~C~~~p~~P  179 (197)
T pfam02568       129 -----LRVISA-ATNLPILRPLIGLDKEEIINLAKEIGTYEISIEPY--DCCSVFPKHP  179 (197)
T ss_pred             -----HHHHHH-HHCCCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCC--CCCCCCCCCC
T ss_conf             -----699987-62485313434699999999999948677662888--7642279989


No 11 
>TIGR00268 TIGR00268 conserved hypothetical protein TIGR00268; InterPro: IPR005232   This family of conserved hypothetical proteins has no known function but is predicted to be part of the wider PP-loop superfamily ..
Probab=99.78  E-value=1.3e-18  Score=153.69  Aligned_cols=167  Identities=25%  Similarity=0.427  Sum_probs=129.4

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCCCCCCCCCCH-HHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             6338899996098579999999988-6984999998704787665555778818-9999999999980995898170788
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKR-DGYDVIGVTLQLYNSRKASKRKGSCCAG-QDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~-~G~~V~g~~m~~~~~~~~~~~~~~c~~~-~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      -+++||++|+||||||++.|.++.+ +|.+|+++|+..-           -.++ ++++||.+.|+.+||.|..+.+   
T Consensus        13 f~nk~~~IAySGGvDS~lla~v~~~v~g~~~lait~~sP-----------~~sp~~el~~A~~~A~~~g~~he~~~~---   78 (263)
T TIGR00268        13 FKNKKVLIAYSGGVDSSLLAAVCSDVAGTEVLAITVVSP-----------SISPRRELEDAKAIAKEIGVKHELVKI---   78 (263)
T ss_pred             HHCCCEEEEEECCHHHHHHHHHHHHHHHHCEEEEEEECC-----------CCCCHHHHHHHHHHHHHHCCCEEEECC---
T ss_conf             640816999517465899999998753101135787627-----------757354489999999880830121100---


Q ss_pred             HHHHCCCCCH-HHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCE
Q ss_conf             6632244112-678708861200001541105888887401687645225311025412678773168853157878731
Q gi|254780151|r   96 FRNAVIVPFA-SSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQS  174 (408)
Q Consensus        96 f~~~V~~~~~-~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQS  174 (408)
                            +-+. ..|+ -.+||-|+.|.+.+ |..|...|.+.|+|+|.-|    ++..+-.+  +|+.+....       
T Consensus        79 ------d~~~n~~f~-~N~~~RCY~CK~~~-~~~L~~~a~~~gy~~V~dG----tN~dDL~~--~RPG~~A~~-------  137 (263)
T TIGR00268        79 ------DKMANPNFR-ANVEERCYFCKKKV-LSILVKLAEKRGYDVVVDG----TNADDLED--HRPGLRAVK-------  137 (263)
T ss_pred             ------CCCCCCCCC-CCCCCCCHHHHHHH-HHHHHHHHHHCCCCEEEEC----CCCCCCCC--CCCHHHHHH-------
T ss_conf             ------123685001-68854441548889-9998999986399579823----46200023--675135676-------


Q ss_pred             EEEEEECCHHHCEEECCCCCC--CHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHH
Q ss_conf             898630202210033425689--97898999974125435511102301112775103
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDM--KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFD  230 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~--~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~  230 (408)
                               .+.-.-=|+.++  +|.|||++|+.+|++..+||..  -|...+-.|..
T Consensus       138 ---------E~~g~~SP~aef~I~K~eir~ia~~lg~~~~DKP~~--~CL~sR~p~g~  184 (263)
T TIGR00268       138 ---------ELNGVYSPWAEFGITKKEIREIAKSLGLSFYDKPSE--ACLASRFPFGE  184 (263)
T ss_pred             ---------HCCCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC--CHHHCCCCCCC
T ss_conf             ---------607886872002568799999999748898888662--10210476875


No 12 
>PRK00074 guaA GMP synthase; Reviewed
Probab=99.75  E-value=1.4e-17  Score=146.29  Aligned_cols=167  Identities=23%  Similarity=0.308  Sum_probs=116.6

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH-HHCCCCEEECC
Q ss_conf             788863388999960985799999999886-9849999987047876655557788189999999999-98099589817
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC-DTINVSHYVFD   91 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va-~~LgI~~~~~d   91 (408)
                      +++..++.||++|+||||||||||+||.++ |-+++++|+.+   +....        .+.+.+.+.. ++||++++++|
T Consensus       210 Ik~~Vg~~kVi~~lSGGVDStV~A~Ll~kAIGd~l~cvfVD~---GllRk--------nE~~~V~~~~~~~lgl~~~~vd  278 (513)
T PRK00074        210 IREQVGDKKVILGLSGGVDSSVAAVLLHKAIGDQLTCVFVDH---GLLRK--------NEAEQVMEMFREHFGLNLIHVD  278 (513)
T ss_pred             HHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHHCEEEEEECC---CCCCC--------CCHHHHHHHHHHHCCCCEEEEE
T ss_conf             999838762899723883089999999998511248999537---71116--------7299999999886199679922


Q ss_pred             HHHHHHHH---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC-CCCEECCCC-CCCEEEECCCCCCCEEEEEEC
Q ss_conf             07886632---2441126787088612000015411058888874016-876452253-110254126787731688531
Q gi|254780151|r   92 YEERFRNA---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL-GADVLATGH-YIRSRLYVGDDGKRRRIMCRP  166 (408)
Q Consensus        92 ~~~~f~~~---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~-g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~  166 (408)
                      .+++|.+.   |.||=-.--.-|.|         +|  ..|-+.|+++ +++|+|.|. |..+.++.+.. .....+...
T Consensus       279 A~~~Fl~~L~gv~DPE~KRKIIG~~---------FI--~vfe~~a~~~~~~~~L~QGTlYPDvIES~~~~-~~a~~IKsH  346 (513)
T PRK00074        279 ASDRFLSALAGVTDPEEKRKIIGRE---------FI--EVFEEEAKKLGGVKFLAQGTLYPDVIESASGT-GKAATIKSH  346 (513)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHH---------HH--HHHHHHHHHCCCCCEEECCCCCCCEEEECCCC-CCCCCCCCC
T ss_conf             4899999737998979967887789---------99--99999997579983996467655068847989-998860487


Q ss_pred             CCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             578787318986302022100334256899789899997412543
Q gi|254780151|r  167 MDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       167 ~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      ++        .-+|++..=-+++-||.+|.|+|||++++++|||-
T Consensus       347 HN--------Vgglp~~~~~~lvEPlr~lfKDEVR~lg~~Lglp~  383 (513)
T PRK00074        347 HN--------VGGLPEDMKLKLVEPLRELFKDEVRKLGLELGLPE  383 (513)
T ss_pred             CC--------CCCCHHHCCCEEEEEHHHHCCHHHHHHHHHHCCCH
T ss_conf             75--------87885664875450317561589999999968977


No 13 
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only]
Probab=99.74  E-value=7e-18  Score=148.49  Aligned_cols=160  Identities=30%  Similarity=0.482  Sum_probs=119.8

Q ss_pred             CCC-EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             338-8999960985799999999886-98499999870478766555577881899999999999809958981707886
Q gi|254780151|r   19 KDM-RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~-kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      |.+ ||+||+|||||||+.|++.++. |-+|.++|...   +        -...+.+++|+..|+++||.|.++++... 
T Consensus        15 k~~~kv~vAfSGGvDSslLa~la~~~lG~~v~AvTv~s---P--------~~p~~e~e~A~~~A~~iGi~H~~i~~~~~-   82 (269)
T COG1606          15 KEKKKVVVAFSGGVDSSLLAKLAKEALGDNVVAVTVDS---P--------YIPRREIEEAKNIAKEIGIRHEFIKMNRM-   82 (269)
T ss_pred             HHCCEEEEEECCCCCHHHHHHHHHHHHCCCEEEEEEEC---C--------CCCHHHHHHHHHHHHHHCCCCEEEEHHHC-
T ss_conf             64373999965884279999999997356469999716---8--------77766606789999994876246550002-


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             63224411267870886120000154110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                           +    -+..-.++|+|..|.+.+ |..|.+.|.+.|.|.|+.|.    +.++-.+  .++ .+|+.-        
T Consensus        83 -----~----~~~~~n~~~rCY~CK~~v-~~~l~~~a~~~Gyd~V~dGt----NasDl~~--~RP-G~rA~k--------  137 (269)
T COG1606          83 -----D----PEFKENPENRCYLCKRAV-YSTLVEEAEKRGYDVVADGT----NASDLFD--YRP-GLRALK--------  137 (269)
T ss_pred             -----C----HHHCCCCCCCCHHHHHHH-HHHHHHHHHHCCCCEEEECC----CHHHHCC--CCC-CHHHHH--------
T ss_conf             -----5----233049987355778999-99999999973998897477----5787337--883-023577--------


Q ss_pred             EEEECCHHHCEEECCCCC--CCHHHHHHHHHHCCCCCCCHHHCCCEEECCC
Q ss_conf             863020221003342568--9978989999741254355111023011127
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGD--MKKESVRDLAREMGLDIADKSDSQDICFVQQ  225 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~--~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~  225 (408)
                             .+ .+--||-+  ++|.|||++|+++||++.+||.  .-|....
T Consensus       138 -------E~-gi~sPl~e~gitk~eIre~a~~lgl~~~~kp~--~aCl~sr  178 (269)
T COG1606         138 -------EL-GIRSPLAEFGITKKEIREIAKSLGLPTWDKPS--MACLASR  178 (269)
T ss_pred             -------HC-CCCCHHHHHCCCHHHHHHHHHHCCCCCCCCCC--CCCCCCC
T ss_conf             -------60-77771888397599999999975998455865--4332000


No 14 
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase. It contains two subdomains; the ATP pyrophosphatase domain which closes to the N-termial and the dimerization domain at C-terminal end. The ATP-PPase is a twisted, five-stranded parallel beta-sheet sandwiched between helical layers. It has a signature nucleotide-binding motif, or P-loop, at the end of the first-beta strand.The dimerization domain formed by the C-terminal 115 amino acid for prokaryotic proteins. It is adjacent to teh ATP-binding site of the ATP-PPase subdomain. The largest difference between the primary sequence of prokaryotic and eukaryotic GMP synthetase map to the dimerization domain.Eukaryotic GMP synthetase has several large insertions relative to prokaryotes.
Probab=99.70  E-value=4.6e-16  Score=135.46  Aligned_cols=159  Identities=29%  Similarity=0.372  Sum_probs=109.1

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH-HHCCCCEEECCHHHHHHHH
Q ss_conf             8999960985799999999886-9849999987047876655557788189999999999-9809958981707886632
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC-DTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va-~~LgI~~~~~d~~~~f~~~   99 (408)
                      ||++|+||||||||+|+||.++ |-+++++|+.+   +.....        +.+.+.+.. +++++++..+|.+++|.+.
T Consensus         1 kVi~~lSGGVDStV~A~Ll~kAig~~l~~vfVDn---GlmRk~--------E~e~V~~~~~~~~~~~~~~vdas~~Fl~~   69 (295)
T cd01997           1 KVILALSGGVDSTVAAVLLHKAIGDRLTCVFVDN---GLLRKN--------EAERVEELFSKLLGINLIVVDASERFLSA   69 (295)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHCCEEEEEECC---CCCCCC--------CHHHHHHHHHHHCCCCEEEECHHHHHHHH
T ss_conf             9899905782899999999988650569999858---978888--------29999999987069977995669999998


Q ss_pred             ---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCC-CCEECCCC-CCCEEEECCCCCCCEEEEEECCCCCCCCE
Q ss_conf             ---24411267870886120000154110588888740168-76452253-11025412678773168853157878731
Q gi|254780151|r  100 ---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG-ADVLATGH-YIRSRLYVGDDGKRRRIMCRPMDLERDQS  174 (408)
Q Consensus       100 ---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g-~~~iATGH-Yar~~~~~~~~~~~~~~L~r~~D~~KDQS  174 (408)
                         |.+|=-.--.-|.|         +|  ..|-+.|++++ ++|+|.|. |..+.++.+..+. ...+...++.     
T Consensus        70 L~gv~DPE~KRKiIG~~---------Fi--~vf~~~~~~~~~~~~L~QGTlyPDvIES~~~~~~-a~~IKsHHNv-----  132 (295)
T cd01997          70 LKGVTDPEEKRKIIGET---------FI--EVFEEEAKKLGLAEYLAQGTLYPDVIESGSGKGS-ADTIKSHHNV-----  132 (295)
T ss_pred             HCCCCCHHHHHHHHHHH---------HH--HHHHHHHHHCCCCCEEEECCCCCCEEECCCCCCC-CCEEEEECCC-----
T ss_conf             65877925636565389---------99--9999999755886189724302625750788888-7514522456-----


Q ss_pred             EEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             8986302022100334256899789899997412543
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                         -.|+++.--+++-||.+|.|+|||++++++|||.
T Consensus       133 ---ggLp~~~~~kliEPLr~LfKDEVR~lG~~LGlp~  166 (295)
T cd01997         133 ---GGLPEDMKLKLIEPLRDLFKDEVRELGRELGLPE  166 (295)
T ss_pred             ---CCCCHHCCCCCCHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             ---7772322654001678874599999999868978


No 15 
>PRK00919 GMP synthase subunit B; Validated
Probab=99.70  E-value=7.6e-17  Score=141.09  Aligned_cols=158  Identities=26%  Similarity=0.364  Sum_probs=111.3

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             788863388999960985799999999886-9849999987047876655557788189999999999980995898170
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      +++...+.||++|+||||||||||+||.++ |-+++++|+.+   +.....        +.+.+.+..+. |+++.++|.
T Consensus        14 Ir~~Vg~~kvi~~lSGGVDStV~A~Ll~kAig~~l~~v~VD~---GllR~~--------E~~~V~~~~~~-~~~l~~vda   81 (306)
T PRK00919         14 IREEVGDGKAIIALSGGVDSSVAAVLAHRAIGDRLLAVYVDT---GLMRKG--------ETERIREIFKD-GLNLRIVDA   81 (306)
T ss_pred             HHHHHCCCCEEEEECCCCHHHHHHHHHHHHHHCCEEEEEECC---CCCCCC--------CHHHHHHHHHH-CCCCEEEEH
T ss_conf             999848985999916884799999999988642659999868---988798--------69999999983-589289834


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHH-----HHHHHHCCCCCCEECCCC-CCCEEEECCCCCCCEEEEEEC
Q ss_conf             78866322441126787088612000015411058-----888874016876452253-110254126787731688531
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS-----DLLSVTRQLGADVLATGH-YIRSRLYVGDDGKRRRIMCRP  166 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~-----~l~~~a~~~g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~  166 (408)
                      ++.|.+.         .+|.| +|-  =.|.| +|     .|-+.|+++|++|+|.|. |..+.++.+.       +...
T Consensus        82 ~~~Fl~~---------L~gv~-DPE--~KRKi-IG~~Fi~vfe~~~~~~~~~~LaQGTlyPDvIES~~~-------IKSH  141 (306)
T PRK00919         82 SDRFLEA---------LKGVT-DPE--EKRKI-IGETFIRVFEEVAKEIGAEYLVQGTIAPDWIESEGG-------IKSH  141 (306)
T ss_pred             HHHHHHH---------HCCCC-CHH--HCCCH-HHHHHHHHHHHHHHHHCCCEEEECEECCCHHHCCCC-------CCCC
T ss_conf             9999997---------37998-956--74602-579999999999998298768511073760204676-------4341


Q ss_pred             CCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             578787318986302022100334256899789899997412543
Q gi|254780151|r  167 MDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       167 ~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      ++.        -+|++..=-+++-||.+|.|+|||++++++|||-
T Consensus       142 HNV--------ggLp~~m~~kliEPLr~LfKDEVR~lG~~LGlp~  178 (306)
T PRK00919        142 HNV--------GGLPEGMVLKIVEPLRDLYKDEVREVARALGLPE  178 (306)
T ss_pred             CCC--------CCCHHHCCCCCCCHHHHHHHHHHHHHHHHHCCCH
T ss_conf             668--------8773323563103189985599999999969788


No 16 
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism]
Probab=99.66  E-value=7.7e-16  Score=133.88  Aligned_cols=165  Identities=26%  Similarity=0.319  Sum_probs=115.1

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH-HHHHCCCCEEECC
Q ss_conf             788863388999960985799999999886-98499999870478766555577881899999999-9998099589817
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR-VCDTINVSHYVFD   91 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~-va~~LgI~~~~~d   91 (408)
                      +.++..+.||++|+||||||||||.|++++ |-.++++|+..   +.....+        -+.+++ ..+++|+++.++|
T Consensus        15 ir~~vg~~kvi~alSGGVDSsv~a~L~~~AiGd~l~cvfVD~---GLlR~~E--------~e~V~~~f~~~~~~nl~~Vd   83 (315)
T COG0519          15 IREQVGDGKVILALSGGVDSSVAAVLAHRAIGDQLTCVFVDH---GLLRKGE--------AEQVVEMFREHLGLNLIVVD   83 (315)
T ss_pred             HHHHHCCCEEEEEECCCCCHHHHHHHHHHHHHCCEEEEEECC---CCCCCCC--------HHHHHHHHHHHCCCCEEEEC
T ss_conf             999728853999833878089999999997405248999637---7434785--------69999998753298459975


Q ss_pred             HHHHHHHH---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC-CCCEEEECCCCCCCEEEEEECC
Q ss_conf             07886632---2441126787088612000015411058888874016876452253-1102541267877316885315
Q gi|254780151|r   92 YEERFRNA---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH-YIRSRLYVGDDGKRRRIMCRPM  167 (408)
Q Consensus        92 ~~~~f~~~---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~~  167 (408)
                      .+++|-..   |-+|=-.--.-|+|         +  ...|-+.|++++++|+|.|. |..+..+.+..  . ..+...+
T Consensus        84 A~~~Fl~~L~GvtDPE~KRKiIG~~---------F--i~VFe~ea~k~~~~~LaQGTiYpDvIES~~g~--~-~~IKSHH  149 (315)
T COG0519          84 AKDRFLSALKGVTDPEEKRKIIGRE---------F--IEVFEEEAKKLGAEFLAQGTIYPDVIESGTGK--A-GTIKSHH  149 (315)
T ss_pred             HHHHHHHHHCCCCCHHHHHHHHHHH---------H--HHHHHHHHHHCCCCEEEECCCCCCEEEECCCC--C-CCCCCCC
T ss_conf             4988998843999889989998799---------9--99999999857860687044345046506888--8-8621356


Q ss_pred             CCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             78787318986302022100334256899789899997412543
Q gi|254780151|r  168 DLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       168 D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      +.        -+||...--+++-||.++.|+|||++++++|||-
T Consensus       150 NV--------GGLP~~m~lkLvEPLr~LfKDEVR~lg~~LGlp~  185 (315)
T COG0519         150 NV--------GGLPEDMKLKLVEPLRELFKDEVRELGRELGLPE  185 (315)
T ss_pred             CC--------CCCCCCCCEEEEHHHHHHHHHHHHHHHHHHCCCH
T ss_conf             26--------8895014222307789886899999999859988


No 17 
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domainhas  a strongly conserved motif SGGKD at the N terminus.
Probab=99.66  E-value=3.1e-16  Score=136.71  Aligned_cols=165  Identities=22%  Similarity=0.323  Sum_probs=113.2

Q ss_pred             EEEEEECCCHHHHHHHHHHHH------CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             899996098579999999988------69849999987047876655557788189999999999980995898170788
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKR------DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~------~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ||+||+|||+||++.+.+|++      .++++.++|+.   +....      .+.++.+.++..|+.++||++++.+.+.
T Consensus         1 kilva~SGG~DS~~Ll~ll~~~~~~~~~~~~l~~~hvn---h~~r~------~s~~~~~~v~~~~~~~~i~~~~~~~~~~   71 (185)
T cd01993           1 RILVALSGGKDSLVLLHVLKKLQRRYPYGFELEALTVD---EGIPG------YRDESLEVVERLAEELGIELEIVSFKEE   71 (185)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEEC---CCCCC------CCHHHHHHHHHHHHHCCCCEEEEEEEEC
T ss_conf             98999658499999999999988864889569999956---99888------8899999999989962993599876403


Q ss_pred             HHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             66322441126787088612000015411058888874016876452253110254126787731688531578787318
Q gi|254780151|r   96 FRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus        96 f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      .      ............+||..|. .++...|.+.|++.|+++|+|||.+.=..    + +--..|.||....     
T Consensus        72 ~------~~~~~~~~~~~~~~c~~c~-r~Rr~~l~~~~~~~~~~~i~~gHh~dD~~----E-T~l~~l~rg~~~~-----  134 (185)
T cd01993          72 Y------TDDIEVKKRGGKSPCSLCG-VLRRGLLNKIAKELGADKLATGHNLDDEA----E-TLLMNLLRGGILR-----  134 (185)
T ss_pred             C------CCCHHHHHHHHCCHHHHHH-HHHHHHHHHHHHHCCCCEEEEECCHHHHH----H-HHHHHHHCCCCHH-----
T ss_conf             6------7638999986406346899-99999999999981998897533076899----9-9999998489700-----


Q ss_pred             EEEEECCHHH----CEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             9863020221----003342568997898999974125435
Q gi|254780151|r  176 FLFATTQQQL----CDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       176 fL~~l~~~~L----~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .|...+....    -.++-||-.++|+|+++.|++.+|+--
T Consensus       135 ~~~~~~~~~~~~~~i~iiRPLL~~~k~ei~~y~~~~~l~~~  175 (185)
T cd01993         135 LMRPGPILYLDEGDVTRIRPLVYVREKEIVLYAELNGLPFV  175 (185)
T ss_pred             HCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCEE
T ss_conf             05676633356898479954988989999999998799878


No 18 
>pfam02540 NAD_synthase NAD synthase. NAD synthase (EC:6.3.5.1) is involved in the de novo synthesis of NAD and is induced by stress factors such as heat shock and glucose limitation.
Probab=99.59  E-value=1.7e-14  Score=124.22  Aligned_cols=159  Identities=25%  Similarity=0.325  Sum_probs=109.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             3388999960985799999999886-9-8499999870478766555577881899999999999809958981707886
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      +.+++++|+|||+||||+|+|++++ | -.|.|++|-           ....++++.++|+.+|+.|||+++++|+.+.|
T Consensus        17 g~~gvViGlSGGIDSav~a~La~~AlG~~~v~~v~mP-----------~~~ss~~s~~~A~~la~~lgi~~~~i~I~~~~   85 (243)
T pfam02540        17 GAKGVVLGLSGGIDSAVVAYLAVKALGKENVLALIMP-----------SINSSEEDVQDALALAENLGINYKTIDIKPIV   85 (243)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECC-----------CCCCCHHHHHHHHHHHHHHCCCEEEEECHHHH
T ss_conf             9991999788879999999999995597428999647-----------77898889999999999968926999888999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECC--C--CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCC
Q ss_conf             632244112678708861200001--5--411058888874016876452253110254126787731688531578787
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDC--N--RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERD  172 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~C--N--~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KD  172 (408)
                      .         ++.....|+.+-..  |  .++.--.|+.+|.+.|.=.+.||...  +...|      +. ..--|    
T Consensus        86 ~---------~~~~~~~~~~~~~a~~Ni~aR~Rm~~ly~~A~~~~~lVlgT~Nks--E~~~G------y~-TkyGD----  143 (243)
T pfam02540        86 R---------AFSQLFQPAKDDLAKGNLKARIRMIILYAHANKFNRLVLGTGNKS--ELALG------YF-TKYGD----  143 (243)
T ss_pred             H---------HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCC--CEEEE------EE-EECCC----
T ss_conf             9---------999885320137787455788889999986233791898168704--20054------32-31277----


Q ss_pred             CEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEE
Q ss_conf             31898630202210033425689978989999741254--355111023011
Q gi|254780151|r  173 QSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICF  222 (408)
Q Consensus       173 QSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICF  222 (408)
                                  ..--+-||+++.|.|||++|+.+|+|  +-+|+=|-|+.-
T Consensus       144 ------------~~~di~Pi~dL~KteV~~la~~l~vP~~ii~k~Psa~L~~  183 (243)
T pfam02540       144 ------------GACDIAPIGDLYKTQVYELAKRLNVPERIIKKPPSADLWP  183 (243)
T ss_pred             ------------CCCCHHHHCCCCHHHHHHHHHHHCCCHHHHHCCCCCCCCC
T ss_conf             ------------7655154168818999999999498888983799988888


No 19 
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning]
Probab=99.58  E-value=1e-14  Score=125.83  Aligned_cols=163  Identities=23%  Similarity=0.312  Sum_probs=114.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCC--CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             3889999609857999999998869--84999998704787665555778818999999999998099589817078866
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDG--YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G--~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      +.||+||+|||.||++++++|++.+  +++.++|+..   +-..      .++.+.+.++.+|+.+|||+++.++...+.
T Consensus        21 ~~~ilVavSGGkDS~~ll~~L~~l~~~~~~~a~~Vd~---~~~~------~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~   91 (298)
T COG0037          21 EYKILVAVSGGKDSLALLHLLKELGRRIEVEAVHVDH---GLRG------YSDQEAELVEKLCEKLGIPLIVERVTDDLG   91 (298)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECC---CCCC------CCHHHHHHHHHHHHHCCCCEEEEEHHHHHH
T ss_conf             7858999378789999999999842257389999708---9886------432899999999996499848862045431


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEE
Q ss_conf             32244112678708861200001541105888887401687645225311025412678773168853157878731898
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL  177 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL  177 (408)
                      ....+          ..|||..| +.+++..|.+.|+++|+++|||||.+.-....-     ---+.++....     .|
T Consensus        92 ~~~~~----------~~~~c~~c-~~~R~~~l~~~a~~~g~~~i~tgH~~dD~~et~-----lm~l~~g~~~~-----~l  150 (298)
T COG0037          92 RETLD----------GKSICAAC-RRLRRGLLYKIAKELGADKIATGHHLDDQAETF-----LMNLLRGSGLR-----GL  150 (298)
T ss_pred             HCCCC----------CCCHHHHH-HHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHH-----HHHHHCCCCHH-----HH
T ss_conf             00246----------76787999-999999999999985999898567846899999-----99986175224-----56


Q ss_pred             EEECCHH----HCEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             6302022----1003342568997898999974125435
Q gi|254780151|r  178 FATTQQQ----LCDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       178 ~~l~~~~----L~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      ..++...    ....+=||-.+++.||+..|...|||..
T Consensus       151 ~~~~~~~~~~~~~~~iRPL~~~~~~ei~~~~~~~~l~~~  189 (298)
T COG0037         151 RGMPPKRPFEGGLLIIRPLLYVREKEIELYAKEKGLPYI  189 (298)
T ss_pred             HCCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCCEE
T ss_conf             408852445788645475746889999999997599875


No 20 
>PRK00876 nadE NAD synthetase; Reviewed
Probab=99.54  E-value=1.7e-13  Score=117.12  Aligned_cols=169  Identities=22%  Similarity=0.250  Sum_probs=110.8

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             863388999960985799999999886-9-84999998704787665555778818999999999998099589817078
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      ..+.+-+++|+|||+||||+|+|.+++ | -+|.|+.|--           .-+++++..+|+.+|+.|||++.++|+..
T Consensus        30 ~~~~kG~VlGlSGGIDSAv~a~Lav~AlG~e~V~gl~MP~-----------~~s~~~s~~~a~~la~~lGi~~~~idI~~   98 (325)
T PRK00876         30 TLKRRGVVLGLSGGIDSSVTLALCVRALGKDRVLGLLMPE-----------RDSSPDSLRLGRMLAESLGVEYVVEDISP   98 (325)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCC-----------CCCCHHHHHHHHHHHHHCCCCEEEEECHH
T ss_conf             1698679996876888999999999974855169997886-----------56887789999999998199359984489


Q ss_pred             HHH--------HHCC-----------------CCCHHH------HH-----------CCCCCCCEE------CCCCEEEH
Q ss_conf             866--------3224-----------------411267------87-----------088612000------01541105
Q gi|254780151|r   95 RFR--------NAVI-----------------VPFASS------YA-----------AGETPLPCV------DCNRTVKF  126 (408)
Q Consensus        95 ~f~--------~~V~-----------------~~~~~~------y~-----------~G~TPNPc~------~CN~~iKF  126 (408)
                      -+.        +..+                 ..+++.      +.           ....||+=.      .--.++..
T Consensus        99 ~l~~~~~y~~~d~~i~~~~p~~~~~~~~~i~~~~~l~~~~~~~~~l~~~~~~~~~~~~~l~~~~~l~~~a~~NiKaR~RM  178 (325)
T PRK00876         99 ALEALGCYERRDEAIRRVVPEYGPGWKSKLVLPNFLEGDLLNVPYLVVQDPGGEVRKKRLPPADYLQIVAATNFKQRTRK  178 (325)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCHHCCCCCCCHHCCCCCCCHHHHCCCCCCCCCCCCCCHHHHHHHHHHCCHHHHHHH
T ss_conf             99875431356888875033324200000002311102322310121046421000013550344445553233689999


Q ss_pred             HHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHH
Q ss_conf             88888740168764522531102541267877316885315787873189863020221003342568997898999974
Q gi|254780151|r  127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE  206 (408)
Q Consensus       127 ~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~  206 (408)
                      -.++.+|.+.|.=-+-|||-+  +...|      +.-.-| |-                .-=+-||+++.|.|||++|+.
T Consensus       179 ~~lY~~A~~~n~lVlGT~Nks--E~~~G------yfTKyG-DG----------------a~Di~PI~~LyKtQV~~LA~~  233 (325)
T PRK00876        179 MVEYYHADRLNYAVAGTPNRL--EYDQG------FFVKYG-DG----------------AADLKPIAHLYKTQVYALAEY  233 (325)
T ss_pred             HHHHHHHHHCCCEEECCCCHH--HHHHC------CEEEEC-CC----------------CCCCCCCCCCCHHHHHHHHHH
T ss_conf             999999987398776588465--56635------147544-78----------------878451357758999999998


Q ss_pred             CCCC--CCCHHHCCCEE
Q ss_conf             1254--35511102301
Q gi|254780151|r  207 MGLD--IADKSDSQDIC  221 (408)
Q Consensus       207 ~gl~--~a~K~eSqgIC  221 (408)
                      +|+|  +.+|+=|-|+-
T Consensus       234 LgvPe~Ii~K~PSadLw  250 (325)
T PRK00876        234 LGVPEEIRRRPPTTDTY  250 (325)
T ss_pred             CCCCHHHHCCCCCCCCC
T ss_conf             09999993699981335


No 21 
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD). The conversion of NaAD to NAD+ occurs via an NAD-adenylate intermediate and requires ATP and Mg2+. The intemediate is subsequently cleaved into NAD+ and AMP. In many prokaryotes, such as E. coli , NAD synthetase consists of a single domain and is strictly ammonia dependent. In contrast, eukaryotes and other prokaryotes have an additional N-terminal amidohydrolase domain that prefer glutamine, Interestingly, NAD+ synthases in these prokaryotes, can also utilize ammonia as an amide source .
Probab=99.53  E-value=2.8e-14  Score=122.73  Aligned_cols=166  Identities=27%  Similarity=0.369  Sum_probs=116.8

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             8863388999960985799999999886-9-8499999870478766555577881899999999999809958981707
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      +...-.++++|+|||+||+|+|+|..++ | ..|.|++|-..           -+++++.++|+.+|+.|||++..+++.
T Consensus        19 ~~~g~~~~viGlSGGIDSav~a~La~~Alg~~~v~~v~mP~~-----------~ss~~s~~~A~~la~~lgi~~~~i~I~   87 (248)
T cd00553          19 RKSGFKGVVLGLSGGIDSALVAALAVRALGRENVLALFMPSR-----------YSSEETREDAKELAEALGIEHVNIDID   87 (248)
T ss_pred             HHCCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCCC-----------CCCHHHHHHHHHHHHHHCCCEEEECHH
T ss_conf             981999199958888999999999999728875999889997-----------898758999999999958916871559


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCC--CEECCC--CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCC
Q ss_conf             8866322441126787088612--000015--411058888874016876452253110254126787731688531578
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPL--PCVDCN--RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDL  169 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPN--Pc~~CN--~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~  169 (408)
                      ..|..     |.........++  +-..=|  .++.--.|+..|.+.|.=.+.||+..-  ...|      +.-.-| |.
T Consensus        88 ~~~~~-----~~~~~~~~~~~~~~~~~~~NiqaRlRm~~Ly~~An~~~~lVlgTgNksE--~~~G------y~TkyG-D~  153 (248)
T cd00553          88 PAVEA-----FLALLGESGGSELEDLALGNIQARLRMVILYALANKLGGLVLGTGNKSE--LLLG------YFTKYG-DG  153 (248)
T ss_pred             HHHHH-----HHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCHHH--HHHC------CCEECC-CC
T ss_conf             99999-----9998644048705567874248788899999999744998962874607--8757------210007-87


Q ss_pred             CCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEE
Q ss_conf             78731898630202210033425689978989999741254--355111023011
Q gi|254780151|r  170 ERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICF  222 (408)
Q Consensus       170 ~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICF  222 (408)
                                      .--+-||+++.|.||+++|+.+|+|  +-+|+=|-|++-
T Consensus       154 ----------------~~d~~Pi~~L~Kt~V~~la~~l~vp~~Ii~k~PSaeL~~  192 (248)
T cd00553         154 ----------------AADINPIGDLYKTQVRELARYLGVPESIIDKPPSAELWP  192 (248)
T ss_pred             ----------------CCCCCCCCCCCHHHHHHHHHHHCCHHHHHCCCCCCCCCC
T ss_conf             ----------------758221368849999999999688898734799966679


No 22 
>PRK13980 NAD synthetase; Provisional
Probab=99.49  E-value=1.8e-13  Score=116.98  Aligned_cols=158  Identities=25%  Similarity=0.283  Sum_probs=109.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             3388999960985799999999886-9-8499999870478766555577881899999999999809958981707886
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      +-+++++|+|||+||+|+|+|..++ | -+|.|++|-           ....++++.+||+.+|+.|||++..+|+...|
T Consensus        27 g~kg~VlGlSGGIDSavva~La~~Alg~~~v~~v~mP-----------~~~ss~~s~~dA~~la~~lgi~~~~i~I~~~~   95 (264)
T PRK13980         27 GFKGVVLGLSGGIDSAVVAYLAVKALGKENVLALLMP-----------YRVSPPEDLEDALLVAERLGIEYKVIEITPIV   95 (264)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCCCCEEEEECC-----------CCCCCHHHHHHHHHHHHHHCCCEEEEECHHHH
T ss_conf             9980999798688899999999985496606899898-----------99998878999999999869984998279999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECC----CCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCC
Q ss_conf             632244112678708861200001----5411058888874016876452253110254126787731688531578787
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDC----NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERD  172 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~C----N~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KD  172 (408)
                      ..         |.+.. |+.+-.-    -.++.--.|+.+|...|.=.+.||+-.  +...|      +.-.-| |.   
T Consensus        96 ~~---------~~~~~-~~~~~~~~~NiqaR~Rm~~Ly~~An~~~~lVlgTgNks--E~~~G------y~TkyG-D~---  153 (264)
T PRK13980         96 DA---------FFSAV-PDADRLRRGNIMARTRMVLLYDYANRDNRLVLGTSNKS--ELLLG------YFTKYG-DG---  153 (264)
T ss_pred             HH---------HHHHC-CCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCHH--HHHHH------HCCCCC-CC---
T ss_conf             99---------99863-10006688875898999999998643397765588674--79872------100168-76---


Q ss_pred             CEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEE
Q ss_conf             31898630202210033425689978989999741254--355111023011
Q gi|254780151|r  173 QSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICF  222 (408)
Q Consensus       173 QSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICF  222 (408)
                                   .--+-||+++.|.||+++|+.+|+|  +-+|+=|-|+..
T Consensus       154 -------------~~d~~Pi~dL~Kt~V~~La~~l~vP~~Ii~k~PSa~L~~  192 (264)
T PRK13980        154 -------------AVDINPIGDLYKTQVRELARHLGVPEDIIEKPPSADLWE  192 (264)
T ss_pred             -------------CCCHHHHCCCCHHHHHHHHHHHCCCHHHEECCCCCCCCC
T ss_conf             -------------656245258739999999999399664403699977679


No 23 
>pfam01171 ATP_bind_3 PP-loop family. This family of proteins belongs to the PP-loop superfamily.
Probab=99.46  E-value=2e-13  Score=116.67  Aligned_cols=167  Identities=20%  Similarity=0.281  Sum_probs=107.2

Q ss_pred             EEEEEECCCHHHHHHHHHHHH----CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             899996098579999999988----6984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKR----DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      ||+||+|||+||.+.+++|++    .++++.++|+. +....        .+.++.+.+++.|+.+|||+++.++...  
T Consensus         1 ki~vavSGG~DS~~Ll~~l~~~~~~~~~~~~~~hvn-h~lr~--------~s~~~~~~v~~~~~~~~i~~~i~~~~~~--   69 (182)
T pfam01171         1 KILVAVSGGPDSMALLYLLKKLKPKFGIDLTAAHVD-HGLRE--------ESDREAQFVKELCRQLNIPLEVLRVDVA--   69 (182)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEE-CCCCC--------CHHHHHHHHHHHHHHCCCCEEEEEEECC--
T ss_conf             999996785999999999999999759978999987-99865--------4058999999999985997599997347--


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEE
Q ss_conf             32244112678708861200001541105888887401687645225311025412678773168853157878731898
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL  177 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL  177 (408)
                       ..-..           |..-.| |.+.++.|.+.|++.|+++|+|||.+.=..    + +--..|.||....     -|
T Consensus        70 -~~~~~-----------~~e~~a-R~~Ry~~l~~~a~~~~~~~i~lgHh~DD~~----E-T~lm~l~rG~~~~-----gl  126 (182)
T pfam01171        70 -KKSGL-----------NLEEAA-REARYDFFEEIAKKNGAEVLLTAHHADDQA----E-TFLMRLLRGSGLA-----GL  126 (182)
T ss_pred             -CCCCC-----------CHHHHH-HHHHHHHHHHHHHHHCCCEEEEECCCCHHH----H-HHHHHHHCCCCCC-----CC
T ss_conf             -66787-----------775789-999999999989861766488743423299----9-9999997289811-----03


Q ss_pred             EEECCHH-H--CEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEE
Q ss_conf             6302022-1--0033425689978989999741254355111023011
Q gi|254780151|r  178 FATTQQQ-L--CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICF  222 (408)
Q Consensus       178 ~~l~~~~-L--~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICF  222 (408)
                      +.++... +  -+++=||=.++|+|++..|++.+||.-+-+-.++.-|
T Consensus       127 ~gm~~~~~~~~~~iiRPLl~~~k~ei~~~a~~~~l~~~~D~sN~d~~~  174 (182)
T pfam01171       127 AGIAPVRPLAGGRIVRPLLKVTKSEIEEYLKEHGIPWVEDESNADLRY  174 (182)
T ss_pred             CCCCCCCCCCCCEEECCCCCCCHHHHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             388751346894387021148899999999986993689908899876


No 24 
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This domain has  a strongly conserved motif SGGXD at the N terminus.
Probab=99.43  E-value=4.9e-13  Score=113.81  Aligned_cols=174  Identities=19%  Similarity=0.253  Sum_probs=109.9

Q ss_pred             EEEEEECCCHHHHHHHHHHHH----CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             899996098579999999988----6984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKR----DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      ||+||+|||+||.+.+.+|++    .++++.++|+. +....        .+.++.+.++..|+.+|||+++....... 
T Consensus         1 ki~vavSGG~DS~~Ll~~l~~~~~~~~~~l~a~hvd-h~lr~--------~s~~~~~~v~~~~~~~~i~~~i~~~~~~~-   70 (185)
T cd01992           1 KILVAVSGGPDSMALLHLLSELKPRLGLRLVAVHVD-HGLRP--------ESDEEAAFVADLCAKLGIPLYILVVALAP-   70 (185)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEE-CCCCC--------CCHHHHHHHHHHHHHCCCCEEEEEEEECC-
T ss_conf             999996784999999999999999749948999981-89888--------88899999999999859988999977536-


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEE
Q ss_conf             32244112678708861200001541105888887401687645225311025412678773168853157878731898
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL  177 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL  177 (408)
                                   ...-|..-.| |...++.|.+.|++.|+++|+|||.+.=..    + +---.|.||....     .|
T Consensus        71 -------------~~~~~~e~~a-R~~Ry~~l~~~~~~~~~~~i~lgHh~dD~~----E-T~lm~l~rg~~~~-----gl  126 (185)
T cd01992          71 -------------KPGGNLEAAA-REARYDFFAEIAKEHGADVLLTAHHADDQA----E-TVLMRLLRGSGLR-----GL  126 (185)
T ss_pred             -------------CCCCCHHHHH-HHHHHHHHHHHHHHHCCCCEEECCCHHHHH----H-HHHHHHHCCCCCC-----CC
T ss_conf             -------------7899999999-999999999999873545042036303689----9-9999987189964-----15


Q ss_pred             EEECCHHH---CEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHH
Q ss_conf             63020221---0033425689978989999741254355111023011127751034553
Q gi|254780151|r  178 FATTQQQL---CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKR  234 (408)
Q Consensus       178 ~~l~~~~L---~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~  234 (408)
                      +.++....   -.++=||=.++|.|+++.|++.+|+-.+-+-.++.-|     .++++++
T Consensus       127 ~gm~~~~~~~~~~iiRPLL~~~k~ei~~~~~~~~i~~~~D~sN~d~~y-----~Rn~iR~  181 (185)
T cd01992         127 AGMPARIPFGGGRLIRPLLGITRAEIEAYLRENGLPWWEDPSNEDPRY-----TRNRIRH  181 (185)
T ss_pred             CCCCCCCCCCCCEEEEHHHHHHHHHHHHHHHHCCCCEEECCCCCCCCC-----CHHHHHH
T ss_conf             277841357995287157785399999999984995679908799876-----3999974


No 25 
>pfam06508 ExsB ExsB. This family includes putative transcriptional regulators from Bacteria and Archaea.
Probab=99.42  E-value=1.4e-12  Score=110.65  Aligned_cols=113  Identities=24%  Similarity=0.337  Sum_probs=85.6

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH---H
Q ss_conf             8999960985799999999886984999998704787665555778818999999999998099589817078866---3
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR---N   98 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~---~   98 (408)
                      |++|.||||+||++++++++++|++|.++++...          . .+..+++.|+++|++|||+|+++|+.-...   .
T Consensus         1 Kavvl~SGG~DSt~~l~~a~~~~~~v~ait~dYG----------Q-~~~~Ei~~A~~ia~~l~i~h~vidl~~l~~~~~s   69 (137)
T pfam06508         1 KAVVLLSGGLDSTTCLAWAKKEGYEVYALTFDYG----------Q-RHSKELECAKKIAKALGVEHKIVDLDFLKQIGGS   69 (137)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEECCC----------C-CHHHHHHHHHHHHHHCCCCCEEECCCHHHHHCCC
T ss_conf             9899917878999999999986996899981478----------8-7399999999999982997503033024441655


Q ss_pred             HCC----CCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             224----41126787088612000015411058888874016876452253
Q gi|254780151|r   99 AVI----VPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus        99 ~V~----~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      -..    +---.+|....+|+..+-|...|-+.....+|.++|++.|++|-
T Consensus        70 aL~~~~~~vp~~~~~~~~~~~t~VP~RN~iflsiA~a~A~~~g~~~I~~G~  120 (137)
T pfam06508        70 ALTDDSIEVPDSELESEEIPNTYVPGRNLIFLSIAASYAEAIGANDIFIGV  120 (137)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             223688555665434567877656365499999999999986999799956


No 26 
>PRK08349 hypothetical protein; Validated
Probab=99.41  E-value=9.8e-13  Score=111.68  Aligned_cols=169  Identities=21%  Similarity=0.299  Sum_probs=105.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEEECCHHHHHH
Q ss_conf             8899996098579999999988698499999870478766555577881899999999999809---9589817078866
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHYVFDYEERFR   97 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~~~d~~~~f~   97 (408)
                      ||+++.+|||.||.||||++.++|.+|+.+|+...   ..       ..++..+-++.+++..+   ..++++|+.+.+ 
T Consensus         1 ~Kvl~LlSGGiDSPVAa~~mmKRG~~V~~lhf~~~---~~-------~~~kv~~~~~~L~~~~~~~~~~~~iv~~~~~~-   69 (198)
T PRK08349          1 MKVVALLSSGIDSPVAIYLMLSRGVEIYPLHFRQD---EK-------KEHKARELVEILQEIHGGKVKDPVIVDAYEVQ-   69 (198)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHCCCEEEEEEECCC---HH-------HHHHHHHHHHHHHHHCCCCCCEEEEECCHHHH-
T ss_conf             94999965884389999999977997999986387---78-------89999999999999708887528997722532-


Q ss_pred             HHCCCCCHHHHH-CCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             322441126787-0886120000154110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   98 NAVIVPFASSYA-AGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        98 ~~V~~~~~~~y~-~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                          .+...... .+...+.|+.|-|.+ +..--+.|++.|++.|+||+=.....+..-++  -..+-.+.|.       
T Consensus        70 ----~~i~~~i~~~~~~~~~~vl~rr~M-~riA~~iA~~~g~~aivTGEsLGQVASQTl~N--L~~i~~~~~~-------  135 (198)
T PRK08349         70 ----GPVFEKLREIGKEKWTCLFCKYTM-YRVAERYAHEIGAKAIVTGDSLGQVASQTLDN--LMVISTATDL-------  135 (198)
T ss_pred             ----HHHHHHHHHCCCCCCEEHHHHHHH-HHHHHHHHHHCCCCEEEECCHHHHHHHHHHHH--HHHHHHHHCC-------
T ss_conf             ----899999986077651309999999-99999999985998898452167888999988--9999875067-------


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC-CCCCHHHCCCEE-ECCCC
Q ss_conf             863020221003342568997898999974125-435511102301-11277
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGL-DIADKSDSQDIC-FVQQG  226 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl-~~a~K~eSqgIC-Fi~~~  226 (408)
                                -++=||=.+.|+||-++|++.|. +++.+++  +-| |+++.
T Consensus       136 ----------pVlRPLig~DK~EII~~Ar~IGTye~S~~~~--~cC~~~pk~  175 (198)
T PRK08349        136 ----------PILRPLIGLDKEEIVRIAKEIGTFEISIEPE--PPCPFVPKF  175 (198)
T ss_pred             ----------CCCCCCCCCCHHHHHHHHHHHCCHHHHCCCC--CCCEEECCC
T ss_conf             ----------6647766799899999999819553432899--774410898


No 27 
>PRK05370 argininosuccinate synthase; Validated
Probab=99.40  E-value=3.1e-12  Score=108.07  Aligned_cols=168  Identities=21%  Similarity=0.294  Sum_probs=112.0

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC-EEECCHH
Q ss_conf             888633889999609857999999998869849999987047876655557788189999999999980995-8981707
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS-HYVFDYE   93 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~-~~~~d~~   93 (408)
                      +.-|..+||++|.|||.|+||++..|+++|++|++++..+.-.           .++|++.+++-|..+|.. ++++|++
T Consensus         6 ~~~~~gkKVvLAYSGGLDTSv~l~wL~e~g~eVia~taDvGQ~-----------de~d~~~i~~kA~~~GA~k~~v~D~r   74 (447)
T PRK05370          6 KHLPVGQRVGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQP-----------DEDDYDAIPRRAMEYGAENARLIDCR   74 (447)
T ss_pred             HCCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEEEECCCC-----------CCHHHHHHHHHHHHHCCCEEEEECCH
T ss_conf             0587888899995898279999999987598799999979998-----------61338999999998299789997179


Q ss_pred             HHHHHHCCCCCHHH---HH--CCC-----CC--CCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEE
Q ss_conf             88663224411267---87--088-----61--20000154110588888740168764522531102541267877316
Q gi|254780151|r   94 ERFRNAVIVPFASS---YA--AGE-----TP--LPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRR  161 (408)
Q Consensus        94 ~~f~~~V~~~~~~~---y~--~G~-----TP--NPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~  161 (408)
                      ++|.++.+ |.+..   |.  .|.     ||  -|++.       ..+.+.|++.|++.||.|-     +-   .++   
T Consensus        75 eefv~~~i-~ai~a~A~y~~~~g~~Y~l~t~laRplia-------~~lv~~a~~~ga~~iaHGa-----TG---KGN---  135 (447)
T PRK05370         75 AQLVAEGI-AAIQCGAFHISTGGVTYFNTTPLGRAVTG-------TMLVAAMKEDGVNIWGDGS-----TY---KGN---  135 (447)
T ss_pred             HHHHHHHH-HHHHHCCHHHHCCCCCCCCCCCHHHHHHH-------HHHHHHHHHHCCCEEEECC-----CC---CCC---
T ss_conf             99999999-99973623330257644587730788999-------9999999983998995577-----67---874---


Q ss_pred             EEEECCCCCCCCEEE-EE--EECCHHHCEEECCCCCC-------CHHHHHHHHHHCCCCC---CCHHHCCCEEECC
Q ss_conf             885315787873189-86--30202210033425689-------9789899997412543---5511102301112
Q gi|254780151|r  162 IMCRPMDLERDQSYF-LF--ATTQQQLCDLRFPLGDM-------KKESVRDLAREMGLDI---ADKSDSQDICFVQ  224 (408)
Q Consensus       162 ~L~r~~D~~KDQSYf-L~--~l~~~~L~~~~FPlg~~-------~K~eVR~~A~~~gl~~---a~K~eSqgICFi~  224 (408)
                                ||-=| ++  .+.+ .| +++=|.-++       +-+|--+.|++.|||+   .+|+=|+|-=..+
T Consensus       136 ----------DQVRFe~~~~~l~P-~l-kIiaPwRd~~f~~el~sR~e~i~Ya~~~gIpv~~s~ek~YSiD~NLwg  199 (447)
T PRK05370        136 ----------DIERFYRYGLLTNP-EL-KIYKPWLDQDFIDELGGRAEMSEFMIACGFDYKMSVEKAYSTDSNMLG  199 (447)
T ss_pred             ----------CHHHHHHHHHHHCC-CC-EEECCCCCHHHHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCC
T ss_conf             ----------38899999985299-87-697143346666541574999999998499876678888533633013


No 28 
>PRK13820 argininosuccinate synthase; Provisional
Probab=99.40  E-value=2.9e-12  Score=108.31  Aligned_cols=165  Identities=28%  Similarity=0.483  Sum_probs=116.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             3388999960985799999999886-98-499999870478766555577881899999999999809958981707886
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .++||++|.|||.|+|+++..|+++ || +|++++..+.-            .++|++.+++-|..+|+.++++|++++|
T Consensus         2 ~~kKVvLAySGGLDTSv~l~wL~e~yg~~eVi~~~~d~Gq------------~~e~~~~~~~kA~~~G~~~~viD~r~ef   69 (395)
T PRK13820          2 MKKKVVLAYSGGLDTSVCIPLLKEKYGYDEVITVAVDVGQ------------PEEEIKEAEEKAKKLGVKHYTIDAKEEF   69 (395)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEECCC------------CHHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             9872999968984899999999985199869999998999------------7677699999999709949998169999


Q ss_pred             HHHCCCCCHHH---HHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             63224411267---870886120000154110588888740168764522531102541267877316885315787873
Q gi|254780151|r   97 RNAVIVPFASS---YAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        97 ~~~V~~~~~~~---y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      +++-+-|.+.+   | .| -|+-+..--+.| =..+.+.|++.|++.||.|-     +-   .++.....        | 
T Consensus        70 ~~~~i~paI~ana~Y-eg-YpL~tslaRpli-a~~~v~~A~~~ga~aiaHG~-----TG---kGNDQvRF--------e-  129 (395)
T PRK13820         70 AKDYIFPAIKANALY-EG-YPLGTALARPLI-AKKIVEVAKKEGASAIAHGC-----TG---KGNDQLRF--------E-  129 (395)
T ss_pred             HHHHHHHHHHCCCCC-CC-CCCCCCHHHHHH-HHHHHHHHHHCCCEEEEECC-----CC---CCCHHHHH--------H-
T ss_conf             999999999708732-67-303241046899-99999999975982983077-----78---98709999--------9-


Q ss_pred             EEEEEEECCHHHCEEECCCCCC--CHHHHHHHHHHCCCCCC---CHHHCCCE
Q ss_conf             1898630202210033425689--97898999974125435---51110230
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDM--KKESVRDLAREMGLDIA---DKSDSQDI  220 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~--~K~eVR~~A~~~gl~~a---~K~eSqgI  220 (408)
                      .+|+   .++ | +++=|..++  +-+|-.+.|++.|+|+.   +||=|.|-
T Consensus       130 ~~~~---ap~-~-~iiaP~R~~~~~R~~~i~ya~~~gI~v~~~~~~~yS~D~  176 (395)
T PRK13820        130 AVFR---ATD-L-DVIAPIRELNLTREWEIEYAKEHGIPVPVGKEKPWSIDE  176 (395)
T ss_pred             HHHH---CCC-C-EEEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             9986---789-8-687210453345899999999859988888888852455


No 29 
>PRK10696 C32 tRNA thiolase; Provisional
Probab=99.39  E-value=1.1e-12  Score=111.20  Aligned_cols=205  Identities=18%  Similarity=0.255  Sum_probs=124.7

Q ss_pred             CCCCCCCCCCEEEEEECCCHHHHHHHHHHHH------CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             4678886338899996098579999999988------6984999998704787665555778818999999999998099
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGVDSSVVAALLKR------DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV   85 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~------~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI   85 (408)
                      -++.+=....||+||+|||.||.+-+.+|++      -.|+++++++.-...+       .   +.  ......|+.|||
T Consensus        31 ~dy~MIedGDRVlVglSGGKDS~~LL~iL~~Lq~~api~FeLvAv~lD~~~pG-------f---~~--~~L~~yl~~lGv   98 (311)
T PRK10696         31 ADFNMIEEGDRIMVCLSGGKDSYTMLEILRNLQQSAPINFSLVAVNLDQKQPG-------F---PE--HILPEYLEKLGV   98 (311)
T ss_pred             HHHCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCC-------C---CH--HHHHHHHHHCCC
T ss_conf             98587789999999826788899999999999985899855999983789999-------8---80--688999997499


Q ss_pred             CEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEE--E
Q ss_conf             58981707886632244112678708861200001541105888887401687645225311025412678773168--8
Q gi|254780151|r   86 SHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRI--M  163 (408)
Q Consensus        86 ~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~--L  163 (408)
                      |++++. .+.|.     ...+.-..|.  +||..|-+ ++.+.|.+.|+++||..||+||+..=...       ...  |
T Consensus        99 p~~i~~-~d~~~-----iv~~~~~egk--s~CslCsR-lRRg~Ly~~A~e~G~nKIALGHH~DDi~E-------TfLMNl  162 (311)
T PRK10696         99 EYKIVE-ENTYG-----IVKEKIPEGK--TTCSLCSR-LRRGILYRTATELGATKIALGHHRDDILQ-------TLFLNM  162 (311)
T ss_pred             CCEEEE-EEHHH-----HHHHHCCCCC--CHHHHHHH-HHHHHHHHHHHHCCCCEEEECCCHHHHHH-------HHHHHH
T ss_conf             707998-40767-----9987543688--63789999-99999999999869987986065055899-------999999


Q ss_pred             EECCCCCCCCEEEEEEECCH-----HHCEEECCCCCCCHHHHHHHHHHCCCCCC--CHHHCCCEEECCCCCCHHHHHHCC
Q ss_conf             53157878731898630202-----21003342568997898999974125435--511102301112775103455307
Q gi|254780151|r  164 CRPMDLERDQSYFLFATTQQ-----QLCDLRFPLGDMKKESVRDLAREMGLDIA--DKSDSQDICFVQQGKYFDVVKRIN  236 (408)
Q Consensus       164 ~r~~D~~KDQSYfL~~l~~~-----~L~~~~FPlg~~~K~eVR~~A~~~gl~~a--~K~eSqgICFi~~~~~~~Fl~~~~  236 (408)
                      .++--        |.++++.     -=-.+|=||--..-.++.+.|+..+||+-  +---||+  =+.....+.-|..+.
T Consensus       163 f~gG~--------LktM~Pkl~~d~g~~~VIRPL~y~~E~di~~~a~~~~fPiIpcnlcgsq~--~lqR~~ik~ml~~~~  232 (311)
T PRK10696        163 FYGGK--------MKGMPPKLMSDDGKHIVIRPLAYCREKDIERFADAKAFPIIPCNLCGSQP--NLQRQVIADMLRDWD  232 (311)
T ss_pred             HHCCC--------CCCCCCEEECCCCCEEEEEECCCCCHHHHHHHHHHCCCCEECCCCCCCCH--HHHHHHHHHHHHHHH
T ss_conf             96687--------63679766748997599830420159999999997599874166778836--789999999999999


Q ss_pred             CCCCCCCCE---ECCCCCEEEEE
Q ss_conf             664346711---03774322335
Q gi|254780151|r  237 AGIALEGDI---VHLNGQILGRH  256 (408)
Q Consensus       237 ~~~~~~G~i---vd~~G~viG~H  256 (408)
                      ..  -||.+   ...-++|.-.|
T Consensus       233 ~~--~p~r~~~~~~al~nv~psh  253 (311)
T PRK10696        233 KR--YPGRIETMFSAMQNVVPSH  253 (311)
T ss_pred             HH--CCCCHHHHHHHHHCCCCCH
T ss_conf             98--8882899999975489401


No 30 
>PRK00509 argininosuccinate synthase; Provisional
Probab=99.39  E-value=4.4e-12  Score=106.99  Aligned_cols=166  Identities=27%  Similarity=0.373  Sum_probs=116.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHHHH
Q ss_conf             388999960985799999999886-984999998704787665555778818999999999998099-589817078866
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEERFR   97 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~f~   97 (408)
                      .+||++|.|||.|+||++..|+++ |+||++++..+.             .++|++.+++-|..+|. .++++|++++|.
T Consensus         2 ~kKVvLAySGGLDTSv~l~wL~e~yg~eVia~~~d~G-------------q~~d~~~i~~kA~~~GA~~~~v~D~r~ef~   68 (398)
T PRK00509          2 VKKVVLAYSGGLDTSVIIKWLKEEYGCEVVAFTADVG-------------QGEELEPIREKALASGASEIYVEDLREEFV   68 (398)
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECC-------------CHHHHHHHHHHHHHHCCCEEEEECCHHHHH
T ss_conf             8549999089845999999998753988999999798-------------877889999999982997899963099999


Q ss_pred             HHCCCCCHHHH--HCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEE-EEECCCCCCCCE
Q ss_conf             32244112678--708861200001541105888887401687645225311025412678773168-853157878731
Q gi|254780151|r   98 NAVIVPFASSY--AAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRI-MCRPMDLERDQS  174 (408)
Q Consensus        98 ~~V~~~~~~~y--~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~-L~r~~D~~KDQS  174 (408)
                      ++.+-|++.+-  -.|..|.-....-+.| =..+.+.|++.|+++||.|-     +-.|.| .-|+- -.++.++.    
T Consensus        69 ~~~i~p~I~ana~Yeg~YpL~tslaRpli-a~~~ve~A~~~ga~aiaHG~-----TGkGND-QvRFe~~~~aL~P~----  137 (398)
T PRK00509         69 RDYVFPAIRANALYEGKYPLGTALARPLI-AKKLVEIARKEGADAVAHGC-----TGKGND-QVRFELAIAALAPD----  137 (398)
T ss_pred             HHHHHHHHHCCCCCCCCEEEECCCHHHHH-HHHHHHHHHHCCCEEEEECC-----CCCCCC-HHHHHHHHHHHCCC----
T ss_conf             99999999608545585455220318899-99999999971985998545-----567860-89999999985999----


Q ss_pred             EEEEEECCHHHCEEECCCCCC---CHHHHHHHHHHCCCCCC---CHHHCCCE
Q ss_conf             898630202210033425689---97898999974125435---51110230
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDM---KKESVRDLAREMGLDIA---DKSDSQDI  220 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~---~K~eVR~~A~~~gl~~a---~K~eSqgI  220 (408)
                                | +++=|..++   +-+|--+.|++.|+|+.   ++|=|.|-
T Consensus       138 ----------l-~iiaP~Rd~~~~sR~~~i~ya~~~gIpv~~~~~~~yS~D~  178 (398)
T PRK00509        138 ----------L-KVIAPWREWDLMSREELIAYAEEHGIPIPVTKKSPYSIDA  178 (398)
T ss_pred             ----------C-EEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             ----------7-6861132134168999999999869988877788730256


No 31 
>PRK04527 argininosuccinate synthase; Provisional
Probab=99.36  E-value=8.7e-12  Score=104.89  Aligned_cols=167  Identities=19%  Similarity=0.269  Sum_probs=112.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHHHH
Q ss_conf             3388999960985799999999886984999998704787665555778818999999999998099-589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~f~   97 (408)
                      .++||++|.|||.|+|++...|+++||+|++++..+...           ..++++.+++-|..+|. .++++|.+++|.
T Consensus         2 ~~kkVvLAySGGLDTSv~l~wL~e~g~~Vi~~~ad~G~~-----------~~e~~~~i~~kA~~~GA~~~~v~D~~~ef~   70 (397)
T PRK04527          2 STKDIVLAFSGGLDTSFCIPYLQERGYAVHTVFADTGGV-----------DAEERDFIEKRAAELGAASHVTVDGGPAIW   70 (397)
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCC-----------CCHHHHHHHHHHHHHCCCEEEEECCHHHHH
T ss_conf             987599990897289999999987599479999978998-----------615157899999981997799972899999


Q ss_pred             HHCCCCCHHH--HHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             3224411267--87088612000015411058888874016876452253110254126787731688531578787318
Q gi|254780151|r   98 NAVIVPFASS--YAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus        98 ~~V~~~~~~~--y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      ++-+.|++..  .-.|+.|.-..  -|-+-=..+++.|++.|++.||.|-=    -    .++.....-.+.        
T Consensus        71 ~~~v~~~i~ana~Yeg~YpL~ts--aRplIak~~ve~A~~~ga~~iaHG~T----G----kGNDQvRFe~~~--------  132 (397)
T PRK04527         71 EGFVKPFVWAGEGYQGQYPLLVS--DRYLIVDAALKRAEELGTRIIAHGCT----G----MGNDQVRFDLAV--------  132 (397)
T ss_pred             HHHHHHHHHHCHHHCCCCCCCCC--HHHHHHHHHHHHHHHCCCEEEECCCC----C----CCCCHHHHHHHH--------
T ss_conf             99999998606454185556321--07999999999999729838404766----6----787025677688--------


Q ss_pred             EEEEECCHHHCEEECCCCCC------CHHHHHHHHHHCCCCCC--CHHHCCC
Q ss_conf             98630202210033425689------97898999974125435--5111023
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDM------KKESVRDLAREMGLDIA--DKSDSQD  219 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~------~K~eVR~~A~~~gl~~a--~K~eSqg  219 (408)
                        ..++  .+ +++=|..++      +..+-.+.|++.|||+.  +|+=|+|
T Consensus       133 --~al~--~~-~viAP~R~~~~~~~~~R~~~~~ya~~~gipv~~~~k~yS~D  179 (397)
T PRK04527        133 --KALG--DY-QIVAPIREIQKEHTQTRAYEQKYLEERGFGVRAKQKAYTIN  179 (397)
T ss_pred             --HHCC--CC-CCCCCHHHHHHCCHHHHHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             --8636--76-54365565310222029999976786499988777876675


No 32 
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=99.36  E-value=2.7e-11  Score=101.40  Aligned_cols=173  Identities=27%  Similarity=0.363  Sum_probs=120.1

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC-EEECCHHHH
Q ss_conf             633889999609857999999998869-849999987047876655557788189999999999980995-898170788
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS-HYVFDYEER   95 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~-~~~~d~~~~   95 (408)
                      ++.+||++|.|||+|.||+...|+++| ++|+++++....            .++|++-+++-|..+|.. ++++|++++
T Consensus         2 ~~~kkvvLAYSGGLDTSv~i~wL~e~~~~eVit~tadvGQ------------~eed~~~i~eKA~~~Ga~~~~viD~ree   69 (403)
T COG0137           2 MKVKKVVLAYSGGLDTSVAIKWLKEKGGAEVIAVTADVGQ------------PEEDLDAIREKALELGAEEAYVIDAREE   69 (403)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHCCCEEEEEEEECCC------------CHHHHHHHHHHHHHHCCCEEEEEECHHH
T ss_conf             8776799995488239999999997659469999975899------------7577579999999818852899643899


Q ss_pred             HHHHCCCCCHHHH--HCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEE-EECCCCCCC
Q ss_conf             6632244112678--7088612000015411058888874016876452253110254126787731688-531578787
Q gi|254780151|r   96 FRNAVIVPFASSY--AAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM-CRPMDLERD  172 (408)
Q Consensus        96 f~~~V~~~~~~~y--~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L-~r~~D~~KD  172 (408)
                      |.++-+-|.+.+-  -.|.-|+--.+--+.| =..+.+.|++.|++.||.|-     +-.|.| .-|+-+ .++.++.  
T Consensus        70 Fv~~yi~~~i~ana~Yeg~YpL~TalaRPLI-ak~lVe~A~k~Ga~avaHGc-----TGKGND-QvRFE~~~~al~pd--  140 (403)
T COG0137          70 FVEDYIFPAIKANALYEGVYPLGTALARPLI-AKKLVEAAKKEGADAVAHGC-----TGKGND-QVRFELAILALNPD--  140 (403)
T ss_pred             HHHHHHHHHHHHHCEEECCCCCCCHHHHHHH-HHHHHHHHHHCCCCEEEECC-----CCCCCC-EEEEEEEHHHHCCC--
T ss_conf             9999999999730512156414543467799-99999999971996997467-----888875-35432004541899--


Q ss_pred             CEEEEEEECCHHHCEEECCCCC--CCHHHHHHHHHHCCCCCC---CHHHCCCEEECC
Q ss_conf             3189863020221003342568--997898999974125435---511102301112
Q gi|254780151|r  173 QSYFLFATTQQQLCDLRFPLGD--MKKESVRDLAREMGLDIA---DKSDSQDICFVQ  224 (408)
Q Consensus       173 QSYfL~~l~~~~L~~~~FPlg~--~~K~eVR~~A~~~gl~~a---~K~eSqgICFi~  224 (408)
                                  | +++=|..+  |+.++--+.|++.|||+.   +||=|.|-=..+
T Consensus       141 ------------l-kiiAP~Rew~~~R~~~i~Ya~~~gipv~~~~~kpySiD~Nlwg  184 (403)
T COG0137         141 ------------L-KIIAPWREWNLTREEEIEYAEEHGIPVKATKEKPYSIDENLWG  184 (403)
T ss_pred             ------------C-EEEEEHHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCHHHHC
T ss_conf             ------------6-7985633413376999999998499766567888644433323


No 33 
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase; InterPro: IPR012795   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    The only examples in which the wobble position of a tRNA must discriminate between G and A of mRNA are AUA (Ile) vs. AUG (Met) and UGA (stop) vs. UGG (Trp). In all bacteria, the wobble position of the tRNA(Ile) recognizing AUA is lysidine, a lysine derivative of cytidine. This domain is found, apparently, in all bacteria in a single copy. Eukaryotic sequences appear to be organellar. The domain architecture of this protein is variable; some, including characterised proteins of Escherichia coli and Bacillus subtilis known to be tRNA(Ile)-lysidine synthetase, include a conserved 50-residue domain that many other members lack. This protein belongs to the ATP-binding PP-loop family. It appears in the literature and protein databases as TilS, YacA, and putative cell cycle protein MesJ (a misnomer).; GO: 0000166 nucleotide binding, 0005524 ATP binding, 0016879 ligase activity forming carbon-nitrogen bonds, 0008033 tRNA processing, 0005737 cytoplasm.
Probab=99.31  E-value=1.8e-11  Score=102.70  Aligned_cols=167  Identities=20%  Similarity=0.275  Sum_probs=112.7

Q ss_pred             EEEEEECCCHHHHHHHHHHHH----CCCE-------EEEEEEECCCCCCCCCCCCCCCCHH-HHHHHHHHHHHCCCCEEE
Q ss_conf             899996098579999999988----6984-------9999987047876655557788189-999999999980995898
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKR----DGYD-------VIGVTLQLYNSRKASKRKGSCCAGQ-DVYDARRVCDTINVSHYV   89 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~----~G~~-------V~g~~m~~~~~~~~~~~~~~c~~~~-d~~~a~~va~~LgI~~~~   89 (408)
                      ||+||+|||+||.+-+++|.+    -+..       +.++|+ ++...       . .+.+ |.+.++..|++++||+++
T Consensus         1 ~~lvAvSGG~DS~aLL~~L~~~~~~~~~~~~~~~~~~~a~h~-nH~lR-------~-~s~~~~~~~v~~~c~~~~~~~~~   71 (204)
T TIGR02432         1 KILVAVSGGVDSMALLHLLLKLQPKLKISWQIKDFKLIAAHV-NHGLR-------P-ESAQEEAEFVQQFCEKLNIPLEI   71 (204)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEEE-ECCCC-------H-HHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             978886286427999999999766327877887506899996-17788-------4-15899999999999961895699


Q ss_pred             CC-HHHH-HHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCC-CCEECCCCCCC--EEEECCCCCCCEEEEE
Q ss_conf             17-0788-663224411267870886120000154110588888740168-76452253110--2541267877316885
Q gi|254780151|r   90 FD-YEER-FRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG-ADVLATGHYIR--SRLYVGDDGKRRRIMC  164 (408)
Q Consensus        90 ~d-~~~~-f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g-~~~iATGHYar--~~~~~~~~~~~~~~L~  164 (408)
                      .. ..-. ........ +++-+            |...+..|-+.+++.| +++|+|||.+-  +++.       --.|.
T Consensus        72 ~~~~~~~~~~~~~~~~-~E~~A------------R~~RY~~f~~~~~~~~~~~~i~tAHh~dDq~ET~-------L~rL~  131 (204)
T TIGR02432        72 KKLVDVKALAKGKKKN-LEEAA------------REARYAFFEEIAKKHGKADYILTAHHADDQAETI-------LMRLL  131 (204)
T ss_pred             EEEECCCCCCCCCCCC-HHHHH------------HHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHH-------HHHHH
T ss_conf             8421241101224767-78999------------9999999999999729940899724832279999-------99875


Q ss_pred             ECCCCCCCCEEEEEEECCHH---------HCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEE
Q ss_conf             31578787318986302022---------10033425689978989999741254355111023011
Q gi|254780151|r  165 RPMDLERDQSYFLFATTQQQ---------LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICF  222 (408)
Q Consensus       165 r~~D~~KDQSYfL~~l~~~~---------L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICF  222 (408)
                      ||....=     |+++++-.         -..++=||=.++|.|+.+.+++.+|+--+=+--++..|
T Consensus       132 RG~~~~G-----l~g~~~~~~~~~~g~~~~~~~~RPLL~~~k~ei~~y~~~~~l~~~eD~tN~~~~y  193 (204)
T TIGR02432       132 RGSGLRG-----LSGMPEIRPLGSLGWYKGGQIIRPLLNISKSEIEEYLKENGLPYFEDETNQDDKY  193 (204)
T ss_pred             HCCCCCH-----HHHHCCCCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCEEECCCCCCCCC
T ss_conf             1687000-----1110133663324422563277077567789999999966896565788898762


No 34 
>PRK13981 NAD synthetase; Provisional
Probab=99.30  E-value=5e-12  Score=106.62  Aligned_cols=167  Identities=23%  Similarity=0.248  Sum_probs=109.7

Q ss_pred             CCCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             46555444346788863388999960985799999999886-98-49999987047876655557788189999999999
Q gi|254780151|r    3 VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC   80 (408)
Q Consensus         3 ~~~~~~~~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va   80 (408)
                      +|.|+.+..-+.-++..-++|++|+|||+||+++|++..++ |- +|+|++|-           +.-+++...+||+.+|
T Consensus       264 i~~alvlglrDy~~k~gf~~vviGLSGGiDSaL~aaiA~dALG~~nV~~v~MP-----------s~~tS~~s~~dA~~La  332 (543)
T PRK13981        264 DYRALVLGLRDYVRKNGFPGVVLGLSGGIDSALVAAIAVDALGAENVRAVMMP-----------SRYTSDESLDDAAALA  332 (543)
T ss_pred             HHHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCHHHEEEEECC-----------CCCCCHHHHHHHHHHH
T ss_conf             99999999999998608974999767883599999999985383437886458-----------7778665699999999


Q ss_pred             HHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECC---CCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCC
Q ss_conf             9809958981707886632244112678708861200001---5411058888874016876452253110254126787
Q gi|254780151|r   81 DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC---NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDG  157 (408)
Q Consensus        81 ~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~C---N~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~  157 (408)
                      +.|||.++.+++.+.+..  +...+.....|..  ||+.=   -.++.=-.|+..|.+.|.=.+.||-=  .+       
T Consensus       333 ~~LGi~~~~i~I~~~~~~--~~~~l~~~f~~~~--~dvt~ENiQAR~R~~iLm~laN~~g~lvl~Tgnk--SE-------  399 (543)
T PRK13981        333 RNLGVRYDIIPIEPAFEA--FEAALAPLFAGTE--PDITEENLQSRIRGTLLMALSNKFGSLVLTTGNK--SE-------  399 (543)
T ss_pred             HHHCCCEEEEEHHHHHHH--HHHHHHHHHCCCC--CCCCHHHHHHHHHHHHHHHHHHCCCCEEECCCCH--HH-------
T ss_conf             995997487514999999--9997404416876--6652234548889999999873389679647867--27-------


Q ss_pred             CCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             7316885315787873189863020221003342568997898999974125
Q gi|254780151|r  158 KRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       158 ~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl  209 (408)
                           +..|-          +++-.+. .-.+=|++++.|.+|+.+|+-.+-
T Consensus       400 -----~avGy----------~TlyGD~-~g~~avi~dv~KT~V~~L~r~~n~  435 (543)
T PRK13981        400 -----MAVGY----------ATLYGDM-AGGFAPIKDVYKTLVYRLCRWRNT  435 (543)
T ss_pred             -----HHHCH----------HHHCCCC-CCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             -----87474----------6533765-567430368659999999999865


No 35 
>pfam00764 Arginosuc_synth Arginosuccinate synthase. This family contains a PP-loop motif.
Probab=99.29  E-value=2.7e-11  Score=101.41  Aligned_cols=160  Identities=30%  Similarity=0.445  Sum_probs=112.9

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHHHCCC
Q ss_conf             9996098579999999988698499999870478766555577881899999999999809-958981707886632244
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-VSHYVFDYEERFRNAVIV  102 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-I~~~~~d~~~~f~~~V~~  102 (408)
                      ++|.|||.|+||++..|+++|+||++++..+.          .  ..+|++.+++-|.++| ..++++|++++|.++.+-
T Consensus         1 VLAySGGLDTSv~l~wL~e~~~eVia~~~d~G----------q--~~ed~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~   68 (389)
T pfam00764         1 VLAYSGGLDTSVCIPWLKEKYYEVIAVAVDVG----------Q--GEEDLDEAREKALKLGAVKHYVIDAKEEFVEDYIF   68 (389)
T ss_pred             CEEECCCCHHHHHHHHHHHCCCEEEEEEEECC----------C--CHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH
T ss_conf             96036762899999999970992899999799----------9--77878999999998299789997379999999899


Q ss_pred             CCHHHH--HCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEE---EECCCCCCCCEEEE
Q ss_conf             112678--7088612000015411058888874016876452253110254126787731688---53157878731898
Q gi|254780151|r  103 PFASSY--AAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM---CRPMDLERDQSYFL  177 (408)
Q Consensus       103 ~~~~~y--~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L---~r~~D~~KDQSYfL  177 (408)
                      |++.+-  -.|+-|+-+..--+.| =..+.+.|++.||++||.|.=-        .++....+   .++.++.       
T Consensus        69 p~i~ana~Yeg~Y~L~tslaRpli-a~~~v~~A~~~ga~aiaHG~TG--------kGNDQvRFe~~~~aL~P~-------  132 (389)
T pfam00764        69 PAIKANALYEGRYPLGTALARPLI-AKKLVEAAKKEGADAVAHGCTG--------KGNDQVRFELSIRSLAPD-------  132 (389)
T ss_pred             HHHHCCCCCCCCEEECCCCHHHHH-HHHHHHHHHHCCCEEEEECCCC--------CCCCHHHHHHHHHHHCCC-------
T ss_conf             999668674464785243216699-9999999876397699436667--------997453547889974999-------


Q ss_pred             EEECCHHHCEEECCCCC--CCHHHHHHHHHHCCCCCC-C--HHHCCC
Q ss_conf             63020221003342568--997898999974125435-5--111023
Q gi|254780151|r  178 FATTQQQLCDLRFPLGD--MKKESVRDLAREMGLDIA-D--KSDSQD  219 (408)
Q Consensus       178 ~~l~~~~L~~~~FPlg~--~~K~eVR~~A~~~gl~~a-~--K~eSqg  219 (408)
                             | +++=|..+  ++-++--+.|++.|+|+. .  +|=|.|
T Consensus       133 -------l-~iiaP~R~~~~sR~~~i~ya~~~gI~v~~~~~~pyS~D  171 (389)
T pfam00764       133 -------L-KVIAPVRDLNLTREEEIEYAKEKGIPIPVTKKKPYSID  171 (389)
T ss_pred             -------C-EEECCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             -------7-58545245320579999999985998875688873335


No 36 
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only]
Probab=99.29  E-value=9.3e-12  Score=104.67  Aligned_cols=151  Identities=22%  Similarity=0.341  Sum_probs=102.1

Q ss_pred             CCCCCC-CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             678886-3388999960985799999999886984999998704787665555778818999999999998099589817
Q gi|254780151|r   13 DLDKNP-KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        13 ~~~~~~-k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      +|.+.. .++||+||+|||||||.+|.+|+..|++|.-.++.+-+              +--..+...|..||+.+..+.
T Consensus        52 ef~r~~id~~kiaVA~SGG~DSsas~iilR~~g~~v~p~t~~Lp~--------------~ir~n~~~l~~~lg~~p~yve  117 (255)
T COG1365          52 EFERIKIDKPKIAVAYSGGVDSSASAIILRWAGFTVDPGTAILPD--------------HIRRNKEELETLLGEVPEYVE  117 (255)
T ss_pred             HCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHCEEECCCCCCCCH--------------HHHHHHHHHHHHHCCCHHHHH
T ss_conf             103578888438998427864278899988621041463213877--------------886789999899725777899


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             07886632244112678708861200001541105888887401687645225311025412678773168853157878
Q gi|254780151|r   92 YEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        92 ~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                      ..   ...|.+..+    +|+- .||-+||..| -.+.+++|++++++.+|||----+    |.     .-+-+ .    
T Consensus       118 ed---l~~i~kGal----nGRf-hpCGRCh~~I-~~~V~~k~re~di~~vafGDlLs~----G~-----~svy~-e----  174 (255)
T COG1365         118 ED---LEDIEKGAL----NGRF-HPCGRCHSMI-ENAVMDKARELDIDVVAFGDLLST----GY-----GSVYR-E----  174 (255)
T ss_pred             HH---HHHHHHHHC----CCCC-CCCCHHHHHH-HHHHHHHHHHCCCEEEEECCCCCC----CC-----CCEEC-C----
T ss_conf             89---999986320----5877-8752378999-999999998538708997463234----66-----32120-5----


Q ss_pred             CCEEEEEEECCHHHCEEECCCC-CCCHHHHHHHHHHCCCCC
Q ss_conf             7318986302022100334256-899789899997412543
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLG-DMKKESVRDLAREMGLDI  211 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg-~~~K~eVR~~A~~~gl~~  211 (408)
                      |           -+=++-.|-- .+||.|+|.+++..|.+.
T Consensus       175 D-----------~i~rlnlPAflAltK~Elr~il~~~~~e~  204 (255)
T COG1365         175 D-----------GIFRLNLPAFLALTKDELRSILKWNGYEL  204 (255)
T ss_pred             C-----------CEEEECCHHHHHHCCHHHHHHHHHCCCCC
T ss_conf             8-----------87997258888517199999987138430


No 37 
>KOG1622 consensus
Probab=99.29  E-value=2.3e-11  Score=101.86  Aligned_cols=167  Identities=25%  Similarity=0.311  Sum_probs=98.8

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             3388999960985799999999886-9-8499999870478766555577881899999999999809958981707886
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .+.+|+++.||||||+|+++||.++ | ..+++++..|.           |...+.-+.+++--..|||++.++|.+++|
T Consensus       229 G~~~Vl~~vSGgvdStV~a~Ll~~alg~~R~~ai~vdNG-----------~mrk~Ea~~V~~tl~~lgi~i~v~~as~~f  297 (552)
T KOG1622         229 GDYKVLVAVSGGVDSTVCAALLRRALGPDRVHAIHVDNG-----------FMRKKEAEQVEKTLVYLGIPITVVDASETF  297 (552)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEECCC-----------CHHHHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             644559983488508999999998637894489981264-----------010367788999999738844996215888


Q ss_pred             HH---HCCCCCHHHHHCCCCCCCEECCCCEEE-HHHHHHHH-CCCCC--CEECCCC-CCCEEEECCCCCCCEEEEEECCC
Q ss_conf             63---224411267870886120000154110-58888874-01687--6452253-11025412678773168853157
Q gi|254780151|r   97 RN---AVIVPFASSYAAGETPLPCVDCNRTVK-FSDLLSVT-RQLGA--DVLATGH-YIRSRLYVGDDGKRRRIMCRPMD  168 (408)
Q Consensus        97 ~~---~V~~~~~~~y~~G~TPNPc~~CN~~iK-F~~l~~~a-~~~g~--~~iATGH-Yar~~~~~~~~~~~~~~L~r~~D  168 (408)
                      ..   .|.+|=-.   +      -+.=|.+|| |+...... .+.+-  .++|.|. |..+..+....+.+.      .+
T Consensus       298 ~s~L~~~~dPE~K---R------kiIG~tfikv~~~~~~~l~~k~~~~~~flaQgtL~Pd~ieS~s~~g~~~------a~  362 (552)
T KOG1622         298 LSKLKGVTDPEEK---R------KIIGRTFIKVFDPVASELNKKHGEKESFLAQGTLRPDLIESASVYGSGH------AE  362 (552)
T ss_pred             HHHHCCCCCHHHH---C------EECCCCEEEECCHHHHHHHHCCCCCCEEEECCCCCCHHHHHCCCCCCCH------HH
T ss_conf             8761266887881---6------1024200240767888752065760004433501410443134567734------54


Q ss_pred             CCCCCEEEEEEECCH--HHCEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             878731898630202--21003342568997898999974125435
Q gi|254780151|r  169 LERDQSYFLFATTQQ--QLCDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       169 ~~KDQSYfL~~l~~~--~L~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .-|-|--.= .|..+  .|.+++|||-++.|+|||.+.+.+|+|..
T Consensus       363 tIKThhn~~-~L~r~lrklgK~ieplk~~~kDEvr~lgk~lGlp~~  407 (552)
T KOG1622         363 TIKTHHNDT-GLIRDLRKLGKVIEPLKDFHKDEVRELGKDLGLPES  407 (552)
T ss_pred             HHHCCCCCC-HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHCCCCHH
T ss_conf             420102550-589999983165742678888999876665087243


No 38 
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional
Probab=99.25  E-value=3.9e-11  Score=100.20  Aligned_cols=168  Identities=19%  Similarity=0.207  Sum_probs=109.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHH---HC--CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             33889999609857999999998---86--98499999870478766555577881899999999999809958981707
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLK---RD--GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~---~~--G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      .+.||+||.|||+||++-+.+|.   ++  |+.+.++|+. +  +-..      -+.++..-+++.|+.+|||+++....
T Consensus        12 ~~~~ilvavSGG~DS~~LL~~L~~l~~~~~~~~l~~~Hvn-H--gl~~------~ad~~~~fv~~~c~~~~ip~~~~~~~   82 (433)
T PRK10660         12 ESRQILVAFSGGLDSTVLLHQLVQWRTQNPGVTLRAIHIH-H--GLSP------NADSWVKHCEQVCQQWQVPLVVERVQ   82 (433)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHHCCCCCEEEEEEE-C--CCCC------CHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             9998999972809999999999999986689828999971-8--9792------66999999999999759978999987


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             88663224411267870886120000154110588888740168764522531102541267877316885315787873
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      -+  .  -...+++-+            |...+.+|.+.+.+  .++|||||.+.=..    + +--..|+||.-+.=  
T Consensus        83 v~--~--~~~~~E~aA------------R~~RY~~f~~~~~~--~~~l~tAHh~dDQa----E-TvLlrL~RGsG~~G--  137 (433)
T PRK10660         83 LA--Q--EGLGIEAAA------------RQARYQAFARTLLP--GEVLVTAQHLDDQC----E-TFLLALKRGSGPAG--  137 (433)
T ss_pred             EC--C--CCCCHHHHH------------HHHHHHHHHHHHHH--CCEEEECCCCCHHH----H-HHHHHHHCCCCCCC--
T ss_conf             27--9--997699999------------99999999998743--88799624565199----9-99999865899644--


Q ss_pred             EEEEEEECCHH-H--CEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC
Q ss_conf             18986302022-1--00334256899789899997412543551110230111
Q gi|254780151|r  174 SYFLFATTQQQ-L--CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV  223 (408)
Q Consensus       174 SYfL~~l~~~~-L--~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi  223 (408)
                         |++++... +  .+++=||=.++|.|+...+++.||+-.+-+-.++.-|-
T Consensus       138 ---L~gm~~~r~~~~~~liRPLL~~~r~eI~~Y~~~~~l~~~eD~SN~d~~y~  187 (433)
T PRK10660        138 ---LSAMAEVSPFAGTQLLRPLLARTRGELEQWAQAHGLRWIEDESNQDDRYD  187 (433)
T ss_pred             ---CCCCCCCCCCCCCEEECCCHHHHHHHHHHHHHHCCCCCEECCCCCCCCCC
T ss_conf             ---56775224478970773744665999999999849980389999976112


No 39 
>PRK01565 thiamine biosynthesis protein ThiI; Provisional
Probab=99.24  E-value=7.1e-11  Score=98.34  Aligned_cols=167  Identities=19%  Similarity=0.236  Sum_probs=107.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC-----CCCEEECCHHH
Q ss_conf             3889999609857999999998869849999987047876655557788189999999999980-----99589817078
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI-----NVSHYVFDYEE   94 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~L-----gI~~~~~d~~~   94 (408)
                      +-|+++.||||.||.||||++.+.|..|+.+|+....          -.+++..+.++.+|+.|     ++.++++||.+
T Consensus       176 ~Gk~l~LlSGGIDSPVAa~~mmkRG~~v~~v~f~~~p----------~t~~~a~~kv~~l~~~L~~y~~~~kl~~v~f~~  245 (399)
T PRK01565        176 SGKALLLLSGGIDSPVAGYLAMKRGVEIEAVHFHSPP----------YTSERAKEKVIDLARILAKYGGRIKLHVVPFTE  245 (399)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHCCCEEEEEEEECCC----------CCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHH
T ss_conf             7857998617875399999998559879999986899----------877899999999999999728885599966399


Q ss_pred             HHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC-CCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             8663224411267870886120000154110588888740168764522531-102541267877316885315787873
Q gi|254780151|r   95 RFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY-IRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        95 ~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY-ar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      -- ..+...--+.       .-|+.|-|.+ +..--..|++.|++.|+||-= .++. ++.-+  +-..+-.+.|.    
T Consensus       246 ~~-~~i~~~~~~~-------~~~vl~RR~M-~riA~~iA~~~~~~alvTGESLGQVA-SQTl~--Nl~~i~~~~~~----  309 (399)
T PRK01565        246 IQ-EEIKKKVPES-------YLMTLMRRFM-MRIADKIAEKRGALAIVTGESLGQVA-SQTLE--SMQAINAVTNL----  309 (399)
T ss_pred             HH-HHHHHCCCCC-------EEEHHHHHHH-HHHHHHHHHHCCCCEEEECCHHHHHH-HHHHH--HHHHHHHHCCC----
T ss_conf             99-9998608800-------3859999999-99999999985997898241355676-75567--78888752177----


Q ss_pred             EEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC-CCCCHHHCCCEE--ECCCC
Q ss_conf             189863020221003342568997898999974125-435511102301--11277
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL-DIADKSDSQDIC--FVQQG  226 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl-~~a~K~eSqgIC--Fi~~~  226 (408)
                                   -++=||=.+.|+||-++|++.|- +++..| -.+.|  |.|+.
T Consensus       310 -------------pVlRPLIg~DK~EII~~Ar~IGTye~Si~p-~edcC~if~Pk~  351 (399)
T PRK01565        310 -------------PVLRPLIGMDKEEIIEIAKEIGTYDISILP-YEDCCTIFAPKN  351 (399)
T ss_pred             -------------CCCCCCCCCCHHHHHHHHHHCCCCHHHCCC-CCCEEEEECCCC
T ss_conf             -------------544665578989999999870960112178-757265457999


No 40 
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase. The Argininosuccinate synthase is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate .  In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterized by severe vomiting spells and mental retardation. AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity
Probab=99.23  E-value=7.7e-11  Score=98.09  Aligned_cols=164  Identities=28%  Similarity=0.389  Sum_probs=110.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHHHHHHC
Q ss_conf             99996098579999999988698-4999998704787665555778818999999999998099-589817078866322
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEERFRNAV  100 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~f~~~V  100 (408)
                      |++|.|||.|+||++..|+++|+ ||++++..+.-            .+++++.+++-|..+|. +++++|++++|+++-
T Consensus         1 VvLAySGGLDTSv~l~wL~e~~~~eVia~~~d~Gq------------~~e~~~~i~~kA~~~GA~~~~v~D~r~ef~~~~   68 (385)
T cd01999           1 VVLAYSGGLDTSVILKWLKEKGGYEVIAVTADVGQ------------PEEEIEAIEEKALKLGAKKHVVVDLREEFVEDY   68 (385)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECCC------------CHHHHHHHHHHHHHHCCCEEEEECHHHHHHHHH
T ss_conf             97997788179999999997459849999998999------------667778999999981997899961299999999


Q ss_pred             CCCCHHH--HHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEE-EECCCCCCCCEEEE
Q ss_conf             4411267--87088612000015411058888874016876452253110254126787731688-53157878731898
Q gi|254780151|r  101 IVPFASS--YAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM-CRPMDLERDQSYFL  177 (408)
Q Consensus       101 ~~~~~~~--y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L-~r~~D~~KDQSYfL  177 (408)
                      +-|.+.+  .-.|.-|+-+..--+.| =..+.+.|++.||++||.|-     +-.|.+ .-|+-+ .++.++.       
T Consensus        69 i~pai~ana~Yeg~Y~L~tslaRplI-ak~~ve~A~~~ga~aiaHG~-----TGkGND-QvRFe~~~~aL~P~-------  134 (385)
T cd01999          69 IFPAIQANALYEGTYPLGTALARPLI-AKALVEVAKEEGADAVAHGC-----TGKGND-QVRFELAFYALNPD-------  134 (385)
T ss_pred             HHHHHHHCCCCCCCEECCCCHHHHHH-HHHHHHHHHHHCCEEEEECC-----CCCCCC-HHHHHHHHHHHCCC-------
T ss_conf             99999608643375321350157899-99999999980984997456-----668884-06899999985999-------


Q ss_pred             EEECCHHHCEEECCCCCC---CHHHHHHHHHHCCCCCC---CHHHCCCE
Q ss_conf             630202210033425689---97898999974125435---51110230
Q gi|254780151|r  178 FATTQQQLCDLRFPLGDM---KKESVRDLAREMGLDIA---DKSDSQDI  220 (408)
Q Consensus       178 ~~l~~~~L~~~~FPlg~~---~K~eVR~~A~~~gl~~a---~K~eSqgI  220 (408)
                             | +++=|..++   +-+|--+.|++.|+|+.   +||=|.|-
T Consensus       135 -------l-~iiAP~Rd~~~~sR~~~i~ya~~~gi~v~~~~~~pyS~D~  175 (385)
T cd01999         135 -------L-KIIAPWRDWEFLSREEEIEYAEEHGIPVPVTKKKPYSIDE  175 (385)
T ss_pred             -------C-EEEEEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             -------7-5851473144488899999999859998866788851463


No 41 
>COG0171 NadE NAD synthase [Coenzyme metabolism]
Probab=99.22  E-value=8.3e-11  Score=97.88  Aligned_cols=162  Identities=25%  Similarity=0.336  Sum_probs=109.7

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHC-C-----CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             863388999960985799999999886-9-----8499999870478766555577881899999999999809958981
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRD-G-----YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~-G-----~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~   90 (408)
                      ....+++++|+|||+||+++++|.+++ |     .++.|+.|-...          . .+.|.+||..+|+.||+.+..+
T Consensus        22 ~~~~k~~VlGiSGGiDSa~~~~La~~A~~~~~~~~~~~av~mP~~~----------~-~~~~~~da~~~~~~lg~~~~~i   90 (268)
T COG0171          22 KAGFKGVVLGLSGGIDSALVLALAVRALGKGDSKENVLAVRLPYGY----------T-VQADEEDAQDLAEALGIDYKEI   90 (268)
T ss_pred             HCCCCCEEEECCCCHHHHHHHHHHHHHHCCCCCHHHEEEEECCCCC----------C-CCCCHHHHHHHHHHHCCCEEEE
T ss_conf             7399986997666819999999999985656512432668678877----------6-5347999999999829966997


Q ss_pred             CHHHHHH---HHCCCCCH----HHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEE
Q ss_conf             7078866---32244112----6787088612000015411058888874016876452253110254126787731688
Q gi|254780151|r   91 DYEERFR---NAVIVPFA----SSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM  163 (408)
Q Consensus        91 d~~~~f~---~~V~~~~~----~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L  163 (408)
                      |+.+.+.   ..+...+.    +.+..|.   =.    .++..-.|+.+|.++|.=-+-|||.+-.  ..|      + .
T Consensus        91 ~I~~~v~~~~~~~~~~~~~~~~~~~~~~N---ik----aR~Rm~~lY~~An~~~~lVlGTgn~sE~--~~G------y-~  154 (268)
T COG0171          91 NIKPAVDAFLKKLLKLFLGIYLEDLALGN---IK----ARLRMVILYAIANKLGGLVLGTGNKSEL--ALG------Y-F  154 (268)
T ss_pred             ECHHHHHHHHHHHHHHHCCCCHHHHHHHH---HH----HHHHHHHHHHHHHHCCCEEECCCCHHHH--HCC------C-E
T ss_conf             52888999887666652344211277764---50----9999999999985559789758848778--607------4-4


Q ss_pred             EECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             53157878731898630202210033425689978989999741254--35511102301
Q gi|254780151|r  164 CRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       164 ~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      .+--|-                ..-+-|++++.|.+|+++|+.+|+|  +.+|+=|-++=
T Consensus       155 TkyGDg----------------~~d~~Pi~~L~KtqV~~La~~l~ipe~I~~k~PTAeL~  198 (268)
T COG0171         155 TKYGDG----------------AVDINPIADLYKTQVYALARHLGIPEEILKKPPTADLW  198 (268)
T ss_pred             ECCCCC----------------CCCHHHHCCCCHHHHHHHHHHCCCCHHHHCCCCCCCCC
T ss_conf             320676----------------44705414875899999998739999996399991124


No 42 
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only]
Probab=99.21  E-value=9.3e-11  Score=97.52  Aligned_cols=171  Identities=23%  Similarity=0.337  Sum_probs=101.8

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH-H
Q ss_conf             338899996098579999999988698499999870478766555577881899999999999809958981707886-6
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF-R   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f-~   97 (408)
                      +.||.+|.+|||.||+++|+.+++.|++|+++++.-.          . -....++-|+++|++||||++++|+.-.= +
T Consensus         1 ~~~kavvl~SGG~DStt~l~~a~~~~~ev~alsfdYG----------Q-rh~~Ele~A~~iak~lgv~~~iid~~~~~~~   69 (222)
T COG0603           1 MMKKAVVLLSGGLDSTTCLAWAKKEGYEVHALTFDYG----------Q-RHRKELEAAKELAKKLGVPHHIIDVDLLGEI   69 (222)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEECC----------C-CCHHHHHHHHHHHHHCCCCEEEECHHHHHHC
T ss_conf             9834999916881389999999960988999975078----------9-8689999999999981998289541687535


Q ss_pred             --HHCCCCC--HHHHH--CCCCCCCEECCCCEEEH-HHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCC
Q ss_conf             --3224411--26787--08861200001541105-88888740168764522531102541267877316885315787
Q gi|254780151|r   98 --NAVIVPF--ASSYA--AGETPLPCVDCNRTVKF-SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLE  170 (408)
Q Consensus        98 --~~V~~~~--~~~y~--~G~TPNPc~~CN~~iKF-~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~  170 (408)
                        .--++.-  +..+.  ....||-=+- +|..-| ..-.-+|..+|++.|++|--+  ....+-+ ..+.-...+.   
T Consensus        70 ~~saLtd~~~~vp~~~~~~~~~p~t~VP-~RN~iflsiA~~~Ae~~g~~~I~~Gv~~--~D~sgYP-Dcrpefi~a~---  142 (222)
T COG0603          70 GGSALTDDSIDVPKYEFAEEEIPATFVP-ARNLIFLSIAAAYAEALGADAIIIGVNE--EDFSGYP-DCRPEFIEAL---  142 (222)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEC-CCCHHHHHHHHHHHHHCCCCEEEEEECC--CCCCCCC-CCCHHHHHHH---
T ss_conf             8886758886366666666668644760-6609999999999987599859997532--1047899-8888999999---


Q ss_pred             CCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             8731898630202210033425689978989999741254
Q gi|254780151|r  171 RDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       171 KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                       .+..-|..-..-..  +.-||..++|.|+-++|.++|.+
T Consensus       143 -~~~~~l~~~~~~~~--i~aPl~~l~Ka~iv~l~~elg~~  179 (222)
T COG0603         143 -NEALNLGTEKGVRI--IHAPLMELTKAEIVKLADELGVP  179 (222)
T ss_pred             -HHHHHHHCCCCCCE--EECCEEECCHHHHHHHHHHHCCC
T ss_conf             -99998625578617--76783313499999988886885


No 43 
>PRK00768 nadE NAD synthetase; Reviewed
Probab=99.19  E-value=1.2e-10  Score=96.67  Aligned_cols=160  Identities=20%  Similarity=0.216  Sum_probs=99.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC--------C---CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             3388999960985799999999886--------9---8499999870478766555577881899999999999809958
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD--------G---YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~--------G---~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      +-..++||+|||+||||+|+|.+.+        +   +.++++.|-.             .+..|..||+..++.+++.+
T Consensus        39 g~~g~VlGLSGGIDSAvta~L~~~Av~al~~~~~~~~~~~iav~mP~-------------~~~~~~~da~~~~~~i~~~~  105 (274)
T PRK00768         39 GLKTLVLGISGGQDSTLAGRLAQLAVEELRAETGDASYQFIAVRLPY-------------GVQADEDDAQDALAFIQPDE  105 (274)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEECCC-------------CCCCCHHHHHHHHHHCCCCE
T ss_conf             99839981885768899999999999986530476642268976898-------------86579999999985227660


Q ss_pred             -EECCHHHHHHHHCCCCCHHHHHCCCCCCCEEC---CCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEE
Q ss_conf             -98170788663224411267870886120000---15411058888874016876452253110254126787731688
Q gi|254780151|r   88 -YVFDYEERFRNAVIVPFASSYAAGETPLPCVD---CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM  163 (408)
Q Consensus        88 -~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~---CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L  163 (408)
                       ..+|+...     ++.|...+...-.+..+..   --.++..-.|+..|...|.=-+.||.-.  +...|      + .
T Consensus       106 ~~~i~I~~~-----~d~~~~~l~~~~~~~~d~~~~NiqaRiRM~~LY~~An~~g~LVlGTgNks--E~~vG------Y-f  171 (274)
T PRK00768        106 VLTVNIKPA-----VDASVAALRAAGIELSDFVKGNIKARERMIAQYAIAGARGGLVVGTDHAA--EAITG------F-F  171 (274)
T ss_pred             EEEECCCHH-----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEEECCCCHH--HHHCC------C-E
T ss_conf             488617099-----99999999872775116788885798999999999827899886488640--44408------5-0


Q ss_pred             EECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             53157878731898630202210033425689978989999741254--35511102301
Q gi|254780151|r  164 CRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       164 ~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      .+--|.                +--+.|||++.|.||+++|+.+|+|  +-+|+=|-|+-
T Consensus       172 TkYGDg----------------~~Di~PI~dL~KteV~~lA~~LgvP~~Ii~k~PSA~Lw  215 (274)
T PRK00768        172 TKFGDG----------------GADLLPLFGLNKRQGRALLAALGAPEHLYEKVPTADLE  215 (274)
T ss_pred             EEECCC----------------CCCHHHHCCCCHHHHHHHHHHHCCCHHHHCCCCCCCCC
T ss_conf             102677----------------51737632561999999999959799983689899754


No 44 
>TIGR00364 TIGR00364 exsB protein; InterPro: IPR004479   This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome.    In Sinorhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA , .    In Arthrobacter viscosus, the homologous gene is designated alu1 and is associated with an aluminum tolerance phenotype. When expressed in Escherichia coli, it conferred aliminium tolerance .   The entry also contains the gene queC, which is responsible for the conversion of GTP to 7-cyano-7-deazaguanine (preQ0). The biosynthesis of hypermodified tRNA nucleoside queuosine only occurs in eubacteria. It occupies the wobble position for all known tRNAs that are specific for Asp, Asn, His or Tyr ..
Probab=99.18  E-value=3.8e-11  Score=100.33  Aligned_cols=164  Identities=25%  Similarity=0.372  Sum_probs=103.6

Q ss_pred             EEEECCCHHHHHHHHHHHHCC--CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE-ECCHHHHHHHHC
Q ss_conf             999609857999999998869--84999998704787665555778818999999999998099589-817078866322
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDG--YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHY-VFDYEERFRNAV  100 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G--~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~-~~d~~~~f~~~V  100 (408)
                      +|.||||.||+++++++++.|  |+|++||+. +         |.=.+..+++-|++||++||||++ ++|+.=-=|  .
T Consensus         2 v~~lSGG~DStT~~~~a~~~~GkyeV~a~TF~-Y---------GQR~H~~Ele~A~~ia~~Lgi~~~~~~Dl~~l~~--l   69 (227)
T TIGR00364         2 VVVLSGGQDSTTVLLIALDEGGKYEVHAITFD-Y---------GQRAHSRELESARKIAEALGIRHHFVIDLSLLKQ--L   69 (227)
T ss_pred             EEEEECCHHHHHHHHHHHHCCCCEEEEEECCC-C---------HHHHHHHHHHHHHHHHHHHCCCCEEEECHHHHHH--H
T ss_conf             68743734689999999961795079985465-0---------1378999999999999980897078617799985--5


Q ss_pred             CC--CCHHHHH--CCCCCCCE-ECC----------CCEEEHHHH-HHHHCCCCCCEECCCCCCCEEEEC--CCCCCCEEE
Q ss_conf             44--1126787--08861200-001----------541105888-887401687645225311025412--678773168
Q gi|254780151|r  101 IV--PFASSYA--AGETPLPC-VDC----------NRTVKFSDL-LSVTRQLGADVLATGHYIRSRLYV--GDDGKRRRI  162 (408)
Q Consensus       101 ~~--~~~~~y~--~G~TPNPc-~~C----------N~~iKF~~l-~~~a~~~g~~~iATGHYar~~~~~--~~~~~~~~~  162 (408)
                      ..  -..++-.  ....+.+| ..|          ||.+=|=.+ .-+|.++||..|.||=    ...+  +-+. .+.-
T Consensus        70 ~~YsaLt~~~~~~~~~~~e~d~~~~~E~~p~tfVPgRN~~fl~~a~~yA~~~gA~~v~~G~----~~~DfSgYPD-Cr~E  144 (227)
T TIGR00364        70 GKYSALTDEQEIPEQKSNEEDKEKALETLPNTFVPGRNLIFLSLAASYAEALGAEAVITGV----CETDFSGYPD-CRDE  144 (227)
T ss_pred             HCCCCCCCCCCCCCCCCCCCCHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHCHHHHHHCC----CCCCCCCCCC-CCHH
T ss_conf             4045235787567666653202356531133337804799999999988861842522001----0003657988-8688


Q ss_pred             EEECCCCCCCCEEEEE-EECCHHHC--EEECCCCCCCHHHHHHHHHHCC
Q ss_conf             8531578787318986-30202210--0334256899789899997412
Q gi|254780151|r  163 MCRPMDLERDQSYFLF-ATTQQQLC--DLRFPLGDMKKESVRDLAREMG  208 (408)
Q Consensus       163 L~r~~D~~KDQSYfL~-~l~~~~L~--~~~FPlg~~~K~eVR~~A~~~g  208 (408)
                      -+++.    ++.--|+ +..+=..+  .+.=||=.|||.|+-++|.++|
T Consensus       145 Fvka~----n~~l~Lgn~~~~v~i~Piql~aPL~~ltKaeiv~la~elG  189 (227)
T TIGR00364       145 FVKAL----NHALNLGNMLTPVEIRPIQLEAPLMDLTKAEIVKLADELG  189 (227)
T ss_pred             HHHHH----HHHHHHHCCCCCCEEEEEEEECCEEECCHHHHHHHHHHHC
T ss_conf             99999----9999974126881120246666701269899999988735


No 45 
>TIGR00032 argG argininosuccinate synthase; InterPro: IPR001518   Argininosuccinate synthase (6.3.4.5 from EC) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate , .   In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation.   AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.; GO: 0004055 argininosuccinate synthase activity, 0005524 ATP binding, 0006526 arginine biosynthetic process.
Probab=99.17  E-value=2.9e-10  Score=93.96  Aligned_cols=171  Identities=26%  Similarity=0.368  Sum_probs=114.6

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHH
Q ss_conf             8999960985799999999886-98-499999870478766555577881899999999999809-95898170788663
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-VSHYVFDYEERFRN   98 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-I~~~~~d~~~~f~~   98 (408)
                      ||++|+|||+|.||+..+|+++ |+ +|+++++...-+           -++|+..+++.|.++| ..+++||++++|-+
T Consensus         1 KVvLAySGGLDTSv~l~wL~~kyG~~~Via~~~dvGQP-----------DE~d~~~~~~kA~~~GA~~~~~iDak~eFv~   69 (420)
T TIGR00032         1 KVVLAYSGGLDTSVCLKWLEEKYGYEEVIAVTADVGQP-----------DEEDIDAIEEKALKYGAEKHYTIDAKEEFVK   69 (420)
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEEECCCC-----------CHHHHHHHHHHHHHHCCCEEEEEECHHHHHH
T ss_conf             96888607025999999988652898607999756799-----------9888888999988736710257723688999


Q ss_pred             HCCCCCHHHHH--CCC----CCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEE-EEECCCCCC
Q ss_conf             22441126787--088----61200001541105888887401687645225311025412678773168-853157878
Q gi|254780151|r   99 AVIVPFASSYA--AGE----TPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRI-MCRPMDLER  171 (408)
Q Consensus        99 ~V~~~~~~~y~--~G~----TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~-L~r~~D~~K  171 (408)
                      +.+=+.|+.=+  .|+    -||--.+-=+.| =..+.+.|++-||+.||.|=     +-.|.| .-|+. ..       
T Consensus        70 dy~f~aiqanA~Ye~~GG~~Y~L~TaLaRPlI-A~~lVe~Ak~~Ga~AvaHGC-----TGKGND-Q~RFe~~~-------  135 (420)
T TIGR00032        70 DYLFAAIQANAVYEGTGGLVYPLSTALARPLI-AKKLVEVAKKEGAEAVAHGC-----TGKGND-QVRFERSI-------  135 (420)
T ss_pred             HHHHHHHHCCCEECCCCCEECCCCCCCHHHHH-HHHHHHHHHHCCCEEEECCC-----CCCCCC-HHHHHHHH-------
T ss_conf             99888765066031787410347661145799-99999998466954987076-----877741-35765888-------


Q ss_pred             CCEEEEEEECCHHHCEEECCCCCC--C-----HHHHHHHHHHCCCCCC---CHHHCCCEEECCC
Q ss_conf             731898630202210033425689--9-----7898999974125435---5111023011127
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLGDM--K-----KESVRDLAREMGLDIA---DKSDSQDICFVQQ  225 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg~~--~-----K~eVR~~A~~~gl~~a---~K~eSqgICFi~~  225 (408)
                             ++.+..| ++|=|.-++  +     -.|.-+.|++.|+|++   +|+=|-|==..+.
T Consensus       136 -------~~~~p~L-kviaP~R~~~~~e~lgGR~e~~eYa~~~Gip~p~~~~K~YSiD~Nl~gr  191 (420)
T TIGR00032       136 -------RALNPDL-KVIAPWRDLNLTEELGGREEEIEYAAQKGIPVPMTKEKPYSIDENLWGR  191 (420)
T ss_pred             -------HHHCCCC-EEECCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHH
T ss_conf             -------7526898-5874734646776405948899999966888765467777623667755


No 46 
>TIGR00342 TIGR00342 thiamine biosynthesis/tRNA modification protein ThiI; InterPro: IPR003720 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell. ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway . Almost all the proteins in this group have an N-terminal THUMP domain (see IPR004114 from INTERPRO).; GO: 0009228 thiamin biosynthetic process.
Probab=99.07  E-value=9.5e-10  Score=90.31  Aligned_cols=166  Identities=22%  Similarity=0.319  Sum_probs=104.3

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-------CCEEECCH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809-------95898170
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-------VSHYVFDY   92 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-------I~~~~~d~   92 (408)
                      +-||++.+|||.||-|||+|+-+.|++|+.+||.+-..          .+++..+-++.+|+.+-       +.++++||
T Consensus       186 ~Gkvl~LlSGGiDSPVAaf~~m~RGc~V~~vhf~~~~~----------~~~~~~~kv~~la~~~~~~~~~~~~~l~~~~F  255 (391)
T TIGR00342       186 QGKVLALLSGGIDSPVAAFLAMKRGCRVVAVHFFNEPA----------ASEKAREKVERLANLLSLNETGGSVKLYVVDF  255 (391)
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHCCCEEEEEEECCCCC----------CCHHHHHHHHHHHHHHHHCCCEEEEEEEEECH
T ss_conf             53632041188351679999966387799997328855----------24689999999999885400037999998543


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCCCC-EECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             788663224411267870886120-0001541105888887401687645225311025412678773168853157878
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETPLP-CVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TPNP-c~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                      .+-         +.+-....-+|= ||.|-|.+ ...-=..|.+.|++.|.||-=-....++.-++  -..+-.+.+   
T Consensus       256 ~~~---------~~~~~~~~~e~~~~v~~rR~M-~~~A~~~ae~~g~~A~VTGe~LGQVASQTL~N--l~vI~~~~~---  320 (391)
T TIGR00342       256 TDV---------QEEIIEIIPEKYTMVLCRRLM-LKIASKVAEKEGCLAIVTGESLGQVASQTLEN--LRVIQAVVN---  320 (391)
T ss_pred             HHH---------HHHHHHCCCCCCEEEEHHHHH-HHHHHHHHHHCCCCEEEECCCCCCHHHHHHHH--HHHHHHCCC---
T ss_conf             899---------999984189987887406679-99999888860994899766342037778889--999972378---


Q ss_pred             CCEEEEEEECCHHHCEEEC-CCCCCCHHHHHHHHHHCCC-CCCCHHHCCCEEECCC
Q ss_conf             7318986302022100334-2568997898999974125-4355111023011127
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRF-PLGDMKKESVRDLAREMGL-DIADKSDSQDICFVQQ  225 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~F-Plg~~~K~eVR~~A~~~gl-~~a~K~eSqgICFi~~  225 (408)
                                    .-.|- ||=.|.|++|-++|++.|= +++-.+ ..+-|-+..
T Consensus       321 --------------~~iL~RPLIg~DK~~Ii~~Ak~IgTyeiSi~~-~~~Cc~~~~  361 (391)
T TIGR00342       321 --------------TPILRRPLIGMDKEEIIELAKEIGTYEISIEP-HEDCCTIFK  361 (391)
T ss_pred             --------------CCEEECCCCCCCHHHHHHHHHHCCCEEEEEEC-CCCCCCEEC
T ss_conf             --------------74240775547978999997413962144412-578863002


No 47 
>PRK11106 queuosine biosynthesis protein QueC; Provisional
Probab=99.07  E-value=8.6e-10  Score=90.59  Aligned_cols=165  Identities=21%  Similarity=0.186  Sum_probs=95.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHH--HH
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099-5898170788--66
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEER--FR   97 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~--f~   97 (408)
                      +|++|.+|||.||+++++++.++|++|+++++.- ..          -...+++-|+++|+++|+ +|.++|+.--  +.
T Consensus         2 kkavVLlSGGlDStt~L~~a~~~~~~v~alsfdY-GQ----------rh~~El~~A~~ia~~~gv~~h~vidl~~l~~~~   70 (231)
T PRK11106          2 KRAVVVFSGGQDSTTCLIQALQQYDEVHCITFDY-GQ----------RHRAEIDVARELALKLGARAHKVLDVTLLNELA   70 (231)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEEC-CC----------CCHHHHHHHHHHHHHCCCCCEEEECCHHHHHHC
T ss_conf             8089990787899999999998199499998777-86----------719999999999998598400675327777752


Q ss_pred             -HHCCC-----CCHHHHHCCCCCCCEECCCCEEEHHHH-HHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCC
Q ss_conf             -32244-----112678708861200001541105888-88740168764522531102541267877316885315787
Q gi|254780151|r   98 -NAVIV-----PFASSYAAGETPLPCVDCNRTVKFSDL-LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLE  170 (408)
Q Consensus        98 -~~V~~-----~~~~~y~~G~TPNPc~~CN~~iKF~~l-~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~  170 (408)
                       ....+     |- .++...-+||-=| =||.+-|=.+ .-+|..+|++.|++|--+-=.....|.   ++-...+.+  
T Consensus        71 ~SaLt~~~i~vp~-~~~~~~~~p~T~V-P~RN~ifLsiAaa~Ae~~ga~~I~~G~~~~D~sgYPDC---r~eFi~a~~--  143 (231)
T PRK11106         71 VSSLTRDSIPVPD-YEPEADGLPNTFV-PGRNILFLTLAAIYAYQVKAEAVITGVCETDFSGYPDC---RDEFVKALN--  143 (231)
T ss_pred             CCCCCCCCCCCCC-CCCCCCCCCCCEE-ECCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCC---CHHHHHHHH--
T ss_conf             3566777877777-6544457876467-16729999999999998599959980465566889989---899999999--


Q ss_pred             CCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCC
Q ss_conf             87318986302022100334256899789899997412
Q gi|254780151|r  171 RDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMG  208 (408)
Q Consensus       171 KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~g  208 (408)
                        ++.-|..   +.--++.-||-+++|.||-+|+++.+
T Consensus       144 --~al~~g~---~~~i~i~aPl~~l~K~eiv~l~~~~~  176 (231)
T PRK11106        144 --HAVVLGM---AKDIRFETPLMWLDKAETWALADYYG  176 (231)
T ss_pred             --HHHHHCC---CCCEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             --9998517---89819983777788889999998616


No 48 
>PTZ00323 NAD+ synthase; Provisional
Probab=99.05  E-value=3.7e-09  Score=86.08  Aligned_cols=164  Identities=21%  Similarity=0.218  Sum_probs=96.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CC------EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             3388999960985799999999886-98------4999998704787665555778818999999999998099589817
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GY------DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~------~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      .-+.+++|+|||+||+++|+|..++ |-      .++|+.|-.            +.+..++.+|+..++.+|+...+++
T Consensus        45 GfkgvVLGlSGGIDSAl~aaLA~~Alg~env~~~r~~gv~~P~------------~ss~~s~~~a~~~a~~~g~~~~~~~  112 (294)
T PTZ00323         45 GLKACVTSVSGGIDSAVVLALCSRAMRMPNSPIVRNVGICQPI------------CSSAWALARGRENIAACGATEVVVD  112 (294)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHCCCCCCCCEEEEEECCC------------CCCHHHHHHHHHHHHHCCCCEEECC
T ss_conf             9985999586369999999999998655457530356776785------------4576659879999997688523236


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCCCEECCCC----EEEHHHH-HHHHCCCC--CCEECCCCCCCEEEECCCCCCCEEEEE
Q ss_conf             0788663224411267870886120000154----1105888-88740168--764522531102541267877316885
Q gi|254780151|r   92 YEERFRNAVIVPFASSYAAGETPLPCVDCNR----TVKFSDL-LSVTRQLG--ADVLATGHYIRSRLYVGDDGKRRRIMC  164 (408)
Q Consensus        92 ~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~----~iKF~~l-~~~a~~~g--~~~iATGHYar~~~~~~~~~~~~~~L~  164 (408)
                      ....+..  +..+++... |..+..-..=|-    +++.+.+ ...+.+.|  +=-+.|||-+-. ...      .+.-+
T Consensus       113 ~~~i~~~--~~~~~~~~~-g~~~~d~~~gNlqAR~Rm~~~~~la~l~n~~g~~~LVlgTgNkSE~-~~v------GY~Tk  182 (294)
T PTZ00323        113 QTELHKQ--LSTLVETAV-GIDGGDFARGQLRSYMRTPVGYYVAQLLSQEGTPAIVMGTGNMDED-GYL------GYFCK  182 (294)
T ss_pred             CHHHHHH--HHHHHHHHC-CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCCC-HHC------EEEEE
T ss_conf             0777999--999999860-8861046788999999888999999986004887078628975542-120------04420


Q ss_pred             ECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             3157878731898630202210033425689978989999741254--35511102301
Q gi|254780151|r  165 RPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       165 r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      -| |-                .-=+-||+++.|.+|+++|+.+|+|  +-+|+=|-|+=
T Consensus       183 YG-D~----------------agd~apI~DL~Kt~V~~Lar~LgiPe~ii~K~PSAeL~  224 (294)
T PTZ00323        183 AG-DG----------------VVDVQLISDLHKSEVFLVAEELGVPENTLQAAPSADLW  224 (294)
T ss_pred             EC-CC----------------CCCCHHHCCCCHHHHHHHHHHCCCCHHHHCCCCCCCCC
T ss_conf             34-77----------------54703304683999999999809989993089897667


No 49 
>TIGR03573 WbuX N-acetyl sugar amidotransferase. This enzyme has been implicated in the formation of the acetamido moiety (sugar-NC(=NH)CH3) which is found on some exopolysaccharides and is positively charged at neutral pH. The reaction involves ligation of ammonia with a sugar N-acetyl group, displacing water. In E. coli (O145 strain) and Pseudomonas aeruginosa (O12 strain) this gene is known as wbuX and ifnA respectively and likely acts on sialic acid. In Campylobacter jejuni, the gene is known as pseA and acts on pseudaminic acid in the process of flagellin glycosylation. In other Pseudomonas strains and various organisms it is unclear what the identity of the sugar substrate is, and in fact, the phylogenetic tree of this family sports a considerably deep branching suggestive of possible major differences in substrate structure. Nevertheless, the family is characterized by a conserved tetracysteine motif (CxxC.....[GN]xCxxC) possibly indicative of a metal binding site, as well as an 
Probab=98.99  E-value=2.6e-09  Score=87.16  Aligned_cols=110  Identities=15%  Similarity=0.204  Sum_probs=86.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             8899996098579999999988-698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKR-DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~-~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      --.+|++|||+||+.+|++|++ -|..+.+||+..   +.        .++..+++..++++.||++|+.+...-.-.++
T Consensus        60 YDCiv~vSGGkDS~y~~~~l~~~~gl~pL~vt~d~---~~--------~t~~g~~Ni~~l~~~lgvD~i~~~~n~~~~k~  128 (343)
T TIGR03573        60 YDCIIGVSGGKDSTYQAHVLKKKLGLNPLLVTVDP---GW--------NTELGVKNLNNLIKKLGFDLHTITINPETFRK  128 (343)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECC---CC--------CCHHHHHHHHHHHHHCCCCEEEECCCHHHHHH
T ss_conf             86898688772899999999998299259998359---87--------79899999999998369985874699999999


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             244112678708861200001541105888887401687645225311
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      ...-++.     ..++||..|...+ |......|.+.++.+|..|+=+
T Consensus       129 l~k~~~~-----~~gd~~~~~~~~i-~~~~~~iA~k~~IplIi~Gen~  170 (343)
T TIGR03573       129 LQRAYFK-----KVGDPEWPQDHAI-FASVYQVALKFNIPLIIWGENI  170 (343)
T ss_pred             HHHHHHH-----HCCCHHHHHHHHH-HHHHHHHHHHCCCCEEEECCCC
T ss_conf             9999998-----6689469999999-9999999998199989975670


No 50 
>PRK01269 thiamine biosynthesis protein ThiI; Provisional
Probab=98.98  E-value=2.3e-09  Score=87.55  Aligned_cols=162  Identities=24%  Similarity=0.255  Sum_probs=99.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHH-HHHHHHHCC----CCEEECCHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999-999999809----9589817078
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD-ARRVCDTIN----VSHYVFDYEE   94 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~-a~~va~~Lg----I~~~~~d~~~   94 (408)
                      +-|+++.||||.||.||||++.+.|..|+.+|+.+..          ..++..+.+ |+.+++..+    +.++.+||.+
T Consensus       177 qGkvL~LlSGGiDSPVAa~~mmKRG~~v~~l~F~lg~----------~~~e~~V~~va~~L~~~~~~~~~vr~~~V~f~~  246 (483)
T PRK01269        177 QEDVLSLISGGFDSGVASYMLMRRGSRVHYCFFNLGG----------AAHEIGVKQVAHYLWNRYGSSHRVRFISVDFEP  246 (483)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCEEEEEEECCCC----------HHHHHHHHHHHHHHHHHHCCCCCEEEEEECCHH
T ss_conf             7868999527888388899998459879999957998----------688999999999999973888870899976799


Q ss_pred             HHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC-CCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             8663224411267870886120000154110588888740168764522531-102541267877316885315787873
Q gi|254780151|r   95 RFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY-IRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        95 ~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY-ar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      -.. .+.+..-+.|       -|+.|-|.+ +.+--..|++.|++.|.||-= .++.- ..-.  +              
T Consensus       247 v~~-eI~~~v~~~~-------~~vv~KR~M-~R~A~~iA~~~g~~ALVTGESLGQVAS-QTL~--N--------------  300 (483)
T PRK01269        247 VVG-EILEKVDNGQ-------MGVVLKRMM-LRAASKVAERYGIQALVTGEALGQVSS-QTLT--N--------------  300 (483)
T ss_pred             HHH-HHHHHCCHHH-------EEHHHHHHH-HHHHHHHHHHCCCCEEEECCCHHHHHH-HHHH--H--------------
T ss_conf             999-9987387634-------439999999-999999999859988985550345677-6787--8--------------


Q ss_pred             EEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC-CCCCHHHCC-CEEEC
Q ss_conf             189863020221003342568997898999974125-435511102-30111
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL-DIADKSDSQ-DICFV  223 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl-~~a~K~eSq-gICFi  223 (408)
                         |..+++-.=--++=||=.+.|+||-++|++.|- +.+   ++| +-|=+
T Consensus       301 ---L~~i~~~~~~pVlRPLIg~DK~eII~~Ar~IGTye~s---~~~pEyCgv  346 (483)
T PRK01269        301 ---LRLIDNVTDTLILRPLIAMDKEDIIDLARQIGTEDFA---KTMPEYCGV  346 (483)
T ss_pred             ---HHHHHHHCCCCEECCCCCCCHHHHHHHHHHHCHHHHH---CCCCCCEEE
T ss_conf             ---8998874077400476679889999999983928776---036865051


No 51 
>cd01995 ExsB ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown
Probab=98.97  E-value=3.5e-09  Score=86.20  Aligned_cols=139  Identities=23%  Similarity=0.350  Sum_probs=87.7

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             89999609857999999998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      |++|.+|||.||+++++.+.++|++|.++++.-. .          ....+++.|+++|++|| |..            +
T Consensus         1 kavvllSGGlDSt~~l~~~~~~g~~v~~l~~dYG-Q----------r~~~E~~~a~~i~~~l~-~~~------------~   56 (169)
T cd01995           1 KAVVLLSGGLDSTTCLAWAKKEGYEVHALSFDYG-Q----------RHAKEEEAAKLIAEKLG-PST------------Y   56 (169)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECC-C----------CHHHHHHHHHHHHHHHC-CCC------------E
T ss_conf             9899907878899999999984996999997569-8----------54999999999999968-994------------6


Q ss_pred             CCCHHHHHCCCCCCCEECCCCEEEH-HHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEE
Q ss_conf             4112678708861200001541105-888887401687645225311025412678773168853157878731898630
Q gi|254780151|r  102 VPFASSYAAGETPLPCVDCNRTVKF-SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT  180 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~CN~~iKF-~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l  180 (408)
                      -|+                 |.+-| ..-.-+|..+|++.|++|--+--.....|.   ++-...+.+..       -.+
T Consensus        57 VP~-----------------RN~ifls~A~~~A~~~g~~~v~~G~~~~d~~~ypDc---~~~F~~a~~~~-------~~~  109 (169)
T cd01995          57 VPA-----------------RNLIFLSIAAAYAEALGAEAIIIGVNAEDYSGYPDC---RPEFIEAMNKA-------LNL  109 (169)
T ss_pred             ECC-----------------CHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCCC---CHHHHHHHHHH-------HHH
T ss_conf             528-----------------389999999999998299968999824775689998---69999999999-------983


Q ss_pred             CCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             2022100334256899789899997412543
Q gi|254780151|r  181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       181 ~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      ....-=++..|+-+++|.||-+++.++|++.
T Consensus       110 ~~~~~v~i~aP~~~~~K~eiv~~g~~lgv~~  140 (169)
T cd01995         110 GTENGIKIHAPLIDLSKAEIVRLGGELGVPL  140 (169)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHHCCCCH
T ss_conf             0879858984333598999999998849979


No 52 
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism]
Probab=98.95  E-value=5.3e-09  Score=84.94  Aligned_cols=153  Identities=23%  Similarity=0.315  Sum_probs=98.5

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH-HHC-----CCCEEECCH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999-980-----995898170
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC-DTI-----NVSHYVFDY   92 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va-~~L-----gI~~~~~d~   92 (408)
                      .+.|+++.||||.||-||+|++.+.|.+|+.+|+.+-..          .+++....+...+ ..+     .+.++++||
T Consensus       174 t~Gk~l~LlSGGIDSPVA~~l~mkRG~~v~~v~f~~~p~----------~~~~a~~k~~~l~~~~~~~~~~~~~~~~v~f  243 (383)
T COG0301         174 TQGKVLLLLSGGIDSPVAAWLMMKRGVEVIPVHFGNPPY----------TSEKAREKVVALALLRLTSYGGKVRLYVVPF  243 (383)
T ss_pred             CCCCEEEEEECCCCHHHHHHHHHHCCCEEEEEEECCCCC----------CHHHHHHHHHHHHHHHHCCCCCCEEEEEECH
T ss_conf             677489997078774999999985698779999727998----------5188999999998643024687228999762


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCC--CCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCC
Q ss_conf             7886632244112678708861--20000154110588888740168764522531102541267877316885315787
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETP--LPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLE  170 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TP--NPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~  170 (408)
                      .+-..+          .....|  .-|+.|-|.+ +..--+.|++.|+..|+||-=.....++.-+      -++..+  
T Consensus       244 ~~v~~~----------i~~~~~~~y~~v~~rR~M-~riA~~iae~~g~~aIvtGEsLGQVASQTl~------nL~~i~--  304 (383)
T COG0301         244 TEVQEE----------ILEKVPESYRCVLLKRMM-YRIAEKLAEEFGAKAIVTGESLGQVASQTLE------NLRVID--  304 (383)
T ss_pred             HHHHHH----------HHHHCCCCCEEHHHHHHH-HHHHHHHHHHHCCEEEEECCCCHHHHHHHHH------HHHHHH--
T ss_conf             999999----------986367530204789999-9999999998398399836861046676788------899998--


Q ss_pred             CCCEEEEEEECCHHHC-EEECCCCCCCHHHHHHHHHHCCCC-CC
Q ss_conf             8731898630202210-033425689978989999741254-35
Q gi|254780151|r  171 RDQSYFLFATTQQQLC-DLRFPLGDMKKESVRDLAREMGLD-IA  212 (408)
Q Consensus       171 KDQSYfL~~l~~~~L~-~~~FPlg~~~K~eVR~~A~~~gl~-~a  212 (408)
                                  .+.. -++=||=.|.|+||-++|++.|.. ++
T Consensus       305 ------------~~t~~pIlRPLI~~DK~eIi~~Ar~IgT~eiS  336 (383)
T COG0301         305 ------------SVTNTPVLRPLIGLDKEEIIEIARRIGTYEIS  336 (383)
T ss_pred             ------------HCCCCCEECCCCCCCHHHHHHHHHHHCCHHHH
T ss_conf             ------------15587423144579989999999982974431


No 53 
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domain has  a strongly conserved motif SGGKD at the N terminus.
Probab=98.93  E-value=5.5e-09  Score=84.86  Aligned_cols=113  Identities=19%  Similarity=0.306  Sum_probs=83.4

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             8999960985799999999886-984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      -++|++|||+||+.+|++|++. |.++.+||+...   .        .++..+++++++++. |+.++.+..........
T Consensus         3 DcIVpvSGGKDS~y~~~~lk~kyglnpL~Vt~~~~---~--------~t~~g~~Nl~nl~~~-g~D~~~~~~~~~~~~~l   70 (154)
T cd01996           3 DCIIGVSGGKDSSYALYLLKEKYGLNPLAVTVDNG---F--------NSEEAVKNIKNLIKK-GLDLDHLVINPEEMKDL   70 (154)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHCCCEEEEEECCC---C--------CCHHHHHHHHHHHHC-CCCEEEEECCHHHHHHH
T ss_conf             78996888818999999999994996599996798---7--------546899999999974-99816993288899999


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEE
Q ss_conf             441126787088612000015411058888874016876452253110254
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRL  151 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~  151 (408)
                      .   + .......++||..|..-+ |...++.|.+.++.+|.+||-.....
T Consensus        71 ~---~-~~~~~~~gd~~~~~~~~i-~~~~~~~A~k~~IplIi~Gen~~~e~  116 (154)
T cd01996          71 Q---L-ARFKAKVGDPCWPCDTAI-FTSLYKVALKFGIPLIITGENPAQEF  116 (154)
T ss_pred             H---H-HHHHHCCCCCHHHHHHHH-HHHHHHHHHHCCCCEEEECCCCCCCC
T ss_conf             9---9-999844799348899879-98999999993999899727835514


No 54 
>PRK02628 nadE NAD synthetase; Reviewed
Probab=98.92  E-value=3e-09  Score=86.70  Aligned_cols=198  Identities=18%  Similarity=0.243  Sum_probs=116.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHH----HHHCCC---EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             338899996098579999999----988698---4999998704787665555778818999999999998099589817
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAAL----LKRDGY---DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~l----L~~~G~---~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      .-++|++|+|||+||++|++.    +..-|.   +|+|++|-           +.-+++...+||+.+|+.|||.++.++
T Consensus       361 g~~~vViGLSGGiDSaLaLLVaa~A~d~Lg~~r~~V~~vtMP-----------s~~TS~~S~~dA~~La~~LGi~~~~I~  429 (678)
T PRK02628        361 GIKKVVIGISGGLDSTLALLVAAKAFDRLGLPRKNILAYTMP-----------GFGTTDRTKNNAVALMKALGVTAREID  429 (678)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHHCCCHHCEEEEECC-----------CCCCCHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             998189967776447999999999999848971224899778-----------876578789999999997299779976


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCCCEEC---CCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCC
Q ss_conf             0788663224411267870886120000---1541105888887401687645225311025412678773168853157
Q gi|254780151|r   92 YEERFRNAVIVPFASSYAAGETPLPCVD---CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMD  168 (408)
Q Consensus        92 ~~~~f~~~V~~~~~~~y~~G~TPNPc~~---CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D  168 (408)
                      +.+.+... +...-.....| .|+-|+.   --.++.=..|++.|.+.|.=.|.||-=.  +            +.-|- 
T Consensus       430 I~~a~~~~-~~di~~~~~~~-~~~~Dvt~ENiQAR~R~~iLM~laNk~g~LVL~TGNkS--E------------lAvGy-  492 (678)
T PRK02628        430 IRPAALQM-LKDIGHPFARG-EKVYDVTFENVQAGERTQILFRLANQRGGLVIGTGDLS--E------------LALGW-  492 (678)
T ss_pred             HHHHHHHH-HHHHCCHHHCC-CCCCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCC--H------------HHHCE-
T ss_conf             29999999-99844422237-87766026652035567899997457796797368514--6------------86483-


Q ss_pred             CCCCCEEEEEEEC-CHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCC-----CCC--
Q ss_conf             8787318986302-02210033425689978989999741254355111023011127751034553076-----643--
Q gi|254780151|r  169 LERDQSYFLFATT-QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINA-----GIA--  240 (408)
Q Consensus       169 ~~KDQSYfL~~l~-~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~-----~~~--  240 (408)
                               +++. .+..+ ..=|++++.|..||.+++-+.-...         |  +.+....|...+.     .+.  
T Consensus       493 ---------~Ty~yGD~mg-~yavn~~VpKTlV~~L~r~~a~~~~---------~--~~~~~~vl~~Il~tpiSpEL~P~  551 (678)
T PRK02628        493 ---------CTYGVGDHMS-HYNVNASVPKTLIQHLIRWVAESGQ---------F--DEAVSEVLLDILDTPISPELVPP  551 (678)
T ss_pred             ---------ECCCCCCCCC-CCCCCCCCCHHHHHHHHHHHHHHCC---------C--CCCHHHHHHHHCCCCCCCCCCCC
T ss_conf             ---------1047754124-6244678837899999999986244---------4--53112568985469999142798


Q ss_pred             -CCCCEECCCCCEEEE---ECCCEEEEEC
Q ss_conf             -467110377432233---5783153102
Q gi|254780151|r  241 -LEGDIVHLNGQILGR---HNGIINYTIG  265 (408)
Q Consensus       241 -~~G~ivd~~G~viG~---H~G~~~yTIG  265 (408)
                       ..|.|.-.|-..||.   ||-+.+|++-
T Consensus       552 ~~~~~i~QktEd~lgPYel~Df~Ly~~lr  580 (678)
T PRK02628        552 DEEGEIVQKTEDIVGPYELQDFFLYYFLR  580 (678)
T ss_pred             CCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             86677887463557875778999999997


No 55 
>pfam01507 PAPS_reduct Phosphoadenosine phosphosulfate reductase family. This domain is found in phosphoadenosine phosphosulfate (PAPS) reductase enzymes or PAPS sulfotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP). It is also found in NodP nodulation protein P from Rizobium which has ATP sulfurylase activity (sulfate adenylate transferase).
Probab=98.90  E-value=6.7e-08  Score=77.07  Aligned_cols=154  Identities=18%  Similarity=0.088  Sum_probs=104.9

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             89999609857999999998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      +|+|++|||.||+|.+.|+.+.+.++..+|+....           -..+-++.++++++.+|++++++.-...+++.+.
T Consensus         1 ~v~vsfSGGKDS~vlL~L~~~~~~~~~vvf~Dtg~-----------efpet~~~v~~~~~~~~~~~~~~~~~~~~~~~~~   69 (174)
T pfam01507         1 ELVVSFSGGKDSLVLLHLASKAFPPGPVIFIDTGY-----------EFPETYEFVDELEEKYGLNLKVYRPEDSFAEGIN   69 (174)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCCEEEEECCC-----------CCHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHH
T ss_conf             99999576099999999999848997579997899-----------8689999999999984981899808677987763


Q ss_pred             CCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEE-ECCCCCCCCEEEEEEE
Q ss_conf             411267870886120000154110588888740168764522531102541267877316885-3157878731898630
Q gi|254780151|r  102 VPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMC-RPMDLERDQSYFLFAT  180 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~-r~~D~~KDQSYfL~~l  180 (408)
                      ..     ...-. ...-.|.+..|...|.++.++++.+.+.+|=    +..   ++..+..+. -..|....+.      
T Consensus        70 ~~-----~~~~~-~~~~~~~~~~K~~p~~~~l~~~~~~~~i~Gi----R~~---Es~~R~~~~~~~~~~~~~~~------  130 (174)
T pfam01507        70 PE-----GIPSK-LWEDCPCRLRKVEPLKRALKKLDFDAWFTGL----RRD---ESPSRAKLPIVSIDGDFPKV------  130 (174)
T ss_pred             HC-----CCCHH-HCCCCCHHHHHHHHHHHHHHHCCCCEEEEEE----ECC---CHHHHHHCCEEEEECCCCCE------
T ss_conf             12-----79501-1454521466517999999865996899951----002---44566407167430578885------


Q ss_pred             CCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             2022100334256899789899997412543
Q gi|254780151|r  181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       181 ~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                           - -++||-+++..||-...++.|||.
T Consensus       131 -----~-~~~PI~~Wt~~DVw~yi~~~~lp~  155 (174)
T pfam01507       131 -----I-KVFPLLNWTETDVWQYILANNVPY  155 (174)
T ss_pred             -----E-EEECHHHCCHHHHHHHHHHCCCCC
T ss_conf             -----9-995005299999999999839999


No 56 
>KOG1706 consensus
Probab=98.75  E-value=2.7e-07  Score=72.78  Aligned_cols=164  Identities=24%  Similarity=0.359  Sum_probs=109.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHHHH
Q ss_conf             3388999960985799999999886984999998704787665555778818999999999998099-589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~f~   97 (408)
                      +.++|+.|.|||.|.|+-+.-|++|||||++... +-            -.++|++.|++-|-++|. .+.+.|+++||-
T Consensus         4 ~~~~vVLAySGgLDTscil~WLkeqGyeViay~A-nv------------GQ~edfe~ar~kAlk~Gakk~~~ed~~~eFv   70 (412)
T KOG1706           4 SKKSVVLAYSGGLDTSCILAWLKEQGYEVIAYLA-NV------------GQKEDFEEARKKALKSGAKKVVVEDVREEFV   70 (412)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCEEEEEEC-CC------------CCHHHHHHHHHHHHHCCCEEEEEHHHHHHHH
T ss_conf             7745999953886723435888862965898400-15------------6266689999753312760798613158887


Q ss_pred             HHCCCCCHH-------HHHCCCC-CCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCC
Q ss_conf             322441126-------7870886-12000015411058888874016876452253110254126787731688531578
Q gi|254780151|r   98 NAVIVPFAS-------SYAAGET-PLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDL  169 (408)
Q Consensus        98 ~~V~~~~~~-------~y~~G~T-PNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~  169 (408)
                      ++.+=|-++       .|.-|.. --||+.       .+..+.|.+.||++++.|---+     |.+ .-++-|.     
T Consensus        71 edfi~Pa~qs~a~YEd~YLLGTSlaRp~ia-------~~qv~va~~eg~~aVsHGcTGK-----GND-QvrFELt-----  132 (412)
T KOG1706          71 EDFIWPALQSSALYEDRYLLGTSLARPVIA-------KAQVDVAQREGAKAVSHGCTGK-----GND-QVRFELT-----  132 (412)
T ss_pred             HHCCHHHHHHCCHHHCEEEECCCCCCCHHH-------HHHHHHHHHCCCEEEECCCCCC-----CCC-CEEEEEE-----
T ss_conf             602016443112101013422444431343-------3353577651750330355667-----774-0246653-----


Q ss_pred             CCCCEEEEEEECCHHHCEEECCCCC------C-CHHHHHHHHHHCCCCC---CCHHHCCCEEE
Q ss_conf             7873189863020221003342568------9-9789899997412543---55111023011
Q gi|254780151|r  170 ERDQSYFLFATTQQQLCDLRFPLGD------M-KKESVRDLAREMGLDI---ADKSDSQDICF  222 (408)
Q Consensus       170 ~KDQSYfL~~l~~~~L~~~~FPlg~------~-~K~eVR~~A~~~gl~~---a~K~eSqgICF  222 (408)
                           |  +.|.++.  +++-|...      + -..+.-+.|+..|+|+   ..++=|||=-.
T Consensus       133 -----~--ysl~P~~--kviapwrmp~f~~rf~Gr~Dl~eYakq~giPvpvT~k~pwsmDeNl  186 (412)
T KOG1706         133 -----F--YSLKPDV--KVIAPWRMPEFYERFKGRKDLLEYAKQHGIPVPVTPKNPWSMDENL  186 (412)
T ss_pred             -----E--ECCCCCC--EEECCCCCHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCC
T ss_conf             -----3--1147763--0333545467887642714789999864997665688876544110


No 57 
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily  including N type ATP PPases and ATP sulphurylases. The domain forms a apha/beta/apha fold which  binds to Adenosine group..
Probab=98.74  E-value=3.1e-08  Score=79.43  Aligned_cols=71  Identities=41%  Similarity=0.535  Sum_probs=56.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCC
Q ss_conf             99996098579999999988698499999870478766555577881899999999999809958981707886632244
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIV  102 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~  102 (408)
                      |+|+||||+|||++|++|++.|+++.++++..+-.+             .++++++.|++                    
T Consensus         1 ~~v~~sgG~ds~~~~~~l~~~~~~~~~~~~~~~~~~-------------~~~~~~~~a~~--------------------   47 (103)
T cd01986           1 VLVAFSGGKDSSVAAALLKKLGYQVIAVTVDHGISP-------------RLEDAKEIAKE--------------------   47 (103)
T ss_pred             CEEEECCCCHHHHHHHHHHHCCCCEEEEEEECCCCC-------------HHHHHHHHHHH--------------------
T ss_conf             989742882219999999986986289998537662-------------78899999999--------------------


Q ss_pred             CCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             112678708861200001541105888887401687645225311
Q gi|254780151|r  103 PFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus       103 ~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                                           +....+.+.|.+.|++.|+|||..
T Consensus        48 ---------------------~~~~~~~~~a~~~~~~~i~~G~~~   71 (103)
T cd01986          48 ---------------------AREEAAKRIAKEKGAETIATGTRR   71 (103)
T ss_pred             ---------------------HHHHHHHHHHHHCCCHHHCCCCCH
T ss_conf             ---------------------999999999886172143047531


No 58 
>TIGR00552 nadE NAD+ synthetase; InterPro: IPR003694 NAD+ synthase (6.3.5.1 from EC) catalyzes the last step in the biosynthesis of nicotinamide adenine dinucleotide and is induced by stress factors such as heat shock and glucose limitation. The three-dimensional structure of NH3-dependent NAD+ synthetase from Bacillus subtilis, in its free form and in complex with ATP shows that the enzyme consists of a tight homodimer with alpha/beta subunit topology .; GO: 0003952 NAD+ synthase (glutamine-hydrolyzing) activity, 0005524 ATP binding, 0009435 NAD biosynthetic process.
Probab=98.72  E-value=7.1e-08  Score=76.89  Aligned_cols=169  Identities=25%  Similarity=0.308  Sum_probs=116.5

Q ss_pred             CCCCCCCCEEEEEECCCHHH--------HHHHHHHHHC-CC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             78886338899996098579--------9999999886-98-49999987047876655557788189999999999980
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDS--------SVVAALLKRD-GY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI   83 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDS--------svaa~lL~~~-G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~L   83 (408)
                      ..+++.-..+++|+|||+||        ++.+++.++. |. +++++.|--          +....+.|..+|..+|+.+
T Consensus        20 ~~~~~~~~g~v~GlsGG~ds~l~g~l~~~~v~~~~~~~~~~~~~~~~~~p~----------~~~~~~~d~~~a~~~~~~~   89 (286)
T TIGR00552        20 VKKSPGAKGVVLGLSGGVDSTLAGKLCQAVVAALCVEALGKEQNHALLLPH----------SNTTPEDDVQDALALAEPL   89 (286)
T ss_pred             HHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCHHHHEEEEECC----------CCCCCHHHHHHHHHHHHHC
T ss_conf             763257650467304762035677899999999998504611420332146----------6788412179999988740


Q ss_pred             CCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECC----CCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCC
Q ss_conf             9958981707886632244112678708861200001----541105888887401687645225311025412678773
Q gi|254780151|r   84 NVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC----NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKR  159 (408)
Q Consensus        84 gI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~C----N~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~  159 (408)
                      +++...+++...+...      ........++-+-..    ..+++.-.++.+|.+.+.-.+.|||.+....  |     
T Consensus        90 ~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~gn~~~r~r~~~~y~~a~~~~~lv~gt~n~~e~~~--G-----  156 (286)
T TIGR00552        90 GINYKTIDIAPIAASF------QAQTETGDPLADFLAEGNLKARLRMALLYAHANKHNLLVLGTGNKSELLL--G-----  156 (286)
T ss_pred             CCCCEECCCHHHHHHH------HHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHHHH--H-----
T ss_conf             5442111304677887------76420344333102332224788999998873101635640461344543--2-----


Q ss_pred             EEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC-----C--CCCHHHCCCEEECC
Q ss_conf             16885315787873189863020221003342568997898999974125-----4--35511102301112
Q gi|254780151|r  160 RRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL-----D--IADKSDSQDICFVQ  224 (408)
Q Consensus       160 ~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl-----~--~a~K~eSqgICFi~  224 (408)
                       + ..+--                ....-+.|+|.+.|.+|+++|+.+|.     |  +.+|+-|-++ |-+
T Consensus       157 -y-~t~~G----------------dg~~d~~p~~~l~k~~~~~l~~~l~~~~~~~P~~~~~k~P~a~l-~~g  209 (286)
T TIGR00552       157 -Y-FTKYG----------------DGGCDILPLGGLFKTEVYELAKRLGVEQTIIPEEIIEKPPTADL-WPG  209 (286)
T ss_pred             -H-HHHCC----------------CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHCCCCCCCC-CCC
T ss_conf             -0-01014----------------42000345532237889999998175310146667337887554-678


No 59 
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase. PAPS reductase is part of the adenine nucleotide alpha hydrolases superfamily also including N type ATP PPases and ATP sulphurylases. A highly modified version of the P loop, the fingerprint peptide of mononucleotide-binding proteins, is present in the active site of the protein, which appears to be a positively charged cleft containing a number of conserved arginine and lysine residues. Although PAPS reductase has no ATPase activity, it shows a striking similarity to the structure of the ATP pyrophosphatase (ATP PPase) domain of GMP synthetase, indicating that both enzyme families have evolved from a common ancestral nucleotide-binding fold.   The enzyme uses thioredoxin as an electron donor for the reduction of PAPS to phospho-adenosine-phosphate (PAP) . It is also found in NodP nodulation protein P from Rhizobium meliloti which has ATP sulphurylase acti
Probab=98.65  E-value=7.4e-07  Score=69.60  Aligned_cols=156  Identities=24%  Similarity=0.186  Sum_probs=100.1

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCC---EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             899996098579999999988698---49999987047876655557788189999999999980995898170788663
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGY---DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~---~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +|+|++|||.||+|.+.|+.+...   .+.-+|...   +.        -.++..+.+++++++++++..++-....+..
T Consensus         1 ~~~vsfSGGKDS~vll~L~~~~~~~~~~~~vvf~DT---g~--------e~pet~~~~~~~~~~~~~~~~~~~~~~~~~~   69 (173)
T cd01713           1 NVVVSFSGGKDSTVLLHLALKALPELKPVPVIFLDT---GY--------EFPETYEFVDRVAERYGLPLVVVRPPDSPAE   69 (173)
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEEECC---CC--------CCHHHHHHHHHHHHHCCCEEEEEECCCCHHH
T ss_conf             959996464999999999999665558837999688---89--------8989999999999873990799968972899


Q ss_pred             HCCCCCHHHHHCCCCCCCEE-CCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEEC-CCCCCCCEEE
Q ss_conf             22441126787088612000-015411058888874016876452253110254126787731688531-5787873189
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCV-DCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRP-MDLERDQSYF  176 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~-~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~-~D~~KDQSYf  176 (408)
                      .+.    ..-....-|+++. .|...+|-.-+.++.++.+.+.+.+|    ++.   +++..+..+... .+..++.   
T Consensus        70 ~~~----~~~~~~~~~~~~~~~c~~~~K~~P~~~~~~~~~~~~~~~G----iR~---~Es~~R~~~~~~~~~~~~~~---  135 (173)
T cd01713          70 GLA----LGLKGFPLPSPDRRWCCRILKVEPLRRALKELGVVAWITG----IRR---DESARRALLPVVWTDDGKGG---  135 (173)
T ss_pred             HHH----HHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCEEEEE----CCC---CCCHHHCCCCCCCCCCCCCC---
T ss_conf             998----6135779983226889888807899999983298289994----121---46244443762343268899---


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             86302022100334256899789899997412543
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                             .  -.+.||-+++..||-....+.++|.
T Consensus       136 -------~--~~~~Pi~~Wt~~dVw~yi~~~~l~~  161 (173)
T cd01713         136 -------I--LKVNPLLDWTYEDVWAYLARHGLPY  161 (173)
T ss_pred             -------E--EEEECHHHCCHHHHHHHHHHCCCCC
T ss_conf             -------8--9993228599999999999839999


No 60 
>PRK13795 hypothetical protein; Provisional
Probab=98.60  E-value=4.2e-07  Score=71.35  Aligned_cols=166  Identities=19%  Similarity=0.162  Sum_probs=107.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      +..|.|++|||.||++++.|.++++-++..+|..+.-+           .++.++.++++++++||++.+.+..+.||+.
T Consensus       245 ~~pv~VsfSGGKDS~v~L~La~ka~~~~~~~f~dTglE-----------fPeT~e~v~~~~~~~gi~~~~~~a~~~fw~~  313 (630)
T PRK13795        245 NLPVVVSFSGGKDSLVVLDLAAEALRKFKAFFNNTGLE-----------FPETVENVKEVAEEYGVELIVADAGDAFWRA  313 (630)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHCCCEEEEEECCCCC-----------CHHHHHHHHHHHHHHCCCEEEECCCHHHHHH
T ss_conf             89759952686899999999998549828999507767-----------6469999999999869818996563678888


Q ss_pred             CCCCCHHHHHCCCCCCCE-ECCCCEEEHHHHHHHHCCCCCCEE--CCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             244112678708861200-001541105888887401687645--22531102541267877316885315787873189
Q gi|254780151|r  100 VIVPFASSYAAGETPLPC-VDCNRTVKFSDLLSVTRQLGADVL--ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc-~~CN~~iKF~~l~~~a~~~g~~~i--ATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                      +-.       .|- |--+ -.|.+..|.+.+.++.++..-..+  -.|-  |-.+     +     ..|+.-+.=-++  
T Consensus       314 ~~~-------~Gp-P~rd~RWCckv~Kl~pl~~~i~~~~~~~~l~~~G~--R~~E-----S-----~~R~~~~rv~~n--  371 (630)
T PRK13795        314 IEK-------FGP-PARDYRWCCKVCKLGPITRAIKSNFPQGCLSFVGQ--RKYE-----S-----FARAKSPRVWRN--  371 (630)
T ss_pred             HHH-------CCC-CCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEEEEC--CHHH-----H-----HHHHCCCCCCCC--
T ss_conf             887-------499-96556435543100579999997589962999855--2466-----3-----766048861447--


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCHH-HCCCEEEC
Q ss_conf             8630202210033425689978989999741254---35511-10230111
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADKS-DSQDICFV  223 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K~-eSqgICFi  223 (408)
                        ..-+.|  -..+|+-+++--+|--.--..+|+   .+++- |-.| ||+
T Consensus       372 --~~i~~q--~~a~PI~~Ws~~~VwLYi~~~~l~~NplY~~Gf~RiG-C~~  417 (630)
T PRK13795        372 --PWVPNQ--IGAAPIQDWTALEVWLYIFSRKLPYNPLYERGFDRIG-CWL  417 (630)
T ss_pred             --CCCCCE--EEEECHHCCCHHHHHHHHHHCCCCCCHHHHCCCCCCC-EEE
T ss_conf             --787772--6872033173869999998848998847875875656-740


No 61 
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis]
Probab=98.59  E-value=1.2e-07  Score=75.13  Aligned_cols=171  Identities=23%  Similarity=0.293  Sum_probs=104.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      |+|-|.+|||.|||+||++|++-||+|.-|++.+.-.             ..|+.|+.-|+.||.||.++.+-.+--++-
T Consensus         1 m~v~vLfSGGKDSSLaA~iL~klgyev~LVTvnFGv~-------------d~~k~A~~tA~~lgF~h~vl~Ldr~ile~A   67 (198)
T COG2117           1 MDVYVLFSGGKDSSLAALILDKLGYEVELVTVNFGVL-------------DSWKYARETAAILGFPHEVLQLDREILEDA   67 (198)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCC-------------CCHHHHHHHHHHHCCCCCEECCCHHHHHHH
T ss_conf             9568984489710589999987178717999873346-------------640668999998299700001688999999


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEE
Q ss_conf             44112678708861200001541105888887401687645225311025412678773168853157878731898630
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT  180 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l  180 (408)
                      ++-.++    ---|++-|-   +|- +.-++++-.-..+.||.|.    +-   |+  ..+.|-+    .+-||.     
T Consensus        68 ~em~ie----dg~P~~aIq---~iH-~~alE~~A~r~~~~iaDGT----RR---DD--rvP~ls~----~~~qSL-----  121 (198)
T COG2117          68 VEMIIE----DGYPRNAIQ---YIH-EMALEALASREVDRIADGT----RR---DD--RVPKLSR----SEAQSL-----  121 (198)
T ss_pred             HHHHHH----CCCCCHHHH---HHH-HHHHHHHHHHHHHHHCCCC----CC---CC--CCCCCCH----HHHHHH-----
T ss_conf             999985----389850889---999-9999999877788875787----44---56--6764249----887518-----


Q ss_pred             CCHHHC-EEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCC
Q ss_conf             202210-03342568997898999974125435511102301112775103455307
Q gi|254780151|r  181 TQQQLC-DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRIN  236 (408)
Q Consensus       181 ~~~~L~-~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~  236 (408)
                       ...+. .-+-||-.+-+..||.+|..+= .+.+.+ |-   =+++.||..-|+..+
T Consensus       122 -EdR~nv~Yi~PL~G~G~kti~~Lv~~~f-~~e~~~-Se---~~~k~DYEaElR~lL  172 (198)
T COG2117         122 -EDRLNVQYIRPLLGLGYKTIRRLVSAIF-ILEEGP-SE---KIEKADYEAELRYLL  172 (198)
T ss_pred             -HHHCCCEEECCCCCCCHHHHHHHHHHHE-EEECCC-CC---CCCCCCHHHHHHHHH
T ss_conf             -8751864553033446789999988773-410166-55---555532699999999


No 62 
>PRK08557 hypothetical protein; Provisional
Probab=98.57  E-value=7.6e-07  Score=69.51  Aligned_cols=165  Identities=18%  Similarity=0.193  Sum_probs=106.0

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      +..|.|++|||.||++++.|..+++-++..+|..+.-   +        .++.++.++++|+++|+++.+++ .+.||+.
T Consensus       183 ~~pV~VSfSGGKDS~a~L~La~~a~~~~~vvF~DTGl---E--------fPeT~eyve~~~~~~~~~l~~~~-~~~fw~~  250 (420)
T PRK08557        183 GYAINASFSGGKDSAVSTLLSKEVIPDLDVVFIDTGL---E--------YPETLNYVKDFAKKYDINLDTVD-GDNFWDN  250 (420)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCC---C--------CHHHHHHHHHHHHHCCCCEEEEC-CHHHHHH
T ss_conf             9746996068789999999999854881699962887---7--------72389999999998099679965-4668988


Q ss_pred             CCCCCHHHHHCCCCCCCE-ECCCCEEEHHHHHHHHCCC-CCCEE--CCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             244112678708861200-0015411058888874016-87645--2253110254126787731688531578787318
Q gi|254780151|r  100 VIVPFASSYAAGETPLPC-VDCNRTVKFSDLLSVTRQL-GADVL--ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc-~~CN~~iKF~~l~~~a~~~-g~~~i--ATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      +-       ..| -|-.+ -.|.+..|.+.+-++.+++ +-+.+  -.|-  |-.     ++     ..|+.-+.=-++ 
T Consensus       251 ~~-------~~G-pP~rd~RWCc~v~Kl~Pl~~~i~~~~~~~~vl~~~G~--R~~-----ES-----~~R~~~~~~~~~-  309 (420)
T PRK08557        251 LE-------KEG-IPTKDNRWCNSACKLMPLKRYLKKKYGNKKVLTIDGS--RKY-----ES-----FTRANLDYERKS-  309 (420)
T ss_pred             HH-------HCC-CCCCCCCCCCCCHHHHHHHHHHHHHCCCCCEEEEEEE--CHH-----HH-----HHHHCCCCCCCC-
T ss_conf             77-------549-9976672507431017899999985789875999970--145-----40-----766058741347-


Q ss_pred             EEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCH-HHCCCEEEC
Q ss_conf             98630202210033425689978989999741254---3551-110230111
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADK-SDSQDICFV  223 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K-~eSqgICFi  223 (408)
                         ..-+.|+  ..+|+-+++--+|--..-..|++   .+++ =|--| ||+
T Consensus       310 ---~~v~~q~--~~~PI~~Wsa~~VwLYI~~~~l~~NplY~~Gf~RvG-C~~  355 (420)
T PRK08557        310 ---GFIDFQT--NVFPILDWNSLDIWSYIFSNDILYNPMYDKGFERIG-CYL  355 (420)
T ss_pred             ---CCCCCCE--EEEHHHCCCHHHHHHHHHHCCCCCCHHHHCCCCCCC-EEE
T ss_conf             ---7766650--353153260769999999759999848866876367-770


No 63 
>PRK13794 hypothetical protein; Provisional
Probab=98.56  E-value=1.1e-06  Score=68.37  Aligned_cols=171  Identities=16%  Similarity=0.130  Sum_probs=107.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             388999960985799999999886-9849999987047876655557788189999999999980995898170788663
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +..|.|++|||.||++++.|..++ |-++..+|..+.-           -.++.++.+.++++++|+++...+..+ ||+
T Consensus       245 ~~pv~VSfSGGKDS~v~L~La~ka~~~~~~vvF~DTgl-----------EfPeT~e~ve~v~~~~gv~ii~~~~~~-fw~  312 (473)
T PRK13794        245 GKPPSVAYSGGKDSLATLLLALKAFGNEFPVLFADTGL-----------EFPETLENVEDVEELYGLEIIRTSSGE-FWE  312 (473)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCEEEEEEECCC-----------CCHHHHHHHHHHHHHHCCCEEEECCCC-HHH
T ss_conf             99839970686899999999998608971699960888-----------767699999999998598789915644-778


Q ss_pred             HCCCCCHHHHHCCCCCCC-EECCCCEEEHHHHHHHHCCCCCCEECC--CCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             224411267870886120-000154110588888740168764522--53110254126787731688531578787318
Q gi|254780151|r   99 AVIVPFASSYAAGETPLP-CVDCNRTVKFSDLLSVTRQLGADVLAT--GHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNP-c~~CN~~iKF~~l~~~a~~~g~~~iAT--GHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      .+-..       | -|-. .-.|.+..|.+.|.++.++.-...+.|  |-  |-.++          ..|+.-+.     
T Consensus       313 ~~~~~-------G-pP~rd~RWCc~v~Kl~pl~~~l~~~~~~~~l~~vG~--R~~ES----------~~Rak~pr-----  367 (473)
T PRK13794        313 KLEEY-------G-PPARDNRWCSEVCKLSPLGKLIDEKYEGECLSFVGQ--RKYES----------FNRSKKPR-----  367 (473)
T ss_pred             HHHHC-------C-CCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEC--CHHHH----------HHHHCCCC-----
T ss_conf             88861-------9-997666021322637899999997489971899852--16876----------87504874-----


Q ss_pred             EEEEE--CCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCHH-HCCCEEEC-CCCCCHHH
Q ss_conf             98630--202210033425689978989999741254---35511-10230111-27751034
Q gi|254780151|r  176 FLFAT--TQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADKS-DSQDICFV-QQGKYFDV  231 (408)
Q Consensus       176 fL~~l--~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K~-eSqgICFi-~~~~~~~F  231 (408)
                       +++-  -+.|+  ..+|+-+++--+|--.--..++|   .+++- |-.| ||+ |-....+|
T Consensus       368 -v~~n~~i~~qi--~~~PI~~Wtal~VwLYI~~~~lp~NpLY~~Gf~RvG-C~~CPa~~~~e~  426 (473)
T PRK13794        368 -IWRNPTIKKQM--LAAPILNWTAMHVWIYLFREKAPYNVLYEQGFDRIG-CFMCPAMEIGEI  426 (473)
T ss_pred             -CCCCCCCCCCE--EEECHHCCHHHHHHHHHHHCCCCCCHHHHCCCCCCC-EECCCCCCHHHH
T ss_conf             -12378876715--761431051879999998758998858876875455-604867566899


No 64 
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily   of proteins is predicted to  bind ATP. This domainhas  a strongly conserved motif SGGKD at the N terminus.
Probab=98.54  E-value=1.3e-06  Score=67.84  Aligned_cols=162  Identities=15%  Similarity=0.146  Sum_probs=89.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEE-EECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999988698499999-8704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVT-LQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~-m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      ||++..|||.||++|++.+.++|++|+++. +..-+.+. ..     ...-..+-.+..|+.||||+..+...-.     
T Consensus         1 Kv~~l~SGGKDS~lAl~~a~~~g~~v~~L~~~~~~~~~~-~~-----~H~~~~~l~~~qAealgiPl~~~~~~~~-----   69 (194)
T cd01994           1 KVVALISGGKDSCYALYRALEEGHEVVALLNLTPEEGSS-MM-----YHTVNHELLELQAEAMGIPLIRIEISGE-----   69 (194)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCEEEEEEEEECCCCCE-EE-----CCCCCHHHHHHHHHHCCCCEEEEECCCC-----
T ss_conf             989997785999999999998699259999996399880-52-----5055789999999985996699966898-----


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEE
Q ss_conf             44112678708861200001541105888887401687645225311025412678773168853157878731898630
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT  180 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l  180 (408)
                      -+...+.                  +..++..+++.|++.|++|--.   .. ... ...-.+|...             
T Consensus        70 ~~~~~~~------------------l~~~L~~~k~~gi~~vv~GdI~---s~-~qr-~~~e~~c~~l-------------  113 (194)
T cd01994          70 EEDEVED------------------LKELLRKLKEEGVDAVVFGAIL---SE-YQR-TRVERVCERL-------------  113 (194)
T ss_pred             CCHHHHH------------------HHHHHHHHHHCCCCEEEECCCC---CH-HHH-HHHHHHHHHC-------------
T ss_conf             7179999------------------9999999997599599999633---28-899-9999999973-------------


Q ss_pred             CCHHHCEEECCCCCCCHHHHHHHHHHCCCC-CCCHHHCCCE--EECCCCCCHHHHHH
Q ss_conf             202210033425689978989999741254-3551110230--11127751034553
Q gi|254780151|r  181 TQQQLCDLRFPLGDMKKESVRDLAREMGLD-IADKSDSQDI--CFVQQGKYFDVVKR  234 (408)
Q Consensus       181 ~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~-~a~K~eSqgI--CFi~~~~~~~Fl~~  234 (408)
                          =-..+|||=+..-.++-+...+.|+. +--+-++.++  =|+|+.=-.+|++.
T Consensus       114 ----gl~~~~PLW~~~~~~ll~e~i~~Gf~aiiv~V~a~~L~~~~lGr~id~~~~~~  166 (194)
T cd01994         114 ----GLEPLAPLWGRDQEELLREMIEAGFKAIIIKVAAEGLDESWLGREIDEMFIEL  166 (194)
T ss_pred             ----CCEEECHHCCCCHHHHHHHHHHCCCEEEEEEEECCCCCHHHCCCCCCHHHHHH
T ss_conf             ----98887001079999999999987990999995026899689598804868999


No 65 
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B. This domain is always found associated n-terminal amidotransferase domain. Family members that contain this domain catalyse the conversion of aspartate to asparagine. Asparagine synthetase B  catalyzes the assembly of asparagine from aspartate, Mg(2+)ATP, and glutamine. The three-dimensional architecture of the N-terminal domain of asparagine synthetase B is similar to that observed for glutamine phosphoribosylpyrophosphate amidotransferase while the molecular motif of the C-domain is reminiscent to that observed for GMP synthetase .
Probab=98.52  E-value=4.2e-07  Score=71.34  Aligned_cols=113  Identities=24%  Similarity=0.229  Sum_probs=73.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             338899996098579999999988698-4999998704787665555778818999999999998099589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      .+.+|.+.||||+|||.-|+++.+++. ++.++++..-+.           ..++...|+++|+++|++|+.+++.....
T Consensus        14 sd~~vg~~LSGGlDSs~ia~~~~~~~~~~~~~~s~~~~~~-----------~~de~~~a~~va~~~~~~~~~i~~~~~~~   82 (269)
T cd01991          14 SDVPVGVLLSGGLDSSLVAALAARLLPEPVKTFSIGFGFE-----------GSDEREYARRVAEHLGTEHHEVEFTPADL   82 (269)
T ss_pred             CCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEEECCCC-----------CCCHHHHHHHHHHHCCCCCEEEECCHHHH
T ss_conf             4885686513569999999999983689984799862899-----------97378999999998098824531434889


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             322441126787088612000015411058888874016876452253110
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                      ..-+...   ...-..|.+...+  .. +-.+.+.|.+.|+.-+-||+=+-
T Consensus        83 ~~~~~~~---~~~~~~p~~~~~~--~~-~~~l~~~a~~~g~~VllsG~GgD  127 (269)
T cd01991          83 LAALPDV---IWELDEPFADSSA--IP-LYLLSRLARKHGIKVVLSGEGAD  127 (269)
T ss_pred             HHHHHHH---HHHHCCCCHHHHH--HH-HHHHHHHHHHCCCEEEEECCCHH
T ss_conf             9999999---9986396012547--89-99999999853977999677614


No 66 
>pfam01902 ATP_bind_4 ATP-binding region. This family of proteins probably binds ATP. This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N terminus.In some members of this family, this domain is associated with pfam01042.
Probab=98.50  E-value=1.4e-06  Score=67.55  Aligned_cols=92  Identities=16%  Similarity=0.212  Sum_probs=63.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             889999609857999999998869849999-9870478766555577881899999999999809958981707886632
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      ||+++..|||.||++|++.+.++ ++|.++ +|..-+.+.      .....-..+-.+..|+.+|||+..+..+.+..  
T Consensus         1 MK~~~l~SGGKDS~~Al~~a~~~-~~v~~L~t~~~~~~ds------~~~H~~~~~l~~~qA~algiPl~~~~~~~~~e--   71 (219)
T pfam01902         1 MKVAALYSGGKDSNYALYWALKE-IEVPYLVSMKSENKES------YMFHEPNLHLTKLLAEALGIPIIKLYTKGEEE--   71 (219)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHC-CCCEEEEEEEECCCCC------CCCCCCCHHHHHHHHHHCCCCEEEEECCCCHH--
T ss_conf             93999972869999999999871-9837999996379981------02615788999999997599689996798617--


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             2441126787088612000015411058888874016876452253
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                             .                 .+..|.+..+++|++.|++|-
T Consensus        72 -------~-----------------~~~~L~~~l~~~~i~~vv~Gd   93 (219)
T pfam01902        72 -------K-----------------EVEDLAGFLESLDVDALVAGA   93 (219)
T ss_pred             -------H-----------------HHHHHHHHHHHCCCCEEEECC
T ss_conf             -------9-----------------999999999875986999986


No 67 
>pfam00733 Asn_synthase Asparagine synthase. This family is always found associated with pfam00310. Members of this family catalyse the conversion of aspartate to asparagine.
Probab=98.42  E-value=1.2e-06  Score=68.23  Aligned_cols=110  Identities=25%  Similarity=0.263  Sum_probs=70.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             3388999960985799999999886-984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      .+-.|.+.+|||+|||+.|+++++. ..++.++++.+-+..           .+|...|+++|+++|++|+.+++..+-.
T Consensus        16 sdvpig~~LSGGlDSs~ia~l~~~~~~~~i~~~s~~~~~~~-----------~~E~~~a~~~a~~~~~~~~~v~~~~~~~   84 (195)
T pfam00733        16 ADVPVGVLLSGGLDSSLIAALAARQSSPPLKTFSVGFEGSD-----------YDEAPYAELVADHLGTDHHEIIVTEEEL   84 (195)
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCC-----------CCHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             69836753067468999999999853899538955788899-----------7589999999965133517877255999


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC
Q ss_conf             3224411267870886120000154110588888740168764522531
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY  146 (408)
                      .+.+..++...   .+|..  ..+... +-.+.+.|++ |+.-+-||+=
T Consensus        85 ~~~~~~~i~~~---~~P~~--~~~~~~-~~~l~k~~~~-~~kV~lsG~G  126 (195)
T pfam00733        85 LDALPEVIYHL---EEPFG--DSSAIP-LYLLSRLARK-GVKVVLSGEG  126 (195)
T ss_pred             HHHHHHHHHHH---CCCCC--CCCHHH-HHHHHHHHHC-CCEEEEEEEC
T ss_conf             99988889986---29877--751789-9999999868-9849997156


No 68 
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism]
Probab=98.30  E-value=3e-05  Score=58.14  Aligned_cols=154  Identities=19%  Similarity=0.163  Sum_probs=107.5

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             89999609857999999998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      .++++.|||.||+|.+.|..+...++.-+|+.+.-           -..+-++.+.++++++|+++.+..-.+.+++.  
T Consensus        41 ~~~~~~S~Gkds~V~l~L~~k~~~~~~vif~DTg~-----------~f~Et~~~~d~~~~~~~~~l~~~~~~~~~~~~--  107 (261)
T COG0175          41 PVVVSFSGGKDSTVLLHLAAKAFPDFPVIFLDTGY-----------HFPETYEFRDRLAEEYGLDLKVYRPDDEVAEG--  107 (261)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCC-----------CCHHHHHHHHHHHHHCCCEEEEECCCHHHHHH--
T ss_conf             75998127467999999998602587189970777-----------57889999999998729717981673234434--


Q ss_pred             CCCHHHHHCC-CCCCCEEC-CCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEE
Q ss_conf             4112678708-86120000-154110588888740168764522531102541267877316885315787873189863
Q gi|254780151|r  102 VPFASSYAAG-ETPLPCVD-CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA  179 (408)
Q Consensus       102 ~~~~~~y~~G-~TPNPc~~-CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~  179 (408)
                          ..|-.. --|+ .-+ |+...|-..|.+..++.+.+...||    ++..   ++..+. -.+-........     
T Consensus       108 ----~~~~~~~~~~~-~~r~c~~i~K~~pl~~al~~~~~~a~~~G----~Rrd---es~~Ra-k~~~~~~~~~~~-----  169 (261)
T COG0175         108 ----EKYGGKLWEPS-VERWCCDIRKVEPLKRALDEYGFDAWFTG----LRRD---ESPTRA-KLPVVSFDSEFG-----  169 (261)
T ss_pred             ----HHCCCCCCCCC-CCHHHHHHHHHHHHHHHHHHCCCCEEEEE----CCCC---CCCCCC-CCCEECCCCCCC-----
T ss_conf             ----42136679997-40233256855139999963586249986----1204---563202-486453467876-----


Q ss_pred             ECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             02022100334256899789899997412543
Q gi|254780151|r  180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       180 l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                           =.--++||-++|-.||-......++|.
T Consensus       170 -----~~~rv~Pl~~Wt~~dVw~Yi~~~~lp~  196 (261)
T COG0175         170 -----ESIRVNPLADWTELDVWLYILANNLPY  196 (261)
T ss_pred             -----CCEEECCHHCCCHHHHHHHHHHHCCCC
T ss_conf             -----836871532099999999999958998


No 69 
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only]
Probab=98.27  E-value=1.1e-05  Score=61.33  Aligned_cols=93  Identities=19%  Similarity=0.239  Sum_probs=65.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCC-CCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             889999609857999999998869849999987047876-6555577881899999999999809958981707886632
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK-ASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~-~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      ||+++.+|||.||..|+++..++|++|.++.. +...+. +..     -..-....+...|+.+|||+...+..-+..+ 
T Consensus         1 mk~~aL~SGGKDS~~Al~~a~~~G~eV~~Ll~-~~p~~~dS~m-----~H~~n~~~~~~~Ae~~gi~l~~~~~~g~~e~-   73 (223)
T COG2102           1 MKVIALYSGGKDSFYALYLALEEGHEVVYLLT-VKPENGDSYM-----FHTPNLELAELQAEAMGIPLVTFDTSGEEER-   73 (223)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHCCCEEEEEEE-EECCCCCEEE-----EECCCHHHHHHHHHHCCCCEEEEECCCCCHH-
T ss_conf             96899981671889999999975983689999-8159987044-----2222567999998744883599834763055-


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             2441126787088612000015411058888874016876452253
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                                               .+..|.+....+++|.|.+|-
T Consensus        74 -------------------------eve~L~~~l~~l~~d~iv~Ga   94 (223)
T COG2102          74 -------------------------EVEELKEALRRLKVDGIVAGA   94 (223)
T ss_pred             -------------------------HHHHHHHHHHHCCCCEEEECH
T ss_conf             -------------------------699999999737633799734


No 70 
>PRK08384 thiamine biosynthesis protein ThiI; Provisional
Probab=98.24  E-value=5.3e-06  Score=63.45  Aligned_cols=124  Identities=17%  Similarity=0.281  Sum_probs=78.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-----CCEEECCHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809-----9589817078
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-----VSHYVFDYEE   94 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-----I~~~~~d~~~   94 (408)
                      +-|+++.||||. |.||||++.+.|.+|+.+|+.+              +++..+-++.+++.|.     .+.+.+.   
T Consensus       179 ~Gk~l~LlSGGi-SPVAa~~mmKRG~~v~~vhf~~--------------~~~~~~kv~~l~~~L~~y~~~~~~~~~~---  240 (310)
T PRK08384        179 QGKMVGLLSDEL-SAVAIFLMMKRGVEVIPVHIGM--------------GEKNLEKVRKLWNQLKKYSYGSKGRLVV---  240 (310)
T ss_pred             CCCEEEEECCCC-CHHHHHHHHHCCCEEEEEEECC--------------CHHHHHHHHHHHHHHHHHCCCCCEEEEE---
T ss_conf             884899953886-3999999985698799998568--------------8789999999999999867998469999---


Q ss_pred             HHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC-CCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             8663224411267870886120000154110588888740168764522531-102541267877316885315787873
Q gi|254780151|r   95 RFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY-IRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        95 ~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY-ar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                            ++                      .|...-+.|++.|+..|+||-= .++....-.+   -..+-.+.|.    
T Consensus       241 ------~~----------------------~~~~a~~ia~~~~~~alvTGEsLGQVASQTl~n---l~~i~~~~~~----  285 (310)
T PRK08384        241 ------VK----------------------NFERVNKIIRDFGAKGVVKGLRPEQLASETLEN---IYEDSRMFDV----  285 (310)
T ss_pred             ------EC----------------------HHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHH---HHHHHHCCCC----
T ss_conf             ------66----------------------599999999985998999774125545457988---9999730488----


Q ss_pred             EEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             189863020221003342568997898999974125
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl  209 (408)
                                   -++=||=.|.|+||-++|++.|.
T Consensus       286 -------------PVlRPLIg~DK~EII~~Ar~IGT  308 (310)
T PRK08384        286 -------------PVYYPLIALPDEYIEKVKEKIGT  308 (310)
T ss_pred             -------------CCCCCCCCCCHHHHHHHHHHCCC
T ss_conf             -------------73038568998999999986388


No 71 
>PRK08576 hypothetical protein; Provisional
Probab=98.22  E-value=4.6e-06  Score=63.91  Aligned_cols=169  Identities=20%  Similarity=0.233  Sum_probs=105.3

Q ss_pred             CCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             34678886338899996098579999999988698499999870478766555577881899999999999809958981
Q gi|254780151|r   11 SLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        11 ~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~   90 (408)
                      |+.|-++-++..|+|..|||.||++++.|.+++.-+|.++|..+.-+           .++..+.+..+|++|||++...
T Consensus       226 s~~fL~~~~~~~iiVp~SGGKDStA~LlLA~ea~~dv~aVfvDTGlE-----------fPeT~eyVe~va~klGv~lv~a  294 (439)
T PRK08576        226 SIEFLEKFGEYTIIVPWSGGKDSTAALLLALKAFDEVTAVYVDTGYE-----------MPLTDEYVEKVAEKLGVDLIRA  294 (439)
T ss_pred             HHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHHCCEEEEEEECCCC-----------CHHHHHHHHHHHHHHCCEEEEE
T ss_conf             99999962898889956887799999999998618836999707986-----------5758999999999859769994


Q ss_pred             CHHHHHHHHCCCCCHHHHHCCCCCCC-EECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEE----EEEE
Q ss_conf             70788663224411267870886120-000154110588888740168764522531102541267877316----8853
Q gi|254780151|r   91 DYEERFRNAVIVPFASSYAAGETPLP-CVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRR----IMCR  165 (408)
Q Consensus        91 d~~~~f~~~V~~~~~~~y~~G~TPNP-c~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~----~L~r  165 (408)
                      +...  |..+.       ..|. |-. .-.|.+ +|.+.|-++.++++-..+..|-  |-..+     ..+.    ...|
T Consensus       295 ~~d~--~~~i~-------~~G~-Pt~d~RWCtk-~KL~PL~~~i~~~~~~l~~vG~--R~~ES-----~~R~~~~~v~~r  356 (439)
T PRK08576        295 GVDV--PMPIE-------GYGL-PTHENRWCTK-MKVEALYEAIRELSNPLLVVGD--RDGES-----ARRRLRPPVRER  356 (439)
T ss_pred             CCCC--CCHHC-------CCCC-CCCCCCCCCC-CCCHHHHHHHHHHCCCEEEECC--CHHHH-----HHHHCCCCEEEC
T ss_conf             7886--42210-------4799-9766633102-0025589999964897699527--25654-----776118963550


Q ss_pred             CCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCHH-HCCCEEEC
Q ss_conf             157878731898630202210033425689978989999741254---35511-10230111
Q gi|254780151|r  166 PMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADKS-DSQDICFV  223 (408)
Q Consensus       166 ~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K~-eSqgICFi  223 (408)
                      -..           + ..++  ..+|+-+++-.+|--.--..|+|   ..++- +-.| ||+
T Consensus       357 n~~-----------v-g~~~--~~~PIk~Wsa~~VwLYI~~~gip~NPLY~kGF~RIG-C~l  403 (439)
T PRK08576        357 ETD-----------F-GKIL--VVMPLKFWSGAMVQLYILMNGIELNPLYYEGFYRLG-CYV  403 (439)
T ss_pred             CCC-----------C-CCCE--EEECHHHCCHHHHHHHHHHCCCCCCHHHHCCCCCCC-EEE
T ss_conf             477-----------7-7726--672343076999999999759999847874773244-330


No 72 
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing); InterPro: IPR006426   These sequences represent glutamine-hydrolysing asparagine synthase. The group have a poorly conserved C-terminal extension while bacterial members of the family tend to have a long, poorly conserved insert lacking from archaeal and eukaryotic sequences. Multiple isozymes have been demonstrated, such as in Bacillus subtilis .; GO: 0004066 asparagine synthase (glutamine-hydrolyzing) activity, 0006529 asparagine biosynthetic process.
Probab=98.20  E-value=7.5e-06  Score=62.39  Aligned_cols=119  Identities=26%  Similarity=0.286  Sum_probs=79.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-C-------CEEEEEEEECC-CCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             3388999960985799999999886-9-------84999998704-7876655557788189999999999980995898
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-G-------YDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G-------~~V~g~~m~~~-~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      -+..|-+-||||||||+.|.++++. .       ..|..+.+.+- +..+..+.  .---.+|---|++||++||+.|+.
T Consensus       310 aDvpvG~~LSGGlDSS~vaa~a~~~~~~~~~~W~~~~~tFsigf~~~~~~~~Es--~l~P~~D~P~A~~vA~~~G~~h~~  387 (646)
T TIGR01536       310 ADVPVGVLLSGGLDSSLVAAIARREAPSEGVDWKGPVKTFSIGFEGDSKDFDES--KLRPDDDQPYARKVADELGTEHHE  387 (646)
T ss_pred             CCCCEEEEEECHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCEEC--CCCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             056068887171679999999999767643311774347886517787653002--578998618999999984983248


Q ss_pred             CCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHH--HHHHHCCC-CCCEECCCC
Q ss_conf             170788663224411267870886120000154110588--88874016-876452253
Q gi|254780151|r   90 FDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD--LLSVTRQL-GADVLATGH  145 (408)
Q Consensus        90 ~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~--l~~~a~~~-g~~~iATGH  145 (408)
                      +.|+.+   ++++.+-+--..=.|++|-..=  -+ ++.  +.+.|++. |..-+-+|-
T Consensus       388 ~~~s~~---e~~~~l~~v~~~~e~y~p~~~~--~~-~P~Yl~s~~ar~~Tg~kV~LSGe  440 (646)
T TIGR01536       388 VLISEE---EVLKALPEVIYHLETYDPTAIR--AS-IPLYLLSKLAREDTGVKVVLSGE  440 (646)
T ss_pred             EEECHH---HHHHHHHHHHHHHCCCCCCCCC--HH-HHHHHHHHHHHHCCCCEEEECCC
T ss_conf             984589---9999988876542488543031--12-35899999999628838997486


No 73 
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism]
Probab=98.07  E-value=1.7e-05  Score=59.89  Aligned_cols=110  Identities=25%  Similarity=0.257  Sum_probs=68.2

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCC-CEEEE-EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH-H
Q ss_conf             3889999609857999999998869-84999-9987047876655557788189999999999980995898170788-6
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDG-YDVIG-VTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER-F   96 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G-~~V~g-~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~-f   96 (408)
                      +-.|.+.+|||||||+.|+++.+.. ..... +++.+++.+           ..|..-|+.+|+.||.+|+.+.+..+ +
T Consensus       230 dvpvg~~lSGGlDSS~Iaa~a~~~~~~~~~~~fsvg~~~~~-----------~~D~~~a~~~A~~lg~~h~~~~~~~~e~  298 (542)
T COG0367         230 DVPVGVFLSGGLDSSLIAAIAAEELGKEGKTTFTVGFEDSD-----------SPDAKYARAVAKFLGTPHHEIILTNEEL  298 (542)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHCCCCCEEEEEECCCCC-----------CCHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             88789996776229999999998623455215898548999-----------7079999999998599857996178999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             632244112678708861200001541105888887401687645225311
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      ...    +-+--..=.+|++.-.|   +=+=.+.+.|++.|..-+-+|.=|
T Consensus       299 ~~~----~~~vv~~~~~p~~~~~~---~ply~~~~~a~~~g~kVvLSGeGA  342 (542)
T COG0367         299 LNA----LPEVVKALDTPGGMAAS---IPLYLLSRKARAEGEKVVLSGEGA  342 (542)
T ss_pred             HHH----HHHHHHHHCCCCCCHHH---HHHHHHHHHHHHCCCEEEECCCCH
T ss_conf             999----99999870788620045---799999987653387898238748


No 74 
>KOG2840 consensus
Probab=98.01  E-value=1.8e-05  Score=59.69  Aligned_cols=123  Identities=22%  Similarity=0.323  Sum_probs=83.5

Q ss_pred             CCCCCCCCCCEEEEEECCCHHHHHHHHHHHH----CCCEEEEEEEECCCCCCCCCCCCCCCCHHH-HHHHHHHHHHCCCC
Q ss_conf             4678886338899996098579999999988----698499999870478766555577881899-99999999980995
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGVDSSVVAALLKR----DGYDVIGVTLQLYNSRKASKRKGSCCAGQD-VYDARRVCDTINVS   86 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d-~~~a~~va~~LgI~   86 (408)
                      +..+.-..+.+|.+|-|||.||+|+|+.+..    ..|++.-+-+.+ +       ++.-...+| +.-+++...+.+||
T Consensus        43 ~~n~l~~rge~v~igasGgkdstvlA~v~~~Ln~r~~~g~~l~Lls~-d-------egi~gyrd~sl~avkrn~~~~~lP  114 (347)
T KOG2840          43 VANKLFARGERVAIGASGGKDSTVLAYVLDALNERHDYGLRLFLLSI-D-------EGIRGYRDDSLEAVKRNGVQYGLP  114 (347)
T ss_pred             HHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEC-C-------CCCCCEECCHHHHHHHHHHHCCCC
T ss_conf             70686678883132555660277999999984030178841342101-0-------036420042999999861420786


Q ss_pred             EEECCHHHHHH----HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             89817078866----322441126787088612000015411058888874016876452253110
Q gi|254780151|r   87 HYVFDYEERFR----NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        87 ~~~~d~~~~f~----~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                      +.++.+++-|.    +.|+.--..     ..-|-|+.|- ..++.+|-+-|+.+|++.++|||-|.
T Consensus       115 L~ivs~~dl~~~~tmd~i~~~i~~-----~~rn~ctfCg-v~RrqaL~~ga~~l~~~~~~tghnaD  174 (347)
T KOG2840         115 LCIVSYKDLYGEWTMDEIVSEIGQ-----EIRNNCTFCG-VFRRQALDRGADVLGAAELVTGHNAD  174 (347)
T ss_pred             EEEECHHHHHCCCHHHHHHHHHHH-----HHCCCCEEEC-HHHHHHHHHHCCCCCHHHHHHCCCCH
T ss_conf             388419997250208889999866-----2304604511-89888887202213414553022306


No 75 
>PTZ00077 asparagine synthetase; Provisional
Probab=97.99  E-value=5.3e-05  Score=56.29  Aligned_cols=123  Identities=20%  Similarity=0.232  Sum_probs=63.4

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHC-----CCEEEE-----------EEEECCCCC-CC--C-C------CCC---CCCCH
Q ss_conf             388999960985799999999886-----984999-----------998704787-66--5-5------557---78818
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRD-----GYDVIG-----------VTLQLYNSR-KA--S-K------RKG---SCCAG   70 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~-----G~~V~g-----------~~m~~~~~~-~~--~-~------~~~---~c~~~   70 (408)
                      +-.|-+-||||+|||+.|+|+++.     +....+           .....+..+ ..  . .      ...   .-...
T Consensus       237 DVPvG~lLSGGLDSSlIaAia~k~l~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~l~tFsIGl~gs  316 (610)
T PTZ00077        237 DVPFGILLSGGLDSSIIAAILAKHLKIIDGEGGGGIQGGGAAAAHNAAHEANNNNGEDNCGNNNADPCHLKSFSIGLKGS  316 (610)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEECCCC
T ss_conf             67236663477058999999998654201112222224432100011111244443221235666744422688625898


Q ss_pred             HHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEE-CCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             999999999998099589817078866322441126787088612000-01541105888887401687645225311
Q gi|254780151|r   71 QDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCV-DCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        71 ~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~-~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      .|+..|++||++||..||.+.+..+   +.++.+-+.--.-.|+.|.. +.  .+=.=.|-+++++.|...+-||-=|
T Consensus       317 pDl~~Ar~vA~~lGt~Hhe~~~t~e---e~ldal~dvIy~lEtyd~ttirA--s~pmYLlsr~ik~~gvKVvLSGEGA  389 (610)
T PTZ00077        317 PDLKAAKEVAEFLGIEHTEFHFTVE---EGIDSLHDVIYHIETYDITTIRA--STPMYILSRLIKSSCVKMVLSGEGA  389 (610)
T ss_pred             CHHHHHHHHHHHHCCCCEEEEECHH---HHHHHHHHHHHHCCCCCCCCCCH--HHHHHHHHHHHHHCCCEEEECCCCC
T ss_conf             2489999999983883459997779---99877576652125667554210--3589999999986498899538874


No 76 
>TIGR00289 TIGR00289 conserved hypothetical protein TIGR00289; InterPro: IPR005237   This family of conserved hypothetical proteins has no known function. Homologous proteins related to MJ0570 of Methanococcus jannaschii include both the apparent orthologs in the family, the much longer protein YLR143W from Saccharomyces cerevisiae (Baker's yeast), and second homologous proteins from Archaeoglobus fulgidus and Pyrococcus horikoshii that appear to represent a second orthologous group..
Probab=97.99  E-value=2.4e-05  Score=58.78  Aligned_cols=97  Identities=16%  Similarity=0.184  Sum_probs=64.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      |||+|..|||.||.+|++-..+.|+||.-+.=-+-+..++-+.     .--.+....-+|+.+|||+...     |-.-+
T Consensus         1 MkvAvLySGGKDS~~ALy~al~eG~eV~~LV~v~seN~eSyMf-----H~pN~Hl~~l~AEavGiPL~kl-----yt~Ge   70 (227)
T TIGR00289         1 MKVAVLYSGGKDSILALYKALEEGFEVKYLVGVISENEESYMF-----HVPNVHLTDLVAEAVGIPLIKL-----YTSGE   70 (227)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCEE-----ECHHHHHHHHHHHHCCCCHHHH-----HCCCC
T ss_conf             9068985187136899999986288547851000288986205-----3425789999997617662563-----02786


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             441126787088612000015411058888874016876452253
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      =+.=+++.+                  .-++..++.|++.|.||=
T Consensus        71 eEkEVedLa------------------g~l~~lderGvea~~~Ga   97 (227)
T TIGR00289        71 EEKEVEDLA------------------GQLEELDERGVEAVVIGA   97 (227)
T ss_pred             CCCHHHHHH------------------HHHHHHHHCCCCEEEECC
T ss_conf             521176662------------------155445530545478853


No 77 
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional
Probab=97.98  E-value=0.00012  Score=53.70  Aligned_cols=164  Identities=17%  Similarity=0.163  Sum_probs=106.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCE-EE---EEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             88999960985799999999886984-99---999870478766555577881899999999999809958981707886
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYD-VI---GVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~-V~---g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .+.++..|||.||+|.++|.+++-|- -+   -+|+.           ..+-..+-++--.++++.+|+.+.+..-.+  
T Consensus        27 ~~pvmL~S~GKDS~VmLhLarKAF~p~~iPfPllHID-----------Tg~kF~Emi~fRD~~a~e~gl~LiV~~n~e--   93 (300)
T PRK05253         27 ENPVMLYSIGKDSSVMLHLARKAFYPGKLPFPLLHVD-----------TGWKFPEMIEFRDRRAKELGLELIVHSNPE--   93 (300)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEE-----------CCCCHHHHHHHHHHHHHHHCCCEEEEECHH--
T ss_conf             6967987167259999999999857889996348830-----------799818999999999998499789975767--


Q ss_pred             HHHCCCCCHHHHHCCCCCC--CEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCC-----C
Q ss_conf             6322441126787088612--00001541105888887401687645225311025412678773168853157-----8
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPL--PCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMD-----L  169 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPN--Pc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D-----~  169 (408)
                                +..+|..|-  .-..|+..+|-.+|.+..++.++|.+.+|  ||--.   .....+-.+....|     -
T Consensus        94 ----------~i~~g~~p~~~g~~~~~~~lKT~~L~~al~~~~fda~~gG--aRRDE---e~sRAKERiFS~R~~~~~Wd  158 (300)
T PRK05253         94 ----------GIARGINPFTHGSAKHTNIMKTEGLKQALEKYGFDAAFGG--ARRDE---EKSRAKERIFSFRDEFGQWD  158 (300)
T ss_pred             ----------HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEC--CCCCC---CCCCCCCCCCCCCCCCCCCC
T ss_conf             ----------7756999566882223157878999999996487656510--12344---32121254247756468888


Q ss_pred             CCCCEEEEEEECCHHH----CEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             7873189863020221----003342568997898999974125435
Q gi|254780151|r  170 ERDQSYFLFATTQQQL----CDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       170 ~KDQSYfL~~l~~~~L----~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .|+|-==||.+=...+    .--+|||-++|--+|=+.-+..+||+.
T Consensus       159 pk~QrPElW~lyn~~~~~geh~RVfPlsnWTElDIW~YI~~E~Ipi~  205 (300)
T PRK05253        159 PKNQRPELWNLYNGRINKGEHIRVFPLSNWTELDIWQYIYRENIPIV  205 (300)
T ss_pred             CCCCCCHHHHHHCCCCCCCCEEEEECCCCCHHHHHHHHHHHHCCCCC
T ss_conf             56698026676355679996477511202257789999998488888


No 78 
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1. The predicted protein-sorting transpeptidase that we call exosortase (see TIGR02602) has distinct subclasses that associated with different types of exopolysaccharide production loci. This model represents a distinct clade among a set of amidotransferases largely annotated (not necessarily accurately) as glutatime-hydrolyzing asparagine synthases. Members of this clade are essentially restricted to the characteristic exopolysaccharide (EPS) regions that contain the exosortase 1 genome (xrtA), in genomes that also have numbers of PEP-CTERM domain (TIGR02595) proteins.
Probab=97.95  E-value=4.2e-05  Score=57.04  Aligned_cols=110  Identities=22%  Similarity=0.226  Sum_probs=65.0

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             3889999609857999999998869-849999987047876655557788189999999999980995898170788663
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +-.|.+-||||+|||+.++++.+.+ ..+..+++.+-+ .          ..++...|+++|+++|++|+.+.+..+-. 
T Consensus       258 DVpvG~~LSGGlDSS~I~a~~~~~~~~~i~tfsi~f~~-~----------~~DE~~~A~~vA~~~g~~h~~~~~~~~~~-  325 (628)
T TIGR03108       258 DVPLGAFLSGGVDSSAVVALMAGLSDTPVNTCSIAFDD-P----------AFDESAYARQVAERYGTNHRVETVDPDDF-  325 (628)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEECCC-C----------CCCHHHHHHHHHHHHCCCCEEEECCHHHH-
T ss_conf             88568764688636899999998429986436653488-8----------75436999999986087647997798999-


Q ss_pred             HCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             22441126787088612000015411058888874016876452253110
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                      ..++.++..+  + .|-.+..+   +-.-.+.+.|++ +...+-||+-|.
T Consensus       326 ~~~~~~~~~~--d-eP~~d~s~---i~~~~l~~~a~~-~vkV~LsG~GgD  368 (628)
T TIGR03108       326 SLVDRLAGLY--D-EPFADSSA---LPTYRVCELARK-RVTVALSGDGGD  368 (628)
T ss_pred             HHHHHHHHHH--C-CCCCCHHH---HHHHHHHHHHHC-CCEEEEECCCCC
T ss_conf             8799999984--6-88666789---999999999864-974999667754


No 79 
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase. Members of this protein family are closely related to several isoforms of asparagine synthetase (glutamine amidotransferase) and typically have been given this name in genome annotation to date. Each is part of a conserved three-gene cassette sparsely distributed across at least twenty different species known so far, including alpha, beta, and gamma Proteobacteria, Mycobacterium, and Prosthecochloris, which is a member of the Chlorobi. The other two members of the cassette are a probable protease and a member of the GNAT family of acetyltransferases.
Probab=97.94  E-value=2.6e-05  Score=58.54  Aligned_cols=110  Identities=21%  Similarity=0.343  Sum_probs=63.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH-HHHH
Q ss_conf             38899996098579999999988698-499999870478766555577881899999999999809958981707-8866
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE-ERFR   97 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~-~~f~   97 (408)
                      +-.|-+.||||+|||+.++++.+.+. ++..+++.+-+.+..        ..++...|+++|+++|.+|+.+.+. ++|.
T Consensus       260 Dvpvg~~LSGGlDSS~i~a~~~~~~~~~i~tfs~~f~~~~~~--------~~dE~~~a~~va~~~~~~h~~~~~~~~~~~  331 (589)
T TIGR03104       260 DVPVGVLLSGGLDSSLIVGLLAEAGVDGLRTFSIGFEDVGGE--------KGDEFEYSDIIAERFHTRHHKIRIPNHRVL  331 (589)
T ss_pred             CCCCCEECCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCC--------CCCHHHHHHHHHHHHCCCCEEEEECCHHHH
T ss_conf             676300017875438999999995699985278872468877--------666799999999973878579995717899


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             322441126787088612000015411058888874016876452253
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      + .++.++..+   -.|..+..|   +-+-.|.+.|.+ +..-+-||+
T Consensus       332 ~-~l~~~~~~~---deP~~~~~~---~~~~~l~~~~~~-~~kV~LsG~  371 (589)
T TIGR03104       332 P-ALPEAVAAM---SEPMVSHDC---VAFYLLSEEVSK-HVKVVQSGQ  371 (589)
T ss_pred             H-HHHHHHHCC---CCCCCCCHH---HHHHHHHHHHCC-CCEEEEEEE
T ss_conf             9-889988526---898768306---889999987328-836999520


No 80 
>PRK09431 asnB asparagine synthetase B; Provisional
Probab=97.91  E-value=3.7e-05  Score=57.40  Aligned_cols=122  Identities=18%  Similarity=0.166  Sum_probs=62.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCE-EEEEEE-ECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             388999960985799999999886984-999998-704787665555778818999999999998099589817078866
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYD-VIGVTL-QLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~-V~g~~m-~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      +-.|.+.||||+|||+.|+|+++..-. +..... ..+...-..-.-|.- ...|...|++||++||..|+.+.+..+--
T Consensus       227 DvpvG~~LSGGLDSSlIaala~k~~~~~~~~~~~~~~~~~~l~tFsiG~~-~s~D~~~Ar~vA~~lgt~h~ei~~t~~d~  305 (555)
T PRK09431        227 DVPYGVLLSGGLDSSLISAIAKKYAARRIEDDERSEAWWPQLHSFAVGLE-GSPDLKAAREVADYLGTVHHEIHFTVQEG  305 (555)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECCC-CCCHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             88624320577067999999998520244332222234678753660479-98149999999998299565999547999


Q ss_pred             HHCCCCCHHHHHCCCCCCCEE-CCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             322441126787088612000-01541105888887401687645225311
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCV-DCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~-~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      .+.+...+..   -.|+.|-. .+  .+-.=.|.+++++.|+..+-||.=|
T Consensus       306 ~~~l~~vi~~---lE~~d~~~~~a--sip~yllsk~i~~~gvKVvLSGeGA  351 (555)
T PRK09431        306 LDALRDVIYH---LETYDVTTIRA--STPMYLMSRKIKAMGIKMVLSGEGA  351 (555)
T ss_pred             HHHHHHHHHH---HHCCCCCCHHH--HHHHHHHHHHHHHCCCEEEEECCCH
T ss_conf             9999999987---41468750256--8999999999996398799927750


No 81 
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional
Probab=97.87  E-value=0.00028  Score=51.13  Aligned_cols=164  Identities=16%  Similarity=0.114  Sum_probs=107.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCC-EEE---EEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             8899996098579999999988698-499---999870478766555577881899999999999809958981707886
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGY-DVI---GVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~-~V~---g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .+.++..|||.||+|.++|.+++-| --+   -+|+.           ..+-..+-++--.++++.+|+.+.+....+  
T Consensus        38 ~~pvmL~S~GKDS~VmlhLA~KAF~p~~iPfPllHID-----------Tg~kF~Emi~fRD~~a~~~~l~LiV~~n~~--  104 (312)
T PRK12563         38 SKPVMLYSIGKDSSVMLHLAMKAFRPTRPPFPLLHVD-----------TTWKFREMIDFRDRRAKELGLDLVVHHNPD--  104 (312)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCEEEEE-----------CCCCHHHHHHHHHHHHHHHCCEEEEECCHH--
T ss_conf             6967986167429999999999737789997358863-----------688759999999999998198689832878--


Q ss_pred             HHHCCCCCHHHHHCCCCCCC--EECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCC-----C
Q ss_conf             63224411267870886120--0001541105888887401687645225311025412678773168853157-----8
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLP--CVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMD-----L  169 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNP--c~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D-----~  169 (408)
                                +..+|.+|-+  -..|+..+|-.+|.+..++.++|.+-.|  ||--.   .....+-......|     -
T Consensus       105 ----------~i~~g~~p~~~~~~~~~~~lKT~~L~~ale~~~fDa~~gG--aRRDE---EksRAKERiFS~Rd~~~~WD  169 (312)
T PRK12563        105 ----------GIARGIVPFRHGSALHTDVAKTQGLKQALDHHGFDAAIGG--ARRDE---EKSRAKERIFSFRSAFHRWD  169 (312)
T ss_pred             ----------HHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEC--CCCCC---CCCCCCCEEECCCCCCCCCC
T ss_conf             ----------8866999676783777668988999999997398878504--53213---42344340306667788988


Q ss_pred             CCCCEEEEEEECCHHHCE----EECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             787318986302022100----3342568997898999974125435
Q gi|254780151|r  170 ERDQSYFLFATTQQQLCD----LRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       170 ~KDQSYfL~~l~~~~L~~----~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .|+|-==||.+=...+..    -+|||-++|--+|=+.-...+||+.
T Consensus       170 PknQrPElWnlyN~~~~~Geh~RVfPlsNWTElDIW~YI~~E~Ipi~  216 (312)
T PRK12563        170 PKAQRPELWSLYNARLRRGESLRVFPLSNWTELDVWQYIAREKIPLV  216 (312)
T ss_pred             CCCCCHHHHHHHCCCCCCCCEEEECCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             55588358776155679997144223556617899999998288988


No 82 
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily  including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF). The domain forms a apha/beta/apha fold which  binds to Adenosine nucleotide.
Probab=97.58  E-value=8.6e-05  Score=54.81  Aligned_cols=57  Identities=37%  Similarity=0.532  Sum_probs=44.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHC---CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             999960985799999999886---98499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRD---GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~---G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      |+|++|||+||++++.++++.   +.++..+.+.                                              
T Consensus         1 ilv~~Sgg~dS~~~~~la~~~~~~~~~~~~~~~~----------------------------------------------   34 (86)
T cd01984           1 ILVALSGGLDSSVLLHLAKRLKSGGPEVVALVVV----------------------------------------------   34 (86)
T ss_pred             CEEEECCCCCHHHHHHHHHHHHCCCCEEEEEEHH----------------------------------------------
T ss_conf             9788617853899999999852599808976389----------------------------------------------


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCE
Q ss_conf             24411267870886120000154110588888740168764522531102
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRS  149 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~  149 (408)
                                         .|     ...+.+.+.++|++.|++||++.-
T Consensus        35 -------------------~~-----~~~~~~~~~~~~~~~i~~G~~~~~   60 (86)
T cd01984          35 -------------------AF-----VRILKRLAAEEGADVIILGHNADD   60 (86)
T ss_pred             -------------------HH-----HHHHHHHHHHCCCCEEEECCCCHH
T ss_conf             -------------------99-----999999877608988998677324


No 83 
>KOG0571 consensus
Probab=97.19  E-value=0.0014  Score=46.24  Aligned_cols=108  Identities=23%  Similarity=0.336  Sum_probs=63.2

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHH----HH----CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             63388999960985799999999----88----69849999987047876655557788189999999999980995898
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALL----KR----DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL----~~----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      ..+-.+-|.||||.|||+.|.++    ++    .|-.++.+-+-+-             ..-|+..||+||+.||++||.
T Consensus       223 M~d~p~GvLLSGGLDSSLvAsia~R~lk~~~~~~~~~lhsFaIGle-------------~SPDL~aarkVAd~igt~Hhe  289 (543)
T KOG0571         223 MTDVPFGVLLSGGLDSSLVASIAARELKKAQAARGSKLHSFAIGLE-------------DSPDLLAARKVADFIGTIHHE  289 (543)
T ss_pred             HCCCCEEEEEECCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEECCC-------------CCHHHHHHHHHHHHHCCCCEE
T ss_conf             3168615895077318999999999998766412787547885289-------------985378889999874885238


Q ss_pred             CCHHHHHHHHCCC---CCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             1707886632244---1126787088612000015411058888874016876452253
Q gi|254780151|r   90 FDYEERFRNAVIV---PFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus        90 ~d~~~~f~~~V~~---~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      +-|+-+=--+.++   +-+++|--     --|+|-.-+  =.|-++.+++|..-|-.|.
T Consensus       290 ~~ft~qegidal~eVI~hLETYDv-----ttIRastpm--yLlsr~Ikk~gvkmvlSGE  341 (543)
T KOG0571         290 HTFTIQEGIDALDEVIYHLETYDV-----TTIRASTPM--YLLSRKIKKLGVKMVLSGE  341 (543)
T ss_pred             EEECHHHHHHHHHHHHEEEECCCC-----CEEECCCCH--HHHHHHHHHCCEEEEEECC
T ss_conf             997588877788877424101344-----158617746--7899999765528998157


No 84 
>pfam02677 DUF208 Uncharacterized BCR, COG1636.
Probab=97.17  E-value=0.0016  Score=45.70  Aligned_cols=105  Identities=15%  Similarity=0.245  Sum_probs=67.2

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCC
Q ss_conf             99960985799999999886984999998704787665555778818999999999998099589817078866322441
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVP  103 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~  103 (408)
                      ++-..=|.+|+...-.|++.|++|++.|.   +++-....+    ...-.+++++.|+.+|||+..-+...+=|      
T Consensus         2 LLH~CCaPCs~~~l~~L~~~g~~vt~~Fy---NPNIhP~~E----y~~R~~~~~~~~~~~~i~~i~~~Yd~~~~------   68 (176)
T pfam02677         2 LLHICCAPCSSYPLEYLREYGFEVTGFFY---NPNIHPYSE----YLRRLEEVKRFAEKLGIPLIEGDYDPEEW------   68 (176)
T ss_pred             EEEECCCCCCHHHHHHHHHCCCCEEEEEE---CCCCCCHHH----HHHHHHHHHHHHHHCCCCEEECCCCHHHH------
T ss_conf             22501878607999999984983699877---999997899----99999999999998599379568885999------


Q ss_pred             CHHHHHCCCCCC-----CEECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             126787088612-----00001541105888887401687645225
Q gi|254780151|r  104 FASSYAAGETPL-----PCVDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       104 ~~~~y~~G~TPN-----Pc~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                       ++ -.+|+--.     -|..|=. +....-..+|+++|+|++.|-
T Consensus        69 -~~-~v~g~e~epE~g~RC~~Cy~-~RL~~tA~~A~e~gfd~ftTT  111 (176)
T pfam02677        69 -LE-RVKGLEDEPEGGKRCTYCYD-MRLEETAQYAKEHGFDAFTTT  111 (176)
T ss_pred             -HH-HHHCCCCCCCCCCHHHHHHH-HHHHHHHHHHHHCCCCEEECC
T ss_conf             -99-98445558888871599999-999999999998599999764


No 85 
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional
Probab=96.70  E-value=0.027  Score=36.98  Aligned_cols=159  Identities=18%  Similarity=0.113  Sum_probs=97.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC--HHHHHHH
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817--0788663
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD--YEERFRN   98 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d--~~~~f~~   98 (408)
                      .+++++-|-|.+|+|.+.|+.+.+-++--+|+.+.-           -..+-++.+.++.+++|++++++-  .+.. +.
T Consensus        42 ~~~~~tsSFG~es~Vllhli~~~~~~ipV~flDTG~-----------~f~ETy~~~d~l~~~~~l~i~~~~P~~~~~-~~  109 (243)
T PRK02090         42 GGLALASSFGAESAVLLHLVAQVDPDIPVIFLDTGY-----------LFPETYRFIDQLTERLLLNLKVYRPDASAA-EQ  109 (243)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECCC-----------CCHHHHHHHHHHHHHHCCCEEEECCCCHHH-HH
T ss_conf             976999458678999999999419999679865798-----------888999999999999799779977881499-99


Q ss_pred             HCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEE
Q ss_conf             22441126787088612000015411058888874016876452253110254126787731688531578787318986
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLF  178 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~  178 (408)
                      .+...-+  +. --..+|+ .|....|..-|-.....+.+  -.||=    +-..+   ..|..|-           ++.
T Consensus       110 ~~~~g~l--~~-~~~~d~~-~CC~irKvePL~raL~~~da--WitG~----Rr~Qs---~~Ra~l~-----------~ve  165 (243)
T PRK02090        110 EARYGGL--WE-QSVEDPD-ECCRIRKVEPLNRALAGLDA--WITGL----RREQS---GTRAELP-----------VLE  165 (243)
T ss_pred             HHHHCCC--CC-CCCCCHH-HHHHHHCCHHHHHHHHHCCE--EEECC----CHHHC---HHHCCCC-----------CEE
T ss_conf             9982997--66-7632489-87677650279998601775--87447----14426---3342587-----------345


Q ss_pred             EECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCC
Q ss_conf             30202210033425689978989999741254355111023
Q gi|254780151|r  179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQD  219 (408)
Q Consensus       179 ~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqg  219 (408)
                      . ....+  -+-||-++++.||-...++.+||.- .--+||
T Consensus       166 ~-d~g~~--KvnPL~~Ws~~dv~~Yi~~~~LP~n-pL~~~G  202 (243)
T PRK02090        166 I-DRGRF--KINPLADWTNEDVWAYLKEHDLPYH-PLVDQG  202 (243)
T ss_pred             E-CCCEE--EECCCHHCCHHHHHHHHHHCCCCCC-CHHHCC
T ss_conf             2-39988--8670011999999999998599988-324459


No 86 
>COG1636 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=96.43  E-value=0.028  Score=36.85  Aligned_cols=110  Identities=17%  Similarity=0.241  Sum_probs=75.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH-HH-H
Q ss_conf             338899996098579999999988698499999870478766555577881899999999999809958981707-88-6
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE-ER-F   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~-~~-f   96 (408)
                      +..||++-..=.+||....--|.+.|.+.++.|-   +++-....+    .+.-..+..+.|+++||++.--|.+ .+ |
T Consensus         2 ~~~kiLlH~CCAPcs~y~le~l~~~~~~i~~yFY---NPNIhP~~E----Y~~R~~e~~~f~~~~~i~~iegdY~~~~~w   74 (204)
T COG1636           2 GRPKLLLHSCCAPCSGYVLEKLRDSGIKITIYFY---NPNIHPLSE----YELRKEEVKRFAEKFGINFIEGDYEDLEKW   74 (204)
T ss_pred             CCCEEEEEEECCCCCHHHHHHHHHCCCCEEEEEE---CCCCCCHHH----HHHHHHHHHHHHHHCCCEEEECCCCCHHHH
T ss_conf             9870789862577718999999965866699974---899892699----999999999999982970553575558999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHH----HHCCCCCCEECCC
Q ss_conf             63224411267870886120000154110588888----7401687645225
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS----VTRQLGADVLATG  144 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~----~a~~~g~~~iATG  144 (408)
                      -+. +..+-++=..|.   -|.+|     |+..++    +|.++|++++.|-
T Consensus        75 ~~~-vKg~E~EpE~G~---RC~~C-----fd~Rle~tA~~A~e~G~d~fttt  117 (204)
T COG1636          75 FER-VKGMEDEPEGGK---RCTMC-----FDMRLEKTAKKAKELGFDVFTTT  117 (204)
T ss_pred             HHH-HHCCHHCCCCCC---HHHHH-----HHHHHHHHHHHHHHCCCCHHHHH
T ss_conf             999-616200777784---23778-----99989999999998296210121


No 87 
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC. Members of this protein family are the DndC protein from the dnd (degradation during electrophoresis) operon. The dnd phenotype reflects a sulfur-containing modification to DNA. This operon is sparsely and sporadically distributed among bactera; among the first eight examples are members from the Actinobacteria, Firmicutes, Gammaproteobacteria, Cyanobacteria. DndC is suggested to be a sulfurtransferase.
Probab=95.60  E-value=0.032  Score=36.39  Aligned_cols=113  Identities=17%  Similarity=0.180  Sum_probs=65.0

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-------C--CEEEEEEEECCCCCCCCCCCCC-CCCHHHHHHHHHHHHHCCCCEEEC-
Q ss_conf             8999960985799999999886-------9--8499999870478766555577-881899999999999809958981-
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-------G--YDVIGVTLQLYNSRKASKRKGS-CCAGQDVYDARRVCDTINVSHYVF-   90 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-------G--~~V~g~~m~~~~~~~~~~~~~~-c~~~~d~~~a~~va~~LgI~~~~~-   90 (408)
                      --+||+|||.||++.+.|+-.+       +  -.|.-++     .+-..+.+-- -...+.++..++-|+..++|+.+. 
T Consensus        15 PWvIGySGGKDSTavLqLvw~Al~~Lp~e~r~K~v~VIs-----sDTlVEnP~V~~~v~~~L~~i~~~a~~~~LPi~~~~   89 (447)
T TIGR03183        15 PWVIGYSGGKDSTAVLQLVWNALSELPPEQRTKKIHVIS-----TDTLVENPIVAAWVNVSLERMQEAAQKQGLPIEPHR   89 (447)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHHHCCHHHCCCCEEEEE-----CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             879975877399999999999998478875768889997-----998755779999999999999999997499823689


Q ss_pred             ---CHHHHHHHHCCCCCHHHHHCCCCCCC-EECCCCEEEHHHH----HHHHCCCCCCEECCCC
Q ss_conf             ---70788663224411267870886120-0001541105888----8874016876452253
Q gi|254780151|r   91 ---DYEERFRNAVIVPFASSYAAGETPLP-CVDCNRTVKFSDL----LSVTRQLGADVLATGH  145 (408)
Q Consensus        91 ---d~~~~f~~~V~~~~~~~y~~G~TPNP-c~~CN~~iKF~~l----~~~a~~~g~~~iATGH  145 (408)
                         ++.+.||-.++..   +|-   +||+ =-.|-.++|..-.    .+...+.|---+.-|-
T Consensus        90 ~~P~~~dtFWvnlIGr---GYP---aP~~~FRWCTdrLKI~P~~~fi~~~v~~~ge~ilvLGt  146 (447)
T TIGR03183        90 LTPAIEDTFWVNLIGK---GYP---APRQKFRWCTDRLKISPSNTFIRDKVAANGEVILVLGT  146 (447)
T ss_pred             ECCCCCCCHHHHHCCC---CCC---CCCCCCCCCCHHHHCCHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             3378544300010346---307---99987652557663682899999865214968999956


No 88 
>KOG2316 consensus
Probab=95.50  E-value=0.051  Score=34.94  Aligned_cols=73  Identities=21%  Similarity=0.186  Sum_probs=44.4

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCH-HHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             88999960985799999999886984999998704787665555778818-999999999998099589817078
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAG-QDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~-~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      |||+...|||.||..+..-+.+.||+++++- .++..++....-.+-... -.-.-+.-.++-+++|++.-..+-
T Consensus         1 MrvvaLiSGGKDScynmm~cv~~gHeiVaLa-nl~p~~d~~delDSyMyQtVGh~~i~lyaecm~lPlyrr~i~g   74 (277)
T KOG2316           1 MRVVALISGGKDSCYNMMCCVRLGHEIVALA-NLHPKEDESDELDSYMYQTVGHDVIDLYAECMGLPLYRRRIRG   74 (277)
T ss_pred             CCEEEEEECCHHHHHHHHHHHHCCCEEEEEE-CCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEECCC
T ss_conf             9189997178078999999998487435643-2468755520577889886027789999998468346642148


No 89 
>PRK06850 hypothetical protein; Provisional
Probab=95.39  E-value=0.043  Score=35.49  Aligned_cols=112  Identities=15%  Similarity=0.202  Sum_probs=64.3

Q ss_pred             EEEEEECCCHHHHHHHHHHHH--------C-CCEEEEEEEECCCCCCCCCCCCC-CCCHHHHHHHHHHHHHCCCCEEEC-
Q ss_conf             899996098579999999988--------6-98499999870478766555577-881899999999999809958981-
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKR--------D-GYDVIGVTLQLYNSRKASKRKGS-CCAGQDVYDARRVCDTINVSHYVF-   90 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~--------~-G~~V~g~~m~~~~~~~~~~~~~~-c~~~~d~~~a~~va~~LgI~~~~~-   90 (408)
                      --+||+|||.||++.+-|.=.        + --.|.-++     .+-..+.+-- -.-.+.++..+.-|+..++|+.+. 
T Consensus        23 PWvIGySGGKDSTavLqLvw~Al~~Lp~e~r~K~v~VIs-----sDTlVEnPiV~~~v~~sL~~i~~~A~~~~LPI~~~~   97 (488)
T PRK06850         23 PWVIGYSGGKDSTAVLQLVWNALAGLPPEKRHKPVYVIS-----TDTLVENPVVVAWVNKSLERIKEAAKKQGLPITPHK   97 (488)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHHHCCHHHCCCCEEEEE-----CCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEEE
T ss_conf             879975877199999999999998378876689889995-----898756779999999999999999986599822688


Q ss_pred             ---CHHHHHHHHCCCCCHHHHHCCCCCCC-EECCCCEEEHHHH----HHHHCCCCCCEECCC
Q ss_conf             ---70788663224411267870886120-0001541105888----887401687645225
Q gi|254780151|r   91 ---DYEERFRNAVIVPFASSYAAGETPLP-CVDCNRTVKFSDL----LSVTRQLGADVLATG  144 (408)
Q Consensus        91 ---d~~~~f~~~V~~~~~~~y~~G~TPNP-c~~CN~~iKF~~l----~~~a~~~g~~~iATG  144 (408)
                         ++.+.||-.++..   +|-   +||+ =-.|--++|..-.    .+...+.|---+.-|
T Consensus        98 v~P~~~dtFWvnlIGr---GYP---aP~~~FRWCTdRLKI~P~~rFI~~~v~~~ge~IlvLG  153 (488)
T PRK06850         98 LTPKVKDTFWVNLIGK---GYP---APRRKFRWCTERLKINPSNDFIRDKVSAFGEVIVVLG  153 (488)
T ss_pred             ECCCCCCCHHHHHCCC---CCC---CCCCCCCCCCHHHHCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             1488654433542047---679---9987665475665148489999999875397899985


No 90 
>KOG0573 consensus
Probab=95.34  E-value=0.049  Score=35.08  Aligned_cols=70  Identities=21%  Similarity=0.283  Sum_probs=38.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHH-----CCCEEEEEEEECCCCCCCCCCCCCCC----CHHHHHHHHHHHHHCCCCEEE
Q ss_conf             338899996098579999999988-----69849999987047876655557788----189999999999980995898
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKR-----DGYDVIGVTLQLYNSRKASKRKGSCC----AGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~-----~G~~V~g~~m~~~~~~~~~~~~~~c~----~~~d~~~a~~va~~LgI~~~~   89 (408)
                      ..-+|+|.+||||||+|.|.|+.+     +-.|.+-+-+-+  .  +......|+    +-+.++.-+.+|-...+.+-.
T Consensus       249 ~~s~VcVlfSGGvDs~vvA~l~h~~vp~ne~IdLINVaF~n--~--e~~~~~~~PDRktgr~g~~eL~s~~P~R~~nlV~  324 (520)
T KOG0573         249 HESNVCVLFSGGVDSTVVAVLAHYVVPENEPIDLINVAFGN--P--EGSKEQNVPDRKTGRRGLEELQSLYPKRSWNLVE  324 (520)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEEEEEECCC--C--CCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             45767999648840899999998606988863689860258--7--7666557960777888899998758763378996


Q ss_pred             CCH
Q ss_conf             170
Q gi|254780151|r   90 FDY   92 (408)
Q Consensus        90 ~d~   92 (408)
                      +|.
T Consensus       325 vnV  327 (520)
T KOG0573         325 VNV  327 (520)
T ss_pred             CCC
T ss_conf             058


No 91 
>cd01987 USP_OKCHK USP domain is located between the N-terminal sensor domain and C-terminal catalytic domain of this Osmosensitive K+ channel histidine kinase family. The family of KdpD sensor kinase proteins regulates the kdpFABC operon responsible for potassium transport. The USP domain is homologous to the universal stress protein Usp Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity.
Probab=94.77  E-value=0.43  Score=28.34  Aligned_cols=92  Identities=18%  Similarity=0.267  Sum_probs=64.0

Q ss_pred             EEEEEECCCHHHHHH----HHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             899996098579999----9999886984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   22 RVVVAMSGGVDSSVV----AALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        22 kV~va~SGGVDSsva----a~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      ||+|+.||.-.|.-+    +.|.++.+-+.+.+|+..-.......     ...+.+..+.+.|+.||....++-      
T Consensus         1 rILV~vd~s~~s~~lir~a~rlA~~~~a~l~vl~V~~~~~~~~~~-----~~~~~l~~~~~la~~lga~~~~~~------   69 (124)
T cd01987           1 RILVCISGGPNAERLIRRAARLADRLKAPWYVVYVETPRLNRLSE-----AERRRLAEALRLAEELGAEVVTLP------   69 (124)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCH-----HHHHHHHHHHHHHHHCCCEEEEEE------
T ss_conf             999995898507999999999999649989999995597565897-----999999999999998599899994------


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             322441126787088612000015411058888874016876452253110
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                                   |.    ++       ...++++|++.+++.|.-|+-.+
T Consensus        70 -------------~~----d~-------~~~I~~~A~~~~~t~IVlG~~~~   96 (124)
T cd01987          70 -------------GD----DV-------AEAIVEFAREHNVTQIVVGKSRR   96 (124)
T ss_pred             -------------CC----CH-------HHHHHHHHHHCCCCEEEECCCCC
T ss_conf             -------------79----98-------99999999984998999768988


No 92 
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only]
Probab=93.42  E-value=0.11  Score=32.46  Aligned_cols=37  Identities=35%  Similarity=0.530  Sum_probs=27.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHH----HCCCEEEEEEEECCCC
Q ss_conf             889999609857999999998----8698499999870478
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLK----RDGYDVIGVTLQLYNS   57 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~----~~G~~V~g~~m~~~~~   57 (408)
                      .+|.|++|||.||+|.+.|+.    +.|.+-++|+..-|..
T Consensus        28 ~~VcVSFSGGKDS~lmLhL~~~~ar~~~~~~i~VlfiD~E~   68 (407)
T COG3969          28 PRVCVSFSGGKDSGLMLHLVAEVARENGRDKISVLFIDWEA   68 (407)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEEECCHH
T ss_conf             83899923787405899999999998198865799970045


No 93 
>KOG2303 consensus
Probab=92.60  E-value=0.57  Score=27.49  Aligned_cols=174  Identities=21%  Similarity=0.280  Sum_probs=84.8

Q ss_pred             EEEEEECCCHHHHHHHHHHH----------HCCC-----EEEEEEEECCCCCCCCCC-C--------------CCCCCHH
Q ss_conf             89999609857999999998----------8698-----499999870478766555-5--------------7788189
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLK----------RDGY-----DVIGVTLQLYNSRKASKR-K--------------GSCCAGQ   71 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~----------~~G~-----~V~g~~m~~~~~~~~~~~-~--------------~~c~~~~   71 (408)
                      --++-+|||+||+.+|.+..          ++|-     ||-.++..    .+.... +              +..++++
T Consensus       351 GfflPLSGG~DSsatA~iV~sMC~~V~~av~~g~eqv~~Dvr~i~~~----~~~~p~dp~~l~nri~~TcyMgSenSS~E  426 (706)
T KOG2303         351 GFFLPLSGGVDSSATAAIVYSMCRQVCKAVQSGDEQVLADVRRIVND----ISYTPTDPADLCNRILYTCYMGSENSSKE  426 (706)
T ss_pred             CEEEECCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHCC----CCCCCCCHHHHHHHHHHHHEECCCCCCHH
T ss_conf             44776478864058999999999999999974736543206877148----88688898999876665420046566488


Q ss_pred             HHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEEC--CCCEEEHHHHHH-HHC-CCCCCEECCCCCC
Q ss_conf             999999999980995898170788663224411267870886120000--154110588888-740-1687645225311
Q gi|254780151|r   72 DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD--CNRTVKFSDLLS-VTR-QLGADVLATGHYI  147 (408)
Q Consensus        72 d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~--CN~~iKF~~l~~-~a~-~~g~~~iATGHYa  147 (408)
                      .-..|+.+|+++|--|.-+++-.. -..|+.-|  .-..|.||-=-+.  ||++-  =+|-. .|+ ++=..|+    +|
T Consensus       427 Tr~rak~La~~igs~H~~i~iD~~-vsavl~lF--~~vtGk~P~f~~~ggsn~en--laLQNiQARiRMvLayl----fA  497 (706)
T KOG2303         427 TRRRAKELANQIGSYHIDLNIDTA-VSAVLSLF--NLVTGKTPRFKSHGGSNREN--LALQNIQARIRMVLAYL----FA  497 (706)
T ss_pred             HHHHHHHHHHHHCCEEEEEEEHHH-HHHHHHHH--HHHHCCCCCEECCCCCHHHH--HHHHHHHHHHHHHHHHH----HH
T ss_conf             999999999863510241550599-99999999--88747875211588860666--76777999999999999----99


Q ss_pred             CEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHH----HCCCCC
Q ss_conf             0254126787731688531578787318986302022100334256899789899997----412543
Q gi|254780151|r  148 RSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAR----EMGLDI  211 (408)
Q Consensus       148 r~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~----~~gl~~  211 (408)
                      +.....-.  ....+|.-| ..+-|.|.-=|-..=+--|.-|-|+|.++|.+.|.+.+    ++|+|.
T Consensus       498 qL~~wvr~--~~GglLVLG-SaNVDE~LrGYLTKYDCSSADINPIGgISK~DLr~Fl~~a~~~~~lp~  562 (706)
T KOG2303         498 QLLLWVRG--RPGGLLVLG-SANVDESLRGYLTKYDCSSADINPIGGISKTDLRRFLQYAKEKFGLPA  562 (706)
T ss_pred             HHHHHHCC--CCCCEEEEE-CCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCHH
T ss_conf             87787507--877369972-476035765111014556246677667248789999999998639568


No 94 
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. This family consist of Cyclopropane-fatty-acyl-phospholipid synthase or CFA synthase EC:2.1.1.79 this enzyme catalyse the reaction: S-adenosyl-L-methionine + phospholipid olefinic fatty acid <= S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.
Probab=91.77  E-value=1.2  Score=25.05  Aligned_cols=141  Identities=14%  Similarity=0.194  Sum_probs=74.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE----EECCHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958----98170788
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH----YVFDYEER   95 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~----~~~d~~~~   95 (408)
                      .++|+ =+-.|--| +|.++.++-|..|+|+++                |++..+.|++.++.+|++.    ...|+++.
T Consensus        63 g~~vL-DiGCGWG~-~a~~~a~~~g~~v~giTl----------------S~~Q~~~~~~r~~~~gl~~~v~v~~~Dyrd~  124 (273)
T pfam02353        63 GMTLL-DIGCGWGG-LMRRAAERYDVNVVGLTL----------------SKNQYKLARQRVAAEGLQRKVEVLLQDYRDF  124 (273)
T ss_pred             CCEEE-EECCCCHH-HHHHHHHHCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCCCCCEEECCHHHC
T ss_conf             99899-97888089-999999847951899979----------------7899999999998708743212000626547


Q ss_pred             HHHHCCCCCHHHHHCCCCCCCEECCCCEE---EHHHHHHHHCC-CCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             66322441126787088612000015411---05888887401-687645225311025412678773168853157878
Q gi|254780151|r   96 FRNAVIVPFASSYAAGETPLPCVDCNRTV---KFSDLLSVTRQ-LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        96 f~~~V~~~~~~~y~~G~TPNPc~~CN~~i---KF~~l~~~a~~-~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                        ..-||-.+.   -|+        =.++   .+..+++...+ +.-                   +++. ++... ..+
T Consensus       125 --~~~fD~IvS---iem--------~Ehvg~~~~~~~f~~i~~~Lkp-------------------gG~~-~iq~i-~~~  170 (273)
T pfam02353       125 --DEPFDRIVS---VGM--------FEHVGHENYDTFFKKLYNLLPP-------------------GGLM-LLHTI-TGL  170 (273)
T ss_pred             --CCCCCEEEE---EHH--------HHHCCHHHHHHHHHHHHHHCCC-------------------CCEE-EEEEE-ECC
T ss_conf             --666666776---516--------8762877799999999986588-------------------9739-99999-425


Q ss_pred             CCEEE-EEEECCHHHCEEECCCCCC-CHHHHHHHHHHCCCCCC
Q ss_conf             73189-8630202210033425689-97898999974125435
Q gi|254780151|r  172 DQSYF-LFATTQQQLCDLRFPLGDM-KKESVRDLAREMGLDIA  212 (408)
Q Consensus       172 DQSYf-L~~l~~~~L~~~~FPlg~~-~K~eVR~~A~~~gl~~a  212 (408)
                      |+.|+ -..-+...+.+-|||=|.+ +.+++...+++.||.+.
T Consensus       171 ~~~~~~~~~~~~~fi~kyIFPGG~lPs~~~~~~~~~~~~l~v~  213 (273)
T pfam02353       171 HPDETSERGLPLKFIDKYIFPGGELPSISMIVESSSEAGFTVE  213 (273)
T ss_pred             CCCCHHHCCCCCCHHHHHCCCCCCCCCHHHHHHHHHHCCCEEE
T ss_conf             7321010277420077760799878999999999986894886


No 95 
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family; InterPro: IPR014188   This entry represents a subfamily of the alcohol dehydrogenase, a superfamily in which some members are zinc-binding medium-chain alcohol dehydrogenases while others are quinone oxidoreductases with no bound zinc. This entry includes YhdH from Escherichia coli and YhfP from Bacillus subtilis both of which bind NADPH or NAD, but not zinc. Both proteins have been studied crystallographically for insight into function. .
Probab=91.17  E-value=0.45  Score=28.23  Aligned_cols=170  Identities=24%  Similarity=0.265  Sum_probs=86.6

Q ss_pred             CCCCCCCCCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHH-HHHHHCCCC
Q ss_conf             44346788863388999-9609857999999998869849999987047876655557788189999999-999980995
Q gi|254780151|r    9 LNSLDLDKNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR-RVCDTINVS   86 (408)
Q Consensus         9 ~~~~~~~~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~-~va~~LgI~   86 (408)
                      |-..+|.++ ++-.|+| |=||||=| +|..||.+.||+|++.+=|.               +     .. ..-+.|| =
T Consensus       139 Le~~Gl~~P-~~GpVlVTGAtGGVGS-~Av~~L~~lGY~V~A~tGk~---------------~-----~~~~yL~~LG-A  195 (330)
T TIGR02823       139 LERNGLLTP-EDGPVLVTGATGGVGS-LAVAILSKLGYEVVASTGKA---------------E-----EEVEYLKELG-A  195 (330)
T ss_pred             HHHCCCCCC-CCCCEEEECCCCCHHH-HHHHHHHHCCCEEEEEECCH---------------H-----HHHHHHHHCC-C
T ss_conf             997268888-8887887067787789-99999983797699973783---------------7-----7889998658-1


Q ss_pred             EEECCHHHHHHHH-CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHH-HCCC---CC---CEECCCCCCCEEEECCCCCC
Q ss_conf             8981707886632-244112678708861200001541105888887-4016---87---64522531102541267877
Q gi|254780151|r   87 HYVFDYEERFRNA-VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV-TRQL---GA---DVLATGHYIRSRLYVGDDGK  158 (408)
Q Consensus        87 ~~~~d~~~~f~~~-V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~-a~~~---g~---~~iATGHYar~~~~~~~~~~  158 (408)
                      -++++ ++++... .-.|.-.+.=+|     +|+|   |= |..+.+ .+++   |+   =-.|.|=    .    -+.+
T Consensus       196 ~evi~-R~~l~~~a~~kPL~k~~WAG-----AvDt---VG-G~~La~~l~~~~ygG~VA~cGlagG~----~----L~tT  257 (330)
T TIGR02823       196 SEVID-REELSEDAPGKPLEKERWAG-----AVDT---VG-GKTLANVLAQLKYGGAVAACGLAGGA----D----LPTT  257 (330)
T ss_pred             CCCCC-HHHCCCCCCCCCCCCCCCCC-----EEEC---CC-HHHHHHHHHHHCCCCEEEEEECCCCC----C----CCCE
T ss_conf             10577-11227687888631222221-----5746---87-57999999840689789999426798----6----3501


Q ss_pred             CEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHH-HHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCC
Q ss_conf             316885315787873189863020221003342568997898-9999741254355111023011127751034553076
Q gi|254780151|r  159 RRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV-RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINA  237 (408)
Q Consensus       159 ~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eV-R~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~  237 (408)
                      --+.++||..        |-+++.-+...-       .++++ .+||.++.+...+.---|.|=|   -+..+.+.+.+.
T Consensus       258 V~PFILRGV~--------LlGIDSV~~p~~-------~R~~~W~RLA~dl~~~~L~~~~~~ei~L---~elp~~~~~~l~  319 (330)
T TIGR02823       258 VLPFILRGVS--------LLGIDSVYCPMA-------LREAAWQRLATDLKPRNLESLTTQEITL---EELPEAAEQILA  319 (330)
T ss_pred             ECCHHHCCCE--------EEEECHHCCCHH-------HHHHHHHHHHHHCCHHHHHHHHCCCCCH---HHHHHHHHHHHC
T ss_conf             2550432853--------888530018878-------9999999887415977888784200157---768999999973


No 96 
>cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain.  DCR in E. coli  is an iron-sulfur flavoenzyme which contains FMN, FAD, and a 4Fe-4S cluster. It is also a monomer, unlike that of its eukaryotic counterparts which form homotetramers and lack the flavin and iron-sulfur cofactors. Metabolism of unsaturated fatty acids requires auxiliary enzymes in addition to those used in b-oxidation. After a given number of cycles through the b-oxidation pathway, those unsaturated fatty acyl-CoAs with double bonds at even-numbered carbon positions contain 2-trans, 4-cis double bonds that can not be modified by enoyl-CoA hydratase. DCR utilizes NADPH to remove the C4-C5 double bond. DCR can catalyze the reduction of both natural fatty acids with cis double bonds, as well as substrates containing trans double bonds. The reaction is initiated by hybrid transfer from NADPH to FAD, which in turn transfers electrons, one at a time, to FMN via the 4Fe-4S cluster. The fully reduced FMN provi
Probab=91.11  E-value=1.4  Score=24.60  Aligned_cols=16  Identities=25%  Similarity=0.447  Sum_probs=9.3

Q ss_pred             HHHHHHHHCCCCCCEE
Q ss_conf             5888887401687645
Q gi|254780151|r  126 FSDLLSVTRQLGADVL  141 (408)
Q Consensus       126 F~~l~~~a~~~g~~~i  141 (408)
                      |..-.+.|++-|+|.|
T Consensus       139 f~~AA~rA~~AGfDgV  154 (353)
T cd02930         139 FARCAALAREAGYDGV  154 (353)
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             9999999998299989


No 97 
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily. This CD includes predicted proteins with rhodanese-like domains found N-terminal of the metallo-beta-lactamase domain.
Probab=90.05  E-value=0.7  Score=26.84  Aligned_cols=36  Identities=39%  Similarity=0.458  Sum_probs=28.5

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             888633889999609857999999998869849999
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +.-|++..|+|-=.+|.-|..||.+|++.||+|.-+
T Consensus        56 ~~lp~d~~ivv~C~~G~rS~~aa~~L~~~G~~v~~L   91 (100)
T cd01523          56 DQLPDDQEVTVICAKEGSSQFVAELLAERGYDVDYL   91 (100)
T ss_pred             HHCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             647899839999289656999999999879837983


No 98 
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase; InterPro: IPR013375   The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology . The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric . Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices , and are mostly dimeric or multimeric, containing at least three conserved regions , , . However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases; these synthetases are further divided into three subclasses, a, b and c, according to sequence homology. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases .    Many archaeal species lack cysteinyl-tRNA synthetase, an essential enzyme that provides Cys-tRNA(Cys) in other organisms. Instead, in a two step pathway, tRNA-Cys is acylated with O-phosphoserine (Sep) to form Sep-tRNA(Cys), which is subsequently converted to Cys-tRNA(Cys) . This pathway is also thought to function as the sole route of cysteine biosynthesis in these organisms. Several other archaeal species use both this pathway and direct tRNA(Cys) aminoacylation to synthesize Cys-tRNA(Cys), but this pathway appears to be the only route for cysteine biosynthesis. Proteins in this entry catalyse the second step in this pathway using pyridoxal phosphate and a sulphur donor to synthesize Cys from Sep while attached to the tRNA..
Probab=89.55  E-value=0.36  Score=28.89  Aligned_cols=67  Identities=22%  Similarity=0.409  Sum_probs=41.6

Q ss_pred             HHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH---HHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCE
Q ss_conf             88698499999870478766555577881899999999---999809958981707886632244112678708861200
Q gi|254780151|r   41 KRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR---VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPC  117 (408)
Q Consensus        41 ~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~---va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc  117 (408)
                      .+.|-+|.=+-+ ++-+.++.+          +.||++   ||+++|||+. +|.              +|.-||.|-  
T Consensus       143 d~~G~~~~Lall-ThvDG~YGN----------L~DA~kva~vc~~~gvPlL-LNC--------------AY~vGRmPv--  194 (381)
T TIGR02539       143 DESGKPVALALL-THVDGEYGN----------LADAKKVAKVCREKGVPLL-LNC--------------AYTVGRMPV--  194 (381)
T ss_pred             CCCCCCCEEEEE-EECCCCCCC----------CHHHHHHHHHHHHCCCCEE-ECC--------------CCEEEEECC--
T ss_conf             027988348998-402688675----------1124568766542078622-124--------------505210031--


Q ss_pred             ECCCCEEEHHHHHHHHCCCCCCEE-CCCCCCCE
Q ss_conf             001541105888887401687645-22531102
Q gi|254780151|r  118 VDCNRTVKFSDLLSVTRQLGADVL-ATGHYIRS  149 (408)
Q Consensus       118 ~~CN~~iKF~~l~~~a~~~g~~~i-ATGHYar~  149 (408)
                                    -++++|+||| +.||=.+.
T Consensus       195 --------------~~ke~~~DFiVGSGHKSMA  213 (381)
T TIGR02539       195 --------------SAKEIKADFIVGSGHKSMA  213 (381)
T ss_pred             --------------CCCCCCCCEEEECCCCHHH
T ss_conf             --------------5777787677806851322


No 99 
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional
Probab=89.52  E-value=1.9  Score=23.68  Aligned_cols=110  Identities=14%  Similarity=0.077  Sum_probs=61.9

Q ss_pred             CCEEEEECCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCCCC
Q ss_conf             83153102334335657786137631755312565235554222112002230377655544568718999980178870
Q gi|254780151|r  258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPV  337 (408)
Q Consensus       258 G~~~yTIGQRkGL~i~~~eP~YVv~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pv  337 (408)
                      -...-.-|||--|++++.    |-..+++...+++.+.....++.+.+. +.  ...    .....  ..+++=+-...+
T Consensus       227 ~v~~a~aG~R~AlNL~G~----v~~~~i~RGd~L~~~~~~~~~~~~~v~-l~--~~~----~lk~~--~~v~l~~Gt~~v  293 (615)
T PRK10512        227 PTETAHAGQRIALNIAGD----AEKEQINRGDWLLADAPPEPFTRVIVE-LQ--THT----PLTQW--QPLHIHHAASHV  293 (615)
T ss_pred             CCCEECCCCEEEEEECCC----CCHHHCCCCCEEECCCCCCCEEEEEEE-EC--CCC----CCCCC--CEEEEEECCCCE
T ss_conf             155732774599961254----467231786689238887753599999-57--899----86589--379999645102


Q ss_pred             EEEEEEEC-CEEEEEECCCCCCCCCCEEEEE--ECCCCCCCEEEEEEEECC
Q ss_conf             08999829-9799997597200069638999--738886658887689714
Q gi|254780151|r  338 PVFVQRND-DGVYVDFEKSEVGVASGQACVF--YTSDSNEARVLGGGIISG  385 (408)
Q Consensus       338 p~~i~~~~-~~~~V~f~eP~~aiAPGQ~~Vf--Y~~D~~~~~vLGGGiI~~  385 (408)
                      .|++..-+ +-+.+.|++|..+ .+||-.|+  |..    .+.||||.|-.
T Consensus       294 ~~rv~ll~~~~aqL~Le~pv~~-~~GDRfIlR~~Sp----~~TIGGG~VLd  339 (615)
T PRK10512        294 TGRVSLLEDNLAELVFDTPLWL-ADNDRLVLRDISA----RNTLAGARVVM  339 (615)
T ss_pred             EEEEEECCCCEEEEEECCCEEE-ECCCEEEEECCCC----CEEEEEEEEEC
T ss_conf             7999954884699997894545-5397689962888----82676279968


No 100
>TIGR02039 CysD sulfate adenylyltransferase, small subunit; InterPro: IPR011784   Metabolic assimilation of sulphur from inorganic sulphate, requires sulphate activation by coupling to a nucleoside, for the production of high-energy nucleoside phosphosulphates. This pathway appears to be similar in all prokaryotic organisms. Activation is first achieved through reaction of sulphate with ATP by sulphate adenylyltransferase (ATP sulphurylase) to produce 5'-phosphosulphate (APS), coupled by GTP hydrolysis. Subsequently, APS is phosphorylated by an APS kinase to produce 3'-phosphoadenosine-5'-phosphosulphate (PAPS). In Escherichia coli, ATP sulphurylase is a heterodimer composed of two subunits encoded by cysD and cysN, with APS kinase encoded by cysC. These genes are located in a unidirectionally transcribed gene cluster, and have been shown to be required for the synthesis of sulphur-containing amino acids. Homologous to this E. coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulphurase and APS kinase activity, yet are involved in Nod factor sulphation, and sulphation of other macromolecules.; GO: 0004781 sulfate adenylyltransferase (ATP) activity, 0019421 sulfate reduction APS pathway.
Probab=89.29  E-value=2  Score=23.56  Aligned_cols=165  Identities=20%  Similarity=0.158  Sum_probs=93.8

Q ss_pred             EEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCC
Q ss_conf             9996098579999999988698-499999870478766555577881899999999999809958981707886632244
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIV  102 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~  102 (408)
                      ++.+|+|.||+|-+.|..++-| --+.+.+ ++ -     +.|. -..+-+.-=-.+...+++.+.+..-.+ ....-+.
T Consensus        23 V~LyS~GKDS~VlLHLA~KaF~Pg~~PFpl-LH-v-----DTgw-~f~E~~~fRD~~~~~~~~~L~v~~~~~-~~~~g~~   93 (295)
T TIGR02039        23 VLLYSIGKDSSVLLHLARKAFYPGRLPFPL-LH-V-----DTGW-KFREMIAFRDELVAKYGLELIVHSNEE-GIAEGIN   93 (295)
T ss_pred             EEEEECCCHHHHHHHHHHHCCCCCCCCCCE-EE-E-----ECCC-CHHHHHHHHHHHHHHHCCEEEEEECHH-HHHHCCC
T ss_conf             689865734799999876405888879735-77-4-----0663-278999999999987097688850502-3541566


Q ss_pred             CCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEE---CC-CCCCCCEEEEE
Q ss_conf             112678708861200001541105888887401687645225311025412678773168853---15-78787318986
Q gi|254780151|r  103 PFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCR---PM-DLERDQSYFLF  178 (408)
Q Consensus       103 ~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r---~~-D~~KDQSYfL~  178 (408)
                      ||.+.-..         ....+|-..|.+..++.++|..-.|  ||-...... ...+-+=.|   +. |+ |+|-==||
T Consensus        94 P~~~~~~~---------~~~~~~T~~L~~Al~~~~FDAa~gG--ARRdEE~sR-aKERifS~R~~~h~WDP-k~QRPELW  160 (295)
T TIGR02039        94 PFTEGSAL---------HTDIMKTEALRQALDKNQFDAAFGG--ARRDEEKSR-AKERIFSFRDAFHQWDP-KKQRPELW  160 (295)
T ss_pred             CCHHHHHH---------HHHHHHHHHHHHHHHHCCCCEEECC--CCCHHHHCC-CCCCEEHHCCCCCCCCC-CCCCHHHH
T ss_conf             20101245---------5555631899999873388656316--631344301-20100010034578885-12573778


Q ss_pred             EECCHHHCE----EECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             302022100----33425689978989999741254
Q gi|254780151|r  179 ATTQQQLCD----LRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       179 ~l~~~~L~~----~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      .+=..+..+    =+|||.++|--||=+....-.++
T Consensus       161 ~~YNg~~~~GE~~RvFPLSNwTE~DiW~Y~~~~~i~  196 (295)
T TIGR02039       161 NLYNGRISKGESVRVFPLSNWTELDIWRYIAAENIE  196 (295)
T ss_pred             HHCCCCCCCCCEEEEECCCCCCHHHHHHHHHHCCCC
T ss_conf             750523468872687226665044589887434654


No 101
>cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain.  Enoate reductase catalyzes the NADH-dependent reduction of carbon-carbon double bonds of several molecules, including nonactivated 2-enoates, alpha,beta-unsaturated aldehydes, cyclic ketones, and methylketones. ERs are similar to 2,4-dienoyl-CoA reductase from E. coli and to the old yellow enzyme from Saccharomyces cerevisiae.
Probab=89.20  E-value=1.3  Score=25.00  Aligned_cols=45  Identities=9%  Similarity=0.062  Sum_probs=19.5

Q ss_pred             CCCCCEEECCCEECCCCCCCC--CCCCCEEE---EEEEECCCCCCEEEEE
Q ss_conf             422211200223037765554--45687189---9998017887008999
Q gi|254780151|r  298 LEVHRIYLREINWLGDGLFED--AVVDGFKC---FVKIRSSQDPVPVFVQ  342 (408)
Q Consensus       298 L~~~~i~l~d~nWi~~~~~~~--~~~~~~~~---~vkiR~~~~pvp~~i~  342 (408)
                      ....+-.+.|++|+.......  .......|   .+--.++..++.|.++
T Consensus       332 V~~gR~~iadP~~v~K~~~G~~~~ir~Ci~Cn~~C~~~~~~~~~~~C~~N  381 (382)
T cd02931         332 ISLGRPLLADPDVVNKIRRGRFKNIRPCISCHDGCLGRMALGGNLSCAVN  381 (382)
T ss_pred             HHHHHHHHHCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCC
T ss_conf             36228988693599999829945575452046898878845998542679


No 102
>PRK09955 rihB ribonucleoside hydrolase 2; Provisional
Probab=88.39  E-value=2.3  Score=23.15  Aligned_cols=57  Identities=12%  Similarity=0.385  Sum_probs=45.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             3388999960985799999999886-984999998704787665555778818999999999998099
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV   85 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI   85 (408)
                      +++||++=-..|+|-++|..++... ..||.|++--..          -++.++...+|.++++.++.
T Consensus         2 ~k~kvIiD~D~G~DDa~Al~lal~~p~i~v~gITtv~G----------N~~~~~~~~Nal~~l~~~~~   59 (313)
T PRK09955          2 EKRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVAG----------NQTLDKTLINGLNVCQKLEI   59 (313)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEECC----------CCCHHHHHHHHHHHHHHHCC
T ss_conf             98669998999879999999998689981899999359----------98889999999999998389


No 103
>TIGR01289 LPOR light-dependent protochlorophyllide reductase; InterPro: IPR005979    This family contains the light-dependent, NADPH-dependent form of protochlorophyllide reductase (1.3.1.33 from EC) which catalyses the reaction  chlorophyllide A + NADP+ = protochlorophyllide + NADPH.  The enzyme belongs to the short chain alcohol dehydrogenase family. ; GO: 0016630 protochlorophyllide reductase activity, 0015995 chlorophyll biosynthetic process, 0019685 photosynthesis dark reaction, 0009507 chloroplast.
Probab=87.51  E-value=1.7  Score=24.11  Aligned_cols=106  Identities=21%  Similarity=0.357  Sum_probs=75.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE-----EECCH
Q ss_conf             33889999609857999999998869-8499999870478766555577881899999999999809958-----98170
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH-----YVFDY   92 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~-----~~~d~   92 (408)
                      |+.-|+-|-|.||-= .+|.-|.+.| ++|+=.                 |  +|+..|.++|+.+|+|-     ..+|+
T Consensus         3 K~tviITGASSG~GL-~~AKAL~~~G~WHV~MA-----------------C--R~l~Ka~~aA~~~G~p~~sYti~~lDL   62 (321)
T TIGR01289         3 KPTVIITGASSGLGL-YAAKALAETGKWHVVMA-----------------C--RDLLKAEKAAKSLGMPKDSYTILHLDL   62 (321)
T ss_pred             CCCEEEECCCHHHHH-HHHHHHHHCCCEEEEEE-----------------C--CCHHHHHHHHHHCCCCCCCCEEEEEHH
T ss_conf             870788637313578-99999986398089981-----------------4--461688999984388866613543013


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCC-CCCC-EECCCCCC
Q ss_conf             7886632244112678708861200001541105888887401-6876-45225311
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGAD-VLATGHYI  147 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~-~g~~-~iATGHYa  147 (408)
                      ..-   +=+--|++.+++-.-|---..||.-|-|+.+-|=... -|++ -|||-|.-
T Consensus        63 ~~L---dSVR~FV~~Fr~~gr~LdaLVCNAAVy~P~~~EP~~~adgfELSV~TNHlG  116 (321)
T TIGR01289        63 GSL---DSVRQFVEQFRESGRPLDALVCNAAVYLPLLKEPLYSADGFELSVATNHLG  116 (321)
T ss_pred             HHH---HHHHHHHHHHHHCCCCCEEEEEHHHHHCCCCCCCCCCCCCEEECHHHHHHH
T ss_conf             446---789999999986078420134213452663347764877503201344556


No 104
>cd02649 nuc_hydro_CeIAG nuc_hydro_CeIAG: Nucleoside hydrolases similar to the inosine-adenosine-guanosine-preferring nucleoside hydrolase from Caenorhabditis elegans.  Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains eukaryotic, bacterial and archeal proteins similar to the purine-preferring nucleoside hydrolase (IAG-NH) from C. elegans and the salivary purine nucleosidase from Aedes aegypti.  C. elegans IAG-NH exhibits a high affinity for the substrate analogue p-nitrophenylriboside (p-NPR).
Probab=87.07  E-value=2.7  Score=22.61  Aligned_cols=58  Identities=19%  Similarity=0.275  Sum_probs=44.9

Q ss_pred             CEEEEEECCCHHHHHHHHHH-HHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEE
Q ss_conf             88999960985799999999-88698499999870478766555577881899999999999809---9589
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL-KRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHY   88 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL-~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~   88 (408)
                      +||++=-..|+|-++|..++ +....+|.|++.-.          |-|..++..++|.++.+.+|   ||.+
T Consensus         1 rkvIiDtD~G~DDa~Al~~al~~~~~~l~git~v~----------GN~~~~~~~~Na~~vL~~~g~~dIPV~   62 (306)
T cd02649           1 RKLIIDTDCGGDDAWALLMALASPNVEVLAITCVH----------GNTNVEQVVKNALRVLEACGRRDIPVY   62 (306)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             93999899986999999999868998599999947----------988889999999999998099999886


No 105
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily. This CD includes Escherichia coli YceA, Bacillus subtilis YbfQ, and similar uncharacterized proteins.
Probab=86.50  E-value=1.4  Score=24.75  Aligned_cols=36  Identities=25%  Similarity=0.408  Sum_probs=29.0

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCC-EEEEE
Q ss_conf             8886338899996098579999999988698-49999
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGY-DVIGV   50 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~   50 (408)
                      ...+|+++|+|==.+|.-|..||.+|+++|| +|.-+
T Consensus        56 ~~~~k~k~ivvyC~~G~RS~~Aa~~L~~~Gf~~V~~L   92 (101)
T cd01518          56 LDLLKGKKVLMYCTGGIRCEKASAYLKERGFKNVYQL   92 (101)
T ss_pred             HCCCCCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEE
T ss_conf             1214387699985998279999999998498706896


No 106
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily. Included in this CD are the Lactococcus lactis NADH oxidase, Bacillus cereus NADH dehydrogenase, and Bacteroides thetaiotaomicron pyridine nucleotide-disulphide oxidoreductase, and similar rhodanese-like domains found C-terminal of the pyridine nucleotide-disulphide oxidoreductase (Pyr-redox) domain and the Pyr-redox dimerization domain.
Probab=86.45  E-value=0.81  Score=26.39  Aligned_cols=35  Identities=26%  Similarity=0.524  Sum_probs=28.5

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             88633889999609857999999998869849999
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +-+++++|++-=..|.-|+.||.+|+++||+|.-+
T Consensus        47 ~l~k~~~ivv~C~~G~rS~~aa~~L~~~G~~v~~l   81 (90)
T cd01524          47 ELPKDKEIIVYCAVGLRGYIAARILTQNGFKVKNL   81 (90)
T ss_pred             HHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             86158709998899805999999999869988996


No 107
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 3rd repeat which does not contain the putative catalytic Cys residue.
Probab=86.41  E-value=1.2  Score=25.03  Aligned_cols=33  Identities=27%  Similarity=0.463  Sum_probs=28.2

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             633889999609857999999998869849999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      .++.+|++-=.+|.-|..||..|+++||+|.-+
T Consensus        54 ~k~~~ivl~C~~G~RS~~AA~~L~~~G~~v~~L   86 (95)
T cd01534          54 VRGARIVLADDDGVRADMTASWLAQMGWEVYVL   86 (95)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHCCCCEEEE
T ss_conf             689839998599987999999999869976995


No 108
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461    Proteins in this entry are related to ClpA () from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins..
Probab=86.41  E-value=1.7  Score=24.02  Aligned_cols=69  Identities=17%  Similarity=0.253  Sum_probs=38.6

Q ss_pred             EECCCHHHHHHHHHHHHCCC----EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             96098579999999988698----49999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   26 AMSGGVDSSVVAALLKRDGY----DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        26 a~SGGVDSsvaa~lL~~~G~----~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      |=.-=+|+.|.|..+.++|+    ..+|-|+ |..+  ..=.+        -+-||.+|+.|||++..+|++|--..+=|
T Consensus       501 GQD~AI~~lv~aiK~SrAGl~~~nkP~GSFL-F~GP--TGVGK--------TElak~LA~~LGv~l~RFDMSEYmEKHTV  569 (774)
T TIGR02639       501 GQDEAIEQLVSAIKRSRAGLGEPNKPVGSFL-FVGP--TGVGK--------TELAKQLAEELGVHLLRFDMSEYMEKHTV  569 (774)
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCEEEEE-EECC--CCCCH--------HHHHHHHHHHHCCHHCCCCCHHHHHHHHH
T ss_conf             1589999999999998742477888168888-6479--89625--------78899999970820010465044689999


Q ss_pred             CCCH
Q ss_conf             4112
Q gi|254780151|r  102 VPFA  105 (408)
Q Consensus       102 ~~~~  105 (408)
                      .-+|
T Consensus       570 sRLI  573 (774)
T TIGR02639       570 SRLI  573 (774)
T ss_pred             HHHH
T ss_conf             8741


No 109
>PRK04148 hypothetical protein; Provisional
Probab=85.58  E-value=2.5  Score=22.86  Aligned_cols=91  Identities=18%  Similarity=0.295  Sum_probs=57.6

Q ss_pred             CEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             8899-996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   21 MRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        21 ~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .||+ ||.-.=   .-+|..|++.|++|+.+-.   +             +..+.+    |+.+|++...        ++
T Consensus        18 ~kIvEvGIGf~---~~vA~~L~e~g~dv~~~Di---n-------------~~aV~~----a~~~Gl~~v~--------DD   66 (135)
T PRK04148         18 GKIAELGIGFY---FKVAKKLKESGFDVIVIDI---N-------------KKAVEK----AKKLGLNAFV--------DD   66 (135)
T ss_pred             CEEEEEECCCC---HHHHHHHHHCCCCEEEEEC---C-------------HHHHHH----HHHCCCCEEE--------CC
T ss_conf             73899923666---7899999874998899957---6-------------554322----1232876375--------15


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             244112678708861200001541105888887401687645225
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                      ||+|-++-|+..-- -=-++|.+.+ ...+++.|++.|++-+..-
T Consensus        67 if~P~l~iY~~a~l-IYSIRPp~El-q~~il~lakkv~~dliI~P  109 (135)
T PRK04148         67 IFNPNLEIYKNAKL-IYSIRPPRDL-QPFILELAKKLNCPLYIKP  109 (135)
T ss_pred             CCCCCHHHHCCCCE-EEEECCCHHH-HHHHHHHHHHCCCCEEEEC
T ss_conf             88998888517887-9981898788-8999999997599899970


No 110
>TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain; InterPro: IPR002761   This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal. The structure of Q8U2K6 from Pyrococcus furiosus has been resolved to 2.7A and is suggested to be a putative N-type pytophosphatase.   In some members of the family e.g. Q12429 from SWISSPROT, this domain is associated with IPR006175 from INTERPRO, another domain of unknown function. Proteins with this uncharacterised domain include two apparent ortholog families in the archaea, one of which is universal among the first four completed archaeal genomes. The domain comprises the full length of the archaeal proteins and the first third of fungal proteins. .
Probab=85.56  E-value=0.8  Score=26.39  Aligned_cols=69  Identities=16%  Similarity=0.230  Sum_probs=46.2

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             889999609857999999998869849999987047876655557788189999999999980995898
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      +|+++..|||.||.++.+-..+.|++|..+.--.-..+...+........-........++.+|||+..
T Consensus         1 ~~~~~~~~gg~d~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~g~p~~~   69 (265)
T TIGR00290         1 MKVAALYSGGKDSCLALYHALKEGHEVISLVNVFPKENEERELDSYMFHGPNLHLLDLLAESVGIPLIK   69 (265)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHCCCCCHHHHHHCCCCCCHHHHHHHHHHCCCHHHHHHHHHHHCCHHHH
T ss_conf             924787507741478999987417610012110134550244444444214425777667651530455


No 111
>TIGR02017 hutG_amidohyd N-formylglutamate amidohydrolase; InterPro: IPR010247   In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This entry represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate..
Probab=85.43  E-value=0.6  Score=27.30  Aligned_cols=57  Identities=23%  Similarity=0.376  Sum_probs=45.5

Q ss_pred             CCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEE
Q ss_conf             0995898170788663224411267870886120000154110588888740168764522531102541
Q gi|254780151|r   83 INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLY  152 (408)
Q Consensus        83 LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~  152 (408)
                      ++|||--+|+.+.-+.+.+++-.          +|-+|.=+|  ..|.|+|+.+||..|.|- |.|....
T Consensus        14 iS~PHtGtdl~~~v~~~L~~~~~----------~l~DtDWhi--~~LYDFA~d~GAt~V~~~-~SR~VID   70 (269)
T TIGR02017        14 ISLPHTGTDLPDAVESRLVSPWL----------ALRDTDWHI--DQLYDFARDLGATVVRTT-ISRTVID   70 (269)
T ss_pred             EECCCCCCCCCHHHHHHHCCCCC----------CCCCCCCCH--HHHHHHHHHCCHHHEEEE-EEEEEEE
T ss_conf             30786767670788873125344----------678875534--788886764031310100-4226886


No 112
>PRK10443 rihA ribonucleoside hydrolase 1; Provisional
Probab=85.18  E-value=3.3  Score=21.96  Aligned_cols=59  Identities=19%  Similarity=0.254  Sum_probs=45.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEEE
Q ss_conf             88999960985799999999886-98499999870478766555577881899999999999809---95898
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHYV   89 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~~   89 (408)
                      +||++=-.+|+|-++|..++... -.||.|++--.          |-|..++..++|.++.+.+|   ||.+.
T Consensus         3 ~kvIiDtD~G~DDa~Al~lal~~~~~ev~gIT~v~----------GN~~~~~~~~Na~~~l~~~g~~diPV~~   65 (311)
T PRK10443          3 LPIILDCDPGHDDAIALVLALASPELDVKAVTTSA----------GNQTPEKTLRNALRMLTLLNRTDIPVAG   65 (311)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHCCCCCCCEEC
T ss_conf             88899899975899999999868998799999807----------9998899999999999980998884755


No 113
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional
Probab=83.53  E-value=3.4  Score=21.92  Aligned_cols=39  Identities=21%  Similarity=0.262  Sum_probs=29.4

Q ss_pred             CCCCCCCCCEEEEEECCCHH---HHHHHHHHHHCCCEEEEEE
Q ss_conf             67888633889999609857---9999999988698499999
Q gi|254780151|r   13 DLDKNPKDMRVVVAMSGGVD---SSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        13 ~~~~~~k~~kV~va~SGGVD---Ssvaa~lL~~~G~~V~g~~   51 (408)
                      ....+.+.+||+++.|||+-   |.-.+.+|+++|++|..+-
T Consensus        64 ~~~~~l~GKkIlLgVtGsIAAYKa~~LvR~L~k~Ga~V~vvm  105 (476)
T PRK13982         64 VAQASLGSKRITLIIGGGIAAYKALDLIRRLKERGAEVRCVL  105 (476)
T ss_pred             CCCCCCCCCEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             667688899799996748999999999999997899899997


No 114
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1. This CD includes the putative rhodanese-related sulfurtransferases of several uncharacterized proteins.
Probab=83.09  E-value=2.2  Score=23.34  Aligned_cols=33  Identities=27%  Similarity=0.352  Sum_probs=22.5

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCC-EEEEE
Q ss_conf             6338899996098579999999988698-49999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGY-DVIGV   50 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~   50 (408)
                      +++..|+|-=..|+-|+.||.+|++.|| +|.-+
T Consensus        62 ~~d~~ivv~C~sG~RS~~Aa~~L~~~Gf~nV~ni   95 (117)
T cd01522          62 GKDRPVLLLCRSGNRSIAAAEAAAQAGFTNVYNV   95 (117)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHCCCCCEEEE
T ss_conf             9998699988998159999999998598777981


No 115
>PRK10768 ribonucleoside hydrolase RihC; Provisional
Probab=81.86  E-value=4.5  Score=21.05  Aligned_cols=55  Identities=16%  Similarity=0.229  Sum_probs=42.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             388999960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      ++||++=-..|+|-++|..++... -.+|.|++--.          |-|+.++..++|.++.+.+|
T Consensus         2 ~~kvIiDtD~G~DDa~Al~lal~~~~~~v~gIT~v~----------GN~~~~~~~~N~~~~l~~~g   57 (304)
T PRK10768          2 KLPIILDTDPGIDDAVAIAAALFAPELDLQLITTVA----------GNVSVEKTTRNALKLLHFFN   57 (304)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             988899899976899999999878998499999747----------98779999999999999839


No 116
>cd01976 Nitrogenase_MoFe_alpha Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe protein, beta subunit. A group of proteins similar to the alpha subunit of the MoFe protein of the molybdenum (Mo-) nitrogenase. The nitrogenase enzyme catalyzes the ATP-dependent reduction of dinitrogen to ammonia. The Mo-nitrogenase is the most widespread and best characterized of these systems.  Mo-nitrogenase consists of the MoFe protein (component 1) and the Fe protein (component 2).  MoFe is an alpha2beta2 tetramer. Each alphabeta pair of MoFe contains one P-cluster (at the alphabeta interface) and, one molecule of iron molybdenum cofactor (FeMoco) contained within the alpha subunit. The Fe protein contains a single [4Fe-4S] cluster.  Electrons are transferred from the [4Fe-4S] cluster of the Fe protein to the P-cluster of the MoFe and in turn to FeMoCo, the site of substrate reduction.
Probab=81.15  E-value=4.7  Score=20.88  Aligned_cols=55  Identities=18%  Similarity=0.302  Sum_probs=31.0

Q ss_pred             ECCCHHHHHHHHHHHHCCCEE-EEEEEECCCCCCCCCCCCCCCCH---HHHHH-HHHHHHHCCCCEEECCH
Q ss_conf             609857999999998869849-99998704787665555778818---99999-99999980995898170
Q gi|254780151|r   27 MSGGVDSSVVAALLKRDGYDV-IGVTLQLYNSRKASKRKGSCCAG---QDVYD-ARRVCDTINVSHYVFDY   92 (408)
Q Consensus        27 ~SGGVDSsvaa~lL~~~G~~V-~g~~m~~~~~~~~~~~~~~c~~~---~d~~~-a~~va~~LgI~~~~~d~   92 (408)
                      .-||-+-...|..-.-+-|.- -++|+-           .+|.+.   +|++- +++..+.+|||..-++.
T Consensus        79 VfGGekKL~~aI~ea~~~~~P~kaIfV~-----------sTC~~glIGDDI~aV~~~~~~~~gipVIpv~~  138 (421)
T cd01976          79 VFGGDKKLAKAIDEAYELFPLNKGISVQ-----------SECPVGLIGDDIEAVARKASKELGIPVVPVRC  138 (421)
T ss_pred             EECHHHHHHHHHHHHHHHCCCCEEEEEE-----------ECCCHHHHCCCHHHHHHHHHHHCCCCEEEEEC
T ss_conf             3367999999999999857973089999-----------23737865568999999987752998899868


No 117
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2. Subgroup 2 includes uncharacterized putative rhodanese-related domains.
Probab=80.72  E-value=2.8  Score=22.49  Aligned_cols=36  Identities=36%  Similarity=0.468  Sum_probs=27.0

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHCCC-EEEE
Q ss_conf             78886338899996098579999999988698-4999
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGY-DVIG   49 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g   49 (408)
                      +....++++|++-=.+|..|..||.+|++.|| +|.-
T Consensus        52 ~~~~~~d~~iv~~C~~G~rS~~aa~~L~~~G~~~V~~   88 (101)
T cd01528          52 LDSDNPDKDIVVLCHHGGRSMQVAQWLLRQGFENVYN   88 (101)
T ss_pred             HHHHCCCCCEEEECCCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             3411689808998389815999999999859977798


No 118
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism]
Probab=79.99  E-value=5.2  Score=20.62  Aligned_cols=247  Identities=19%  Similarity=0.286  Sum_probs=117.2

Q ss_pred             HHHHHHCCCCEEECCHHH----HHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEE
Q ss_conf             999998099589817078----8663224411267870886120000154110588888740168764522531102541
Q gi|254780151|r   77 RRVCDTINVSHYVFDYEE----RFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLY  152 (408)
Q Consensus        77 ~~va~~LgI~~~~~d~~~----~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~  152 (408)
                      -.++..|||+|.++-..+    .|.+.+|+-...+                     ++.+|.++|.+-+   ||.-+...
T Consensus       131 s~I~sLLGIrhvvvAVNKmDLvdy~e~~F~~I~~d---------------------y~~fa~~L~~~~~---~~IPiSAl  186 (431)
T COG2895         131 SFIASLLGIRHVVVAVNKMDLVDYSEEVFEAIVAD---------------------YLAFAAQLGLKDV---RFIPISAL  186 (431)
T ss_pred             HHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHH---------------------HHHHHHHCCCCCC---EEEECHHH
T ss_conf             99999728767999974101235678999999999---------------------9999997699852---47743230


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC------CCC
Q ss_conf             26787731688531578787318986302022100334256899789899997412543551110230111------277
Q gi|254780151|r  153 VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV------QQG  226 (408)
Q Consensus       153 ~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi------~~~  226 (408)
                      .|+|--     .++.           .++            =+.-+..-++.+..  ++++-...+..+|=      ++-
T Consensus       187 ~GDNV~-----~~s~-----------~mp------------WY~GptLLe~LE~v--~i~~~~~~~~~RfPVQ~V~Rp~~  236 (431)
T COG2895         187 LGDNVV-----SKSE-----------NMP------------WYKGPTLLEILETV--EIADDRSAKAFRFPVQYVNRPNL  236 (431)
T ss_pred             CCCCCC-----CCCC-----------CCC------------CCCCCCHHHHHHHC--CCCCCCCCCCEEECEEEECCCCC
T ss_conf             487533-----4656-----------788------------64685099997412--23455436650102288617897


Q ss_pred             CCHHHHHHCCCCCCCCCC-EE-CCCCCE-----EEEECCC-EEEEECCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCC
Q ss_conf             510345530766434671-10-377432-----2335783-153102334335657786137631755312565235554
Q gi|254780151|r  227 KYFDVVKRINAGIALEGD-IV-HLNGQI-----LGRHNGI-INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESL  298 (408)
Q Consensus       227 ~~~~Fl~~~~~~~~~~G~-iv-d~~G~v-----iG~H~G~-~~yTIGQRkGL~i~~~eP~YVv~id~~~N~ViVg~~~~L  298 (408)
                      +|+.|--.......++|+ |+ ...|..     |-..+|- ..--.||--.|-+.       -++|.....++|..+..+
T Consensus       237 dfRGyaGtiasG~v~~Gd~vvvlPsG~~s~V~~Ivt~dg~~~~A~aG~aVtl~L~-------deidisRGd~i~~~~~~~  309 (431)
T COG2895         237 DFRGYAGTIASGSVKVGDEVVVLPSGKTSRVKRIVTFDGELAQASAGEAVTLVLA-------DEIDISRGDLIVAADAPP  309 (431)
T ss_pred             CCCCCCEEEECCCEECCCEEEECCCCCEEEEEEEECCCCCHHHCCCCCEEEEEEC-------CEEECCCCCEEECCCCCC
T ss_conf             6210030440351405974899458970357999646871654168842899980-------002002573787068985


Q ss_pred             CCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCCCCEEEEE-------EEC-----------C---EEEEEECCCC-
Q ss_conf             22211200223037765554456871899998017887008999-------829-----------9---7999975972-
Q gi|254780151|r  299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-------RND-----------D---GVYVDFEKSE-  356 (408)
Q Consensus       299 ~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pvp~~i~-------~~~-----------~---~~~V~f~eP~-  356 (408)
                      ....-...++-|..+.+.    ..+.++.+|+  ....++++|.       .+.           |   .+.+.|++|. 
T Consensus       310 ~~~~~f~A~vvWm~~~pl----~pGr~Y~lK~--~t~~v~a~V~~i~~~ldvntl~~~~a~~l~lN~Ig~v~i~~~~pi~  383 (431)
T COG2895         310 AVADAFDADVVWMDEEPL----LPGRSYDLKI--ATRTVRARVEEIKHQLDVNTLEQEGAESLPLNEIGRVRISFDKPIA  383 (431)
T ss_pred             CHHHHCCEEEEEECCCCC----CCCCEEEEEE--CCEEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCEE
T ss_conf             522321606998437777----8884688884--1247789861127898435001000001477763599996378555


Q ss_pred             -----CCCCCCEEEEEECCCCCCCEEEEEEEECCCCCCCHHH
Q ss_conf             -----0006963899973888665888768971455530347
Q gi|254780151|r  357 -----VGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVE  393 (408)
Q Consensus       357 -----~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~~~~~~  393 (408)
                           .--+.|-+..+ |...+  --+|+|+|...-++....
T Consensus       384 fd~Y~~N~atG~FIlI-D~~tn--~TVgaGmI~~~l~~~~~~  422 (431)
T COG2895         384 FDAYAENRATGSFILI-DRLTN--GTVGAGMILASLSANTGI  422 (431)
T ss_pred             ECCCCCCCCCCCEEEE-ECCCC--CCEECEEEECHHHHCCCC
T ss_conf             0320147555647999-75878--851020351126656887


No 119
>PRK00162 glpE thiosulfate sulfurtransferase; Validated
Probab=79.49  E-value=3  Score=22.30  Aligned_cols=34  Identities=29%  Similarity=0.350  Sum_probs=25.8

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCE-EEEE
Q ss_conf             863388999960985799999999886984-9999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYD-VIGV   50 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~-V~g~   50 (408)
                      .++++.|++---+|..|..||.+|.++||+ |..+
T Consensus        55 ~~~d~~ivv~C~~G~rS~~aa~~L~~~Gf~~V~~l   89 (104)
T PRK00162         55 ADFDTPVMVMCYHGNSSQGAAQYLLQQGFDVVYSI   89 (104)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHHHHHCCCCCEEEE
T ss_conf             68889889995988189999999997376438981


No 120
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily. Unlike other rhodanese sulfurtransferases, GlpE is a single domain protein but indications are that it functions as a dimer. The active site contains a catalytically active cysteine.
Probab=78.18  E-value=3.7  Score=21.68  Aligned_cols=32  Identities=34%  Similarity=0.403  Sum_probs=24.4

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCC-EEE
Q ss_conf             86338899996098579999999988698-499
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGY-DVI   48 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~   48 (408)
                      .++++.|+|-=.+|.-|+.||..|+++|| +|.
T Consensus        53 ~~~~~~ivv~C~~G~rs~~aa~~L~~~G~~~v~   85 (96)
T cd01444          53 LDRDRPVVVYCYHGNSSAQLAQALREAGFTDVR   85 (96)
T ss_pred             HCCCCCEEEEECCCHHHHHHHHHHHHHCCCCEE
T ss_conf             568981899808966899999999982898339


No 121
>TIGR02884 spore_pdaA delta-lactam-biosynthetic de-N-acetylase; InterPro: IPR014235    Muramic delta-lactam is an unusual constituent of peptidoglycan, found only in bacterial spores, in the peptidoglycan wall or spore cortex. This entry represents a subset of the larger polysaccharide deacetylase family that is specifically involved in delta-lactam biosynthesis. PdaA from Bacillus subtilis acts immediately after CwlD, an N-acetylmuramoyl-L-alanine amidase and performs a de-N-acetylation. PdaA may also perform the subsequent transpeptidation that leads to lactam ring formation, as heterologous expression in Escherichia coli of CwlD and PdaA together is sufficient for delta-lactam production..
Probab=77.45  E-value=0.85  Score=26.22  Aligned_cols=41  Identities=32%  Similarity=0.683  Sum_probs=32.6

Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC--CCCEECCCCCCCEE
Q ss_conf             6322441126787088612000015411058888874016--87645225311025
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL--GADVLATGHYIRSR  150 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~--g~~~iATGHYar~~  150 (408)
                      ...|.--|=++|.+|-||             ..||..++.  -|.|..||||.+..
T Consensus        36 ~K~iYLTFDnGYEnGYT~-------------kILDVLKe~~V~AaFFVTghY~K~~   78 (225)
T TIGR02884        36 KKVIYLTFDNGYENGYTP-------------KILDVLKENKVPAAFFVTGHYIKTQ   78 (225)
T ss_pred             CEEEEEECCCCCCCCCCH-------------HHHHHHHCCCCCEEEEEECCCCCCC
T ss_conf             204885143553357703-------------3423320378831146407731476


No 122
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily. This CD includes the heat shock protein 67B2 of Drosophila melanogaster and other similar proteins, many of which are uncharacterized.
Probab=77.43  E-value=3  Score=22.34  Aligned_cols=32  Identities=31%  Similarity=0.463  Sum_probs=24.5

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             88863388999960985799999999886984
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      .+..++..|++-=.+|+-|+.|+.+|++.||.
T Consensus        61 ~~~~~~~~iv~yC~~G~rS~~a~~~l~~~Gy~   92 (106)
T cd01519          61 PKPSKDKELIFYCKAGVRSKAAAELARSLGYE   92 (106)
T ss_pred             CCCCCCCCEEEECCCCCHHHHHHHHHHHCCCC
T ss_conf             15888996899839997399999999986998


No 123
>PRK08305 spoVFB dipicolinate synthase subunit B; Reviewed
Probab=77.30  E-value=6.2  Score=20.07  Aligned_cols=36  Identities=17%  Similarity=0.159  Sum_probs=28.0

Q ss_pred             CCCCCEEEEEECCCHHHH----HHHHHHHHCCCEEEEEEE
Q ss_conf             863388999960985799----999999886984999998
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSS----VVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSs----vaa~lL~~~G~~V~g~~m   52 (408)
                      +-+++||.+|++||+=+-    -.+..|.++|.+|..+.-
T Consensus         2 ~L~gK~I~lgvTGSiaay~kv~~~ir~L~~~GA~V~~ImS   41 (195)
T PRK08305          2 SLKGKRIGFGLTGSHCTYEEVMPQIEKLVAEGAEVRPIVS   41 (195)
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             7689889999672799899999999999987996999975


No 124
>COG0821 gcpE 1-hydroxy-2-methyl-2-(e)-butenyl 4-diphosphate synthase [Lipid metabolism]
Probab=77.22  E-value=6.2  Score=20.05  Aligned_cols=90  Identities=14%  Similarity=0.198  Sum_probs=58.8

Q ss_pred             CHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE-CCHHHHHHHHCCCCCHHH
Q ss_conf             857999999-998869849999987047876655557788189999999999980995898-170788663224411267
Q gi|254780151|r   30 GVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV-FDYEERFRNAVIVPFASS  107 (408)
Q Consensus        30 GVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~-~d~~~~f~~~V~~~~~~~  107 (408)
                      -||++++-. -|.++|.|++-++.               +..++-+-..++++++.+|+-. +.|.-.+--.+.+.-++.
T Consensus        34 Dv~aTv~QI~~L~~aG~dIVRvtv---------------~~~e~A~A~~~Ik~~~~vPLVaDiHf~~rla~~~~~~g~~k   98 (361)
T COG0821          34 DVEATVAQIKALERAGCDIVRVTV---------------PDMEAAEALKEIKQRLNVPLVADIHFDYRLALEAAECGVDK   98 (361)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEEC---------------CCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCCCE
T ss_conf             179999999999981897899936---------------99789999999998479987987305689999756427426


Q ss_pred             HHCCCCCCCEECCCCEEEHHHHHHHHCCCCCC
Q ss_conf             87088612000015411058888874016876
Q gi|254780151|r  108 YAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD  139 (408)
Q Consensus       108 y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~  139 (408)
                      |+-    ||--.=++. +|..+.+.|++.|..
T Consensus        99 ~RI----NPGNig~~~-~v~~vVe~Ak~~g~p  125 (361)
T COG0821          99 VRI----NPGNIGFKD-RVREVVEAAKDKGIP  125 (361)
T ss_pred             EEE----CCCCCCCHH-HHHHHHHHHHHCCCC
T ss_conf             987----786567367-799999999975998


No 125
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=77.14  E-value=6.2  Score=20.04  Aligned_cols=55  Identities=16%  Similarity=0.224  Sum_probs=37.3

Q ss_pred             EEECCCCCCEEEEE-EECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEEC
Q ss_conf             98017887008999-829979999759720006963899973888665888768971
Q gi|254780151|r  329 KIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIIS  384 (408)
Q Consensus       329 kiR~~~~pvp~~i~-~~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~  384 (408)
                      ++-.....+.+++. ..++.+.+.|++|.-+ -+||-.|+-...-..-|.+|+|+|-
T Consensus       355 ~~~~gTa~~~g~v~~~~~~~~~l~L~~Pv~~-~~g~Rf~i~rr~~~r~rtIG~G~i~  410 (410)
T PRK04000        355 MLNVGTATTVGVVTSAKKDEAEVKLKRPVCA-EEGSRVAISRRVGGRWRLIGYGIIK  410 (410)
T ss_pred             EEEEECCCEEEEEEECCCCEEEEEECCCEEC-CCCCEEEEEEECCCCEEEEEEEEEC
T ss_conf             9998116278999977898799996943636-8899899998359953787258969


No 126
>pfam07894 DUF1669 Protein of unknown function (DUF1669). This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this.
Probab=77.13  E-value=6.2  Score=20.04  Aligned_cols=11  Identities=45%  Similarity=0.607  Sum_probs=6.1

Q ss_pred             HHHHHHHHHHC
Q ss_conf             78989999741
Q gi|254780151|r  197 KESVRDLAREM  207 (408)
Q Consensus       197 K~eVR~~A~~~  207 (408)
                      |+.||++-++.
T Consensus       136 Ke~vRr~I~~A  146 (284)
T pfam07894       136 KEVVRRMIQEA  146 (284)
T ss_pred             HHHHHHHHHHC
T ss_conf             99999999632


No 127
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only]
Probab=77.12  E-value=6.2  Score=20.04  Aligned_cols=13  Identities=31%  Similarity=0.478  Sum_probs=7.7

Q ss_pred             CCCCCCCCEEEEE
Q ss_conf             7200069638999
Q gi|254780151|r  355 SEVGVASGQACVF  367 (408)
Q Consensus       355 P~~aiAPGQ~~Vf  367 (408)
                      -.-||-|||.--|
T Consensus       343 gI~GI~~G~Tk~~  355 (382)
T COG1103         343 GIHGIQPGQTKYF  355 (382)
T ss_pred             CCCCCCCCCEEEE
T ss_conf             8665066751378


No 128
>COG1957 URH1 Inosine-uridine nucleoside N-ribohydrolase [Nucleotide transport and metabolism]
Probab=76.85  E-value=6.3  Score=19.99  Aligned_cols=59  Identities=19%  Similarity=0.305  Sum_probs=47.8

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEE
Q ss_conf             3889999609857999999998869-8499999870478766555577881899999999999809---9589
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHY   88 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~   88 (408)
                      .+||++=-.+|+|-++|..++.... .|+.|++.-.          |-|.-++...+|+.+++.+|   ||.+
T Consensus         2 ~~kiiiD~DpG~DDaiAlllal~~p~i~l~giTtv~----------GNv~le~t~~Na~~~l~~~g~~~iPV~   64 (311)
T COG1957           2 MRKIIIDCDPGHDDAIALLLALASPEIDLLGITTVA----------GNVPLEQTTRNALSVLELLGRADIPVY   64 (311)
T ss_pred             CCEEEEECCCCHHHHHHHHHHHCCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             834999689972289999999619876089998850----------763685999999999997397798742


No 129
>PRK12736 elongation factor Tu; Reviewed
Probab=76.45  E-value=6.5  Score=19.91  Aligned_cols=112  Identities=12%  Similarity=0.153  Sum_probs=51.5

Q ss_pred             EEECCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCCCCCCEEECCCEECCCCCC--CCCCCCCEEEEEEEECCCCCCEE
Q ss_conf             3102334335657786137631755312565235554222112002230377655--54456871899998017887008
Q gi|254780151|r  262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF--EDAVVDGFKCFVKIRSSQDPVPV  339 (408)
Q Consensus       262 yTIGQRkGL~i~~~eP~YVv~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~--~~~~~~~~~~~vkiR~~~~pvp~  339 (408)
                      -.-|||.+|++..-+     ..+.....|+..+....-.+.+ -..+.|+.....  ......+.++  ++-.+...+++
T Consensus       269 a~aG~~v~l~L~gid-----~~~i~rG~vL~~~~~~~p~~~f-~A~i~il~~~~~~~~~pi~~g~~~--~~~~~t~~v~~  340 (394)
T PRK12736        269 GQAGDNVGVLLRGVD-----RDEVERGQVLAKPGSIKPHTKF-KAEVYILTKEEGGRHTPFFTNYRP--QFYFRTTDVTG  340 (394)
T ss_pred             CCCCCEEEEEECCCC-----HHHCCCEEEEECCCCCCCCCEE-EEEEEEEECCCCCCCCCCCCCCEE--EEEEEECEEEE
T ss_conf             047678999976899-----8996716699669988987099-999999824566665540178279--99997356999


Q ss_pred             EEEEEC--------CE--EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             999829--------97--999975972000696389997388866588876897145
Q gi|254780151|r  340 FVQRND--------DG--VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       340 ~i~~~~--------~~--~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      ++...+        +.  +.++|++|. .+-+|+--+|=++    ++-+|+|+|.+-
T Consensus       341 ~i~l~~~~~~l~~Gd~a~v~l~l~~Pi-~~e~g~RFvlRd~----g~Tig~G~V~~v  392 (394)
T PRK12736        341 SIELPEGTEMVMPGDNVTITVELIHPI-AMEQGLKFAIREG----GRTVGAGVVTEI  392 (394)
T ss_pred             EEEECCCCCCCCCCCEEEEEEEECCEE-EECCCCEEEEEEC----CEEEEEEEEEEE
T ss_conf             999458973408999899999989728-7656998999989----957999999998


No 130
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated
Probab=75.77  E-value=6.5  Score=19.90  Aligned_cols=33  Identities=30%  Similarity=0.473  Sum_probs=25.9

Q ss_pred             CCCEEEEEECCCHHHH---HHHHHHHHCCCEEEEEE
Q ss_conf             3388999960985799---99999988698499999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSS---VVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va~SGGVDSs---vaa~lL~~~G~~V~g~~   51 (408)
                      +++||++|.|||+-.-   -.+.+|+++|++|..+-
T Consensus         3 ~gK~IllgVtGsIAayK~~~L~r~L~k~G~~V~vvm   38 (392)
T PRK05579          3 AGKRIVLGVSGGIAAYKALELVRRLRKAGADVRVVM   38 (392)
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             999899998337999999999999987899899998


No 131
>TIGR00977 LeuA_rel 2-isopropylmalate synthase/homocitrate synthase family protein; InterPro: IPR005675    This model represents largely uncharacterised proteins related to 2-isopropylmalate synthases and homocitrate synthases but phylogenetically distinct. ; GO: 0046912 transferase activity transferring acyl groups acyl groups converted into alkyl on transfer, 0019752 carboxylic acid metabolic process.
Probab=75.05  E-value=0.94  Score=25.89  Aligned_cols=86  Identities=24%  Similarity=0.318  Sum_probs=63.7

Q ss_pred             HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH--HHHHCCCCEEECCHHHHHHHHCC---CCCH
Q ss_conf             579999999988698499999870478766555577881899999999--99980995898170788663224---4112
Q gi|254780151|r   31 VDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR--VCDTINVSHYVFDYEERFRNAVI---VPFA  105 (408)
Q Consensus        31 VDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~--va~~LgI~~~~~d~~~~f~~~V~---~~~~  105 (408)
                      -|..+-+  |-+++-.|+.+|=+-||-.              +.+|-+  +.+.|..=+.++.+-+.|-++|+   +.|-
T Consensus        83 ~D~~~~~--l~~A~T~~~TIFGKSWDLH--------------V~~aL~T~L~ENL~MI~dTv~YLk~~~~~VIyDAEHfF  146 (543)
T TIGR00977        83 EDKQVQA--LIKAETPVVTIFGKSWDLH--------------VLEALKTTLEENLKMIYDTVAYLKRYADEVIYDAEHFF  146 (543)
T ss_pred             CCHHHHH--HHHCCCEEEEEECCCHHHH--------------HHHHHHHHHHHHHHHHHHHHHHHHHHCCEEEEECCCCC
T ss_conf             3456789--8726981699854735788--------------88877642999999999999999872122563020024


Q ss_pred             HHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECC
Q ss_conf             67870886120000154110588888740168764522
Q gi|254780151|r  106 SSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLAT  143 (408)
Q Consensus       106 ~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iAT  143 (408)
                      |+|++    ||++.-       ..++.|.+-||||+.-
T Consensus       147 DGYka----N~eYAL-------~~L~~A~~aGAdwlVl  173 (543)
T TIGR00977       147 DGYKA----NPEYAL-------KTLKVAEKAGADWLVL  173 (543)
T ss_pred             CCCCC----CHHHHH-------HHHHHHHHCCCCEEEE
T ss_conf             63457----868999-------9999998469828999


No 132
>cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3. Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase. One member of this subgroup, the Sinorhizobium meliloti stachydrine utilization protein stcD, has been idenified as a putative N-methylproline demethylase.
Probab=74.50  E-value=7.2  Score=19.57  Aligned_cols=12  Identities=17%  Similarity=-0.036  Sum_probs=6.5

Q ss_pred             HHHHHCCCCCCE
Q ss_conf             888740168764
Q gi|254780151|r  129 LLSVTRQLGADV  140 (408)
Q Consensus       129 l~~~a~~~g~~~  140 (408)
                      -...|++-|+|.
T Consensus       146 AA~~A~~AGfDg  157 (343)
T cd04734         146 AARRCQAGGLDG  157 (343)
T ss_pred             HHHHHHHCCCCE
T ss_conf             999999739988


No 133
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily. This CD includes several putative molybdopterin synthase sulfurylases including the molybdenum cofactor biosynthetic protein (CnxF) of Aspergillus nidulans and the molybdenum cofactor synthesis protein 3 (MOCS3) of Homo sapiens. These rhodanese-like domains are found C-terminal of the ThiF and MoeZ_MoeB domains.
Probab=74.29  E-value=5.4  Score=20.45  Aligned_cols=29  Identities=31%  Similarity=0.348  Sum_probs=21.6

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             63388999960985799999999886984
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      .++..|+|-=.+|..|..||..|++.||.
T Consensus        70 ~~d~~Ivv~C~~G~rS~~Aa~~L~~~G~~   98 (122)
T cd01526          70 DKDSPIYVVCRRGNDSQTAVRKLKELGLE   98 (122)
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHCCCC
T ss_conf             89987899849996599999999981998


No 134
>PRK07313 phosphopantothenoylcysteine decarboxylase; Validated
Probab=73.06  E-value=7.3  Score=19.53  Aligned_cols=32  Identities=28%  Similarity=0.497  Sum_probs=24.7

Q ss_pred             CCEEEEEECCCHHHHHHH---HHHHHCCCEEEEEE
Q ss_conf             388999960985799999---99988698499999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVA---ALLKRDGYDVIGVT   51 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa---~lL~~~G~~V~g~~   51 (408)
                      ++||+++.|||+-.-=+.   ..|++.|++|..+-
T Consensus         2 ~K~IllgvtGsIAayK~~~lir~L~k~g~~V~vi~   36 (180)
T PRK07313          2 TKKILLAVSGSIAAYKAADLTSQLTKIGYDVTVIM   36 (180)
T ss_pred             CCEEEEEEECHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             97699999549999999999999998899599997


No 135
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 2nd repeat which does contain the putative catalytic Cys residue.
Probab=72.59  E-value=6.6  Score=19.87  Aligned_cols=32  Identities=25%  Similarity=0.299  Sum_probs=25.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCC-E-EEEE
Q ss_conf             338899996098579999999988698-4-9999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGY-D-VIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~-~-V~g~   50 (408)
                      ++..|+|-=.+|.=|..||..|+++|| + |.-+
T Consensus        65 ~~~~ivv~C~~G~RS~~aa~~L~~~G~~n~V~~l   98 (109)
T cd01533          65 PRTPIVVNCAGRTRSIIGAQSLINAGLPNPVAAL   98 (109)
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCCCEEC
T ss_conf             9985999889984999999999986998860170


No 136
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated
Probab=72.32  E-value=7.1  Score=19.63  Aligned_cols=67  Identities=24%  Similarity=0.286  Sum_probs=45.1

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE------
Q ss_conf             86338899996098579999999988698-49999987047876655557788189999999999980995898------
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV------   89 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~------   89 (408)
                      +.|++.|+|-=.+|.-|+.||..|+++|| +|.-+     ..+           -..|++       -|.|++.      
T Consensus        55 pdkd~~ivvyC~sG~RS~~Aa~~L~~~Gy~~V~~l-----~GG-----------~~aW~~-------aGlPvErp~~~~~  111 (379)
T PRK08762         55 PDHDREIVLICQSGKRSAHAAADLRELGYRRVASV-----AGG-----------TSAWRD-------AGLPLERPTLLTD  111 (379)
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCCCCEEC-----CCC-----------HHHHHH-------CCCCCCCCCCCCH
T ss_conf             89998599999998799999999997699660886-----574-----------999997-------7998555886881


Q ss_pred             -CCHHHHHHHHCCCCCHH
Q ss_conf             -17078866322441126
Q gi|254780151|r   90 -FDYEERFRNAVIVPFAS  106 (408)
Q Consensus        90 -~d~~~~f~~~V~~~~~~  106 (408)
                       -+|.++|.++++-|-+.
T Consensus       112 ~~~~~eRYsRqi~lp~iG  129 (379)
T PRK08762        112 EQDFLERYSRHLRLPQVG  129 (379)
T ss_pred             HHHHHHHHHHEECCCCCC
T ss_conf             130344312011562269


No 137
>KOG2594 consensus
Probab=72.16  E-value=8.2  Score=19.19  Aligned_cols=171  Identities=16%  Similarity=0.124  Sum_probs=83.3

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHH---H--------CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH-HH-C
Q ss_conf             8633889999609857999999998---8--------69849999987047876655557788189999999999-98-0
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLK---R--------DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC-DT-I   83 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~---~--------~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va-~~-L   83 (408)
                      -++.+.+++++|||.-|.|.+-.+.   +        -++.|.-+....|+.++...          .+--+..- +. -
T Consensus        59 ~~~sk~vLlv~~G~ssSlvlLd~vh~~l~q~k~~~~~~~~tv~v~~~~~~~~~~~~v----------~e~lq~l~~~~~~  128 (396)
T KOG2594          59 GTPSKNVLLVFDGGSSSLVLLDFVHLALKQLKNKRLRRDFTVLVLVVFQEFTDSTAV----------FEALQELIIDNIE  128 (396)
T ss_pred             CCCCCCEEEEECCCCCHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEEECCCHHHH----------HHHHHHHHHHHCC
T ss_conf             885534699951884047699999999998666532768854899998852511888----------9999999984055


Q ss_pred             CCCEEE--CCHHHHHHHHCCCCCHH-------HHHCCCCCCCEECCC-------CEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             995898--17078866322441126-------787088612000015-------41105888887401687645225311
Q gi|254780151|r   84 NVSHYV--FDYEERFRNAVIVPFAS-------SYAAGETPLPCVDCN-------RTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        84 gI~~~~--~d~~~~f~~~V~~~~~~-------~y~~G~TPNPc~~CN-------~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      ..++.+  ++..+-+.+.+..+++.       .++.=.  -||+.=-       +++|-..|..+|.+.|++.|.-||-+
T Consensus       129 ~~~~~V~~la~~~~~~~~~~~~~~~~n~El~ak~~kl~--~~~sv~~~srqDLl~~lk~kll~~vA~~~g~~~i~~g~~~  206 (396)
T KOG2594         129 WVRYVVSCLAPPEKDNHVVPVESINGNDELIAKDRKLK--LSDSVPDDSRQDLLLHLKMKLLQKVAAENGYNRIVLGDST  206 (396)
T ss_pred             CCCEEEEECCCHHHHCCCCCCCCCCCCCEEECCHHHCC--CCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECCCH
T ss_conf             54268873373576457561100378700113243304--6445664017899999999999999998599879836735


Q ss_pred             CE----EEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHH--CEEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             02----541267877316885315787873189863020221--0033425689978989999741254
Q gi|254780151|r  148 RS----RLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL--CDLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       148 r~----~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L--~~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      --    ....--.|.+..       .    |-++..++....  -+++-||.++++.|+.....--||+
T Consensus       207 t~la~~vlt~v~~GRG~s-------i----s~~v~~~d~r~~~d~~llrPLrDl~~~Ei~~y~~l~~l~  264 (396)
T KOG2594         207 TDLASHVLTAVVKGRGGS-------I----STDVQVVDKRPKGDVKLLRPLRDLLSLEITSYCLLDGLA  264 (396)
T ss_pred             HHHHHHHHHHHHHCCCCC-------C----EEHHHHHCCCCCCCCEEEHHHHHHHHHHHHHHHHHHCCC
T ss_conf             279999999998366765-------1----005445334657872000027788899999999760687


No 138
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=71.84  E-value=8.3  Score=19.14  Aligned_cols=70  Identities=17%  Similarity=0.121  Sum_probs=38.0

Q ss_pred             CCCCCEEEEEECCCHH---HHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             8633889999609857---9999999988698499999870478766555577881899999999999809958981707
Q gi|254780151|r   17 NPKDMRVVVAMSGGVD---SSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        17 ~~k~~kV~va~SGGVD---Ssvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      ..++..+-++.-|-||   |++...||.+-|.-                      .++.++..++-|+..|-.-..    
T Consensus         2 ~~~K~~l~i~~~GhVD~GKSTL~G~Ll~~~g~~----------------------~~~~~~~~~~~~~~~g~~s~~----   55 (426)
T PRK12317          2 AKEKPHLNLAVIGHVDHGKSTLVGRLLYETGAV----------------------DEHIIEEYEEEAKKKGKESFK----   55 (426)
T ss_pred             CCCCCEEEEEEEEECCCCHHHHHHHHHHHCCCC----------------------CHHHHHHHHHHHHHCCCCCCE----
T ss_conf             998978499999522876888876898772994----------------------489999999899864877521----


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             8866322441126787088612
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                         +.-++|-.-++..+|.|-+
T Consensus        56 ---~a~~~D~~~eEr~rGiTid   74 (426)
T PRK12317         56 ---FAWVMDRLKEERERGVTID   74 (426)
T ss_pred             ---EEEECCCCHHHHHCCCEEE
T ss_conf             ---4321257866875582788


No 139
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=71.70  E-value=8.4  Score=19.12  Aligned_cols=29  Identities=31%  Similarity=0.468  Sum_probs=15.4

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             338899996098579999999988698499
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      ..+||+|- -+|--...||+.|.++||+|+
T Consensus       326 tGKkVAII-GsGPAGLsaA~~Lar~G~~VT  354 (654)
T PRK12769        326 SDKRVAII-GAGPAGLACADVLTRNGVAVT  354 (654)
T ss_pred             CCCEEEEE-CCCHHHHHHHHHHHHCCCEEE
T ss_conf             89989998-977899999999997697579


No 140
>pfam02441 Flavoprotein Flavoprotein. This family contains diverse flavoprotein enzymes. This family includes epidermin biosynthesis protein, EpiD, which has been shown to be a flavoprotein that binds FMN. This enzyme catalyses the removal of two reducing equivalents from the cysteine residue of the C-terminal meso-lanthionine of epidermin to form a --C==C-- double bond. This family also includes the B chain of dipicolinate synthase a small polar molecule that accumulates to high concentrations in bacterial endospores, and is thought to play a role in spore heat resistance, or the maintenance of heat resistance. dipicolinate synthase catalyses the formation of dipicolinic acid from dihydroxydipicolinic acid. This family also includes phenylacrylic acid decarboxylase (EC:4.1.1.-).
Probab=71.52  E-value=8.4  Score=19.09  Aligned_cols=30  Identities=20%  Similarity=0.430  Sum_probs=24.6

Q ss_pred             CEEEEEECCCHHHHHHHHHH---HHCCCEEEEE
Q ss_conf             88999960985799999999---8869849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL---KRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL---~~~G~~V~g~   50 (408)
                      +||++|+||++....+..++   ++.|++|.-+
T Consensus         1 kri~l~itGs~~a~~~~~ll~~L~~~~~~v~vv   33 (118)
T pfam02441         1 KKILLGITGSSAAIKALRLLRELKKEGAEVRVI   33 (118)
T ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             979999917899999999999998789979999


No 141
>COG2910 Putative NADH-flavin reductase [General function prediction only]
Probab=70.53  E-value=8.8  Score=18.94  Aligned_cols=60  Identities=20%  Similarity=0.422  Sum_probs=39.2

Q ss_pred             CEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             8899-996098579999999988698499999870478766555577881899999999999809
Q gi|254780151|r   21 MRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        21 ~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      |||+ +|-||-+-|-.+.-.+ +.||+|+++. ++-  ......++.|.-+.|+-|-..+++.|-
T Consensus         1 mKIaiIgAsG~~Gs~i~~EA~-~RGHeVTAiv-Rn~--~K~~~~~~~~i~q~Difd~~~~a~~l~   61 (211)
T COG2910           1 MKIAIIGASGKAGSRILKEAL-KRGHEVTAIV-RNA--SKLAARQGVTILQKDIFDLTSLASDLA   61 (211)
T ss_pred             CEEEEEECCCHHHHHHHHHHH-HCCCEEEEEE-ECH--HHCCCCCCCEEECCCCCCHHHHHHHHC
T ss_conf             907899537456799999998-6798048998-076--766522353020002227456676635


No 142
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional
Probab=69.84  E-value=9.1  Score=18.84  Aligned_cols=155  Identities=19%  Similarity=0.191  Sum_probs=80.7

Q ss_pred             CCCCCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC--CCEEECCHH
Q ss_conf             86338899-996098579999999988698499999870478766555577881899999999999809--958981707
Q gi|254780151|r   17 NPKDMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN--VSHYVFDYE   93 (408)
Q Consensus        17 ~~k~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg--I~~~~~d~~   93 (408)
                      +-+.+||+ ||=-||.-|--.|    +.|.+|+|+-+                +++.++-|+.-|+..|  |.+...+.+
T Consensus        46 ~l~G~~ILDVGCGgG~lse~LA----r~Ga~VtGID~----------------S~~~I~~Ar~ha~~~~l~i~y~~~~~e  105 (233)
T PRK05134         46 GLFGKRVLDVGCGGGILSESMA----RLGATVTGIDA----------------SEENIEVARLHALESGLKIDYRQITAE  105 (233)
T ss_pred             CCCCCEEEEECCCCCHHHHHHH----HCCCEEEEECC----------------CHHHHHHHHHHHHHCCCCCEEEECCHH
T ss_conf             6689989997558971128999----67997999879----------------989999999985644345116751476


Q ss_pred             HH--HHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             88--6632244112678708861200001541105888887401687645225311025412678773168853157878
Q gi|254780151|r   94 ER--FRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        94 ~~--f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                      +.  +-..-||-.+..-----.|||...      +..+.+..+--|.=+++|=                        .+-
T Consensus       106 ~l~~~~~~~FDvV~~~EVlEHV~d~~~~------l~~~~rlLKPGG~l~lsTi------------------------Nrt  155 (233)
T PRK05134        106 ELAAEHPGQFDVVTCMEMLEHVPDPASF------IRACAKLVKPGGLVFFSTL------------------------NRN  155 (233)
T ss_pred             HHHHHCCCCEEEEEEEHHHHHCCCHHHH------HHHHHHHHCCCCEEEEECC------------------------CCC
T ss_conf             6543057863477442147753899999------9999997389914999726------------------------789


Q ss_pred             CCEEEEEEECCHHHCEEECCCCC--C----CHHHHHHHHHHCCCCCCCHHHCCCEEECCC
Q ss_conf             73189863020221003342568--9----978989999741254355111023011127
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLGD--M----KKESVRDLAREMGLDIADKSDSQDICFVQQ  225 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg~--~----~K~eVR~~A~~~gl~~a~K~eSqgICFi~~  225 (408)
                      =.||++.-+-.|.+-+ +.|-|.  +    +-+|++.++++.|+.+   .+.+|+.|-+=
T Consensus       156 ~~S~l~~i~~AEyil~-~vP~gTH~w~kFi~P~el~~~l~~~~~~~---~~~~G~~ynp~  211 (233)
T PRK05134        156 LKSYLLAIVGAEYILR-MLPKGTHDYKKFIKPSELAAWLRQAGLEV---QDIKGLTYNPL  211 (233)
T ss_pred             HHHHHHHHHHHHHHHC-CCCCCCCCHHHCCCHHHHHHHHHHCCCEE---EEEEEEEEECC
T ss_conf             8999999999988860-49999858666799999999999879957---21000799656


No 143
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated
Probab=69.73  E-value=7.3  Score=19.53  Aligned_cols=118  Identities=21%  Similarity=0.174  Sum_probs=59.3

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCC--CCCCC-CCCHHH-----HHHHHHHHHHCCCCE
Q ss_conf             8863388999960985799999999886984999998704787665--55577-881899-----999999999809958
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGS-CCAGQD-----VYDARRVCDTINVSH   87 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~--~~~~~-c~~~~d-----~~~a~~va~~LgI~~   87 (408)
                      +.-++-||+|.=-||+-|.++.||. .+|.--+++    .|.+...  +-... -.+++|     .+-|++.++.++=..
T Consensus        38 ~kL~~a~VlvvG~GGLG~~~~~yLa-aaGvG~i~i----vD~D~v~~sNL~RQil~~~~dvG~~K~~~a~~~l~~~Np~v  112 (392)
T PRK07878         38 KRLKNARVLVIGAGGLGSPTLLYLA-AAGVGTIGI----VEFDVVDESNLQRQIIHGQSDVGRSKAQSARDSIVEINPLV  112 (392)
T ss_pred             HHHHHCCEEEECCCHHHHHHHHHHH-HCCCCEEEE----ECCCCCCCCCCCCCCCCCHHHCCCCHHHHHHHHHHHHCCCC
T ss_conf             9997197899878757899999999-828975999----87899674557720056843358707999999999878985


Q ss_pred             EECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHH-HHHCCCCCCEECCC
Q ss_conf             9817078866322441126787088612000015411058888-87401687645225
Q gi|254780151|r   88 YVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL-SVTRQLGADVLATG  144 (408)
Q Consensus        88 ~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~-~~a~~~g~~~iATG  144 (408)
                      .+.-+.+.+...-...+++.|-      =-+.|--...-..|+ +.+.++|..+|--+
T Consensus       113 ~v~~~~~~l~~~n~~~li~~~D------vViD~tDN~~tR~lindac~~~~~PlV~ga  164 (392)
T PRK07878        113 NVRLHEFRLEPSNAVDLFAQYD------LILDGTDNFATRYLVNDAAVLAGKPYVWGS  164 (392)
T ss_pred             CCEEHHHCCCHHHHHHHHCCCC------EEEECCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             3121131378889876431776------898668998999999999999699879976


No 144
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. This CD aligns the 1st repeat which does not contain the putative catalytic Cys residue.
Probab=69.16  E-value=8.9  Score=18.94  Aligned_cols=32  Identities=34%  Similarity=0.435  Sum_probs=25.0

Q ss_pred             CCCEEEEEECCCHH--HHHHHHHHHHCCC-EEEEE
Q ss_conf             33889999609857--9999999988698-49999
Q gi|254780151|r   19 KDMRVVVAMSGGVD--SSVVAALLKRDGY-DVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVD--Ssvaa~lL~~~G~-~V~g~   50 (408)
                      |+..|+|-=.||..  |..||..|++.|| +|.-+
T Consensus        49 kd~~Ivvyc~~g~~~~s~~Aa~~L~~~Gy~~V~~L   83 (92)
T cd01532          49 RDTPIVVYGEGGGEDLAPRAARRLSELGYTDVALL   83 (92)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHCCCCCEEEC
T ss_conf             99829999699996299999999998699686885


No 145
>CHL00071 tufA elongation factor Tu
Probab=68.91  E-value=9.5  Score=18.71  Aligned_cols=34  Identities=18%  Similarity=0.339  Sum_probs=25.4

Q ss_pred             EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             999975972000696389997388866588876897145
Q gi|254780151|r  348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       348 ~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      +.++|+.|. ++-+|+--+|=++    ++-+|+|+|.+-
T Consensus       374 v~~~l~~Pi-~ie~g~RfilRd~----g~Tig~G~V~~v  407 (409)
T CHL00071        374 MTVELIYPI-AIEKGMRFAIREG----GRTVGAGVVSKI  407 (409)
T ss_pred             EEEEECCCE-EECCCCEEEEEEC----CEEEEEEEEEEE
T ss_conf             999989408-8765998999989----988999999998


No 146
>COG3349 Uncharacterized conserved protein [Function unknown]
Probab=68.77  E-value=7.6  Score=19.40  Aligned_cols=30  Identities=37%  Similarity=0.470  Sum_probs=24.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899996098579999999988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+|+ -||.-+..||+.|.++||+|+=+-
T Consensus         1 ~rVai~-GaG~AgL~~a~~La~~g~~vt~~e   30 (485)
T COG3349           1 MRVAIA-GAGLAGLAAAYELADAGYDVTLYE   30 (485)
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCCEEEEE
T ss_conf             928997-462788899999986898539984


No 147
>KOG3141 consensus
Probab=68.34  E-value=9.8  Score=18.63  Aligned_cols=69  Identities=19%  Similarity=0.316  Sum_probs=37.9

Q ss_pred             CCCCCEECCCCCEEEE-ECCC------------EEEEECCCCCCCCCC-----------------C------CCCEEEEC
Q ss_conf             3467110377432233-5783------------153102334335657-----------------7------86137631
Q gi|254780151|r  240 ALEGDIVHLNGQILGR-HNGI------------INYTIGQRRGLGVAM-----------------G------EPLFVVYL  283 (408)
Q Consensus       240 ~~~G~ivd~~G~viG~-H~G~------------~~yTIGQRkGL~i~~-----------------~------eP~YVv~i  283 (408)
                      .+||+.||..|..+|+ -.|.            |.-|.--|++=++++                 |      +-+-|++|
T Consensus       163 Fk~GqyVDV~g~TigkGFqGvmKR~GFkG~pasHG~sksHR~~GS~G~~~~pgRV~pGrKMpGhMG~~~rtik~LkV~kI  242 (310)
T KOG3141         163 FKPGQYVDVTGKTIGKGFQGVMKRHGFKGGPASHGTSKSHRRPGSIGQGTTPGRVWPGRKMPGHMGNEWRTIKGLKVWKI  242 (310)
T ss_pred             CCCCCEEEEEEEEECCCCCCCEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEEEEEE
T ss_conf             47875488774571555420032034467866667420144775556888876413687277645762378732399998


Q ss_pred             CCCCCEEEE-ECCCCCCCCCEEECCC
Q ss_conf             755312565-2355542221120022
Q gi|254780151|r  284 DKNSSRVIV-GPRESLEVHRIYLREI  308 (408)
Q Consensus       284 d~~~N~ViV-g~~~~L~~~~i~l~d~  308 (408)
                      |.+.|.|+| |+-+.---.-+++.|.
T Consensus       243 d~~~nvi~VkGsVpG~~g~~V~I~Da  268 (310)
T KOG3141         243 DTELNVIWVKGSVPGPKGNLVKIKDA  268 (310)
T ss_pred             CCCCEEEEEECCCCCCCCCEEEEEEC
T ss_conf             58732899935457998977998741


No 148
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase; InterPro: IPR012819   Sucrose occupies a central position in the metabolic pathways of all plants and plays a variety of roles including transport sugar, storage reserve, compatible solute, and signal compound . This compound is produced by the combined action of two enzymes, sucrose-phosphate synthase (2.4.1.14 from EC) and sucrose-phosphate phosphatase (3.1.3.24 from EC), via the intermediate sucrose 6-phosphate. Several studies have shown a positive correlation between sucrose-phosphate synthase activity and plant growth rate and yield in agronomically important plants, though direct proof of a causal link is lacking.   This entry represents sucrose-phosphate synthase from plants, which is known to exist in multigene families in several species of both monocots and dicots. The enzyme contains an N-terminal domain glucosyltransferase domain, a variable linker region, and a C-terminal domain similar to that of sucrose-phosphate phosphatase, the next and final enzyme of sucrose biosynthesis. The C-terminal domain is likely to serve a binding - not a catalytic - function, as sucrose-phosphate phosphatase is always encoded by a distinct protein. ; GO: 0046524 sucrose-phosphate synthase activity, 0005985 sucrose metabolic process.
Probab=66.41  E-value=1.1  Score=25.34  Aligned_cols=312  Identities=19%  Similarity=0.283  Sum_probs=140.0

Q ss_pred             HHHHHHHHHHCCC-C-EEECCHHHHHHHHCCCCCHHHHHCCCC-----C---------------------CCEECCCCEE
Q ss_conf             9999999998099-5-898170788663224411267870886-----1---------------------2000015411
Q gi|254780151|r   73 VYDARRVCDTINV-S-HYVFDYEERFRNAVIVPFASSYAAGET-----P---------------------LPCVDCNRTV  124 (408)
Q Consensus        73 ~~~a~~va~~LgI-~-~~~~d~~~~f~~~V~~~~~~~y~~G~T-----P---------------------NPc~~CN~~i  124 (408)
                      ++++-.+|+.|+- | .|.||+   |-++|..|=+| |.-|.=     |                     -||=-=+++|
T Consensus       198 VKYVVELARAL~~mPGVYRVDL---lTRQvssP~vD-wSYgEPtEmL~~~~~~~~~~~~~GEssGAYIiRiPfGPrdkY~  273 (1072)
T TIGR02468       198 VKYVVELARALGSMPGVYRVDL---LTRQVSSPDVD-WSYGEPTEMLSSRSESENDDDEMGESSGAYIIRIPFGPRDKYI  273 (1072)
T ss_pred             EHHHHHHHHHHHCCCCEEEEHH---HHHHCCCCCCC-CCCCCCHHHCCCCCCCCCCCCCCCCCCCEEEEECCCCCHHHHC
T ss_conf             0257668999835898366100---10000267876-6667615550644222454545567664058876888802311


Q ss_pred             EHH------------HH---HHHHCCCC---------CCEECCCCCCCEEEECC--CCCCCEEEEEECCCCCCCCEEEEE
Q ss_conf             058------------88---88740168---------76452253110254126--787731688531578787318986
Q gi|254780151|r  125 KFS------------DL---LSVTRQLG---------ADVLATGHYIRSRLYVG--DDGKRRRIMCRPMDLERDQSYFLF  178 (408)
Q Consensus       125 KF~------------~l---~~~a~~~g---------~~~iATGHYar~~~~~~--~~~~~~~~L~r~~D~~KDQSYfL~  178 (408)
                      +=.            ||   +..++.+|         ..++..||||...-...  .-.-+.+.++.|+           
T Consensus       274 ~KE~LWP~i~EFVDGAL~Hi~~mSk~LGEqiG~G~pVWP~~IHGHYADAGd~AAlLSGALNVPMvlTGH-----------  342 (1072)
T TIGR02468       274 AKEELWPYIPEFVDGALSHIVNMSKVLGEQIGSGKPVWPYVIHGHYADAGDSAALLSGALNVPMVLTGH-----------  342 (1072)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHHHCCHHHHHHCC-----------
T ss_conf             400057865137767899999999987552078842156265063004689999874110212576154-----------


Q ss_pred             EECCHHHCEEECCCCCCCHHHH--------HHHHHHCCCCCC------CHHHC--C-----CEEECCCCCCHHHHH----
Q ss_conf             3020221003342568997898--------999974125435------51110--2-----301112775103455----
Q gi|254780151|r  179 ATTQQQLCDLRFPLGDMKKESV--------RDLAREMGLDIA------DKSDS--Q-----DICFVQQGKYFDVVK----  233 (408)
Q Consensus       179 ~l~~~~L~~~~FPlg~~~K~eV--------R~~A~~~gl~~a------~K~eS--q-----gICFi~~~~~~~Fl~----  233 (408)
                      .|.++.|+.| +-.|-++|+||        |=.|+|+.|..+      .|.|=  |     |-=.+=+++.+.=.+    
T Consensus       343 sLGRdKLEQL-LkqGR~s~eeI~~tYKI~RRIEAEEL~LDasE~ViTSTrQEIeEQW~LYdGFD~~LerkLRaR~rRgVs  421 (1072)
T TIGR02468       343 SLGRDKLEQL-LKQGRLSKEEINSTYKIMRRIEAEELSLDASEIVITSTRQEIEEQWGLYDGFDVVLERKLRARARRGVS  421 (1072)
T ss_pred             CCCHHHHHHH-HHHCCCCCHHHHCHHHHHEEHHHHHHHCCCCEEEEECCCCCHHHHCCCCCCCCCEEEHHHHHCCCCCCC
T ss_conf             3342369999-971467813442100121000034432011000100444213751565477520110102211126864


Q ss_pred             ---HCCCC--CCCCCCEECCCCCEEE--EECCCEEE-EECCCCCCC--CC------------CCCC--CEEEECCCCCCE
Q ss_conf             ---30766--4346711037743223--35783153-102334335--65------------7786--137631755312
Q gi|254780151|r  234 ---RINAG--IALEGDIVHLNGQILG--RHNGIINY-TIGQRRGLG--VA------------MGEP--LFVVYLDKNSSR  289 (408)
Q Consensus       234 ---~~~~~--~~~~G~ivd~~G~viG--~H~G~~~y-TIGQRkGL~--i~------------~~eP--~YVv~id~~~N~  289 (408)
                         ||.|-  ...||-=.   ..|.-  .|+|=.-- |-|....=.  .|            ..+|  +-+..=||++|.
T Consensus       422 C~GRfMPRM~vIPPGmeF---~~i~~~~~~d~d~~~~~~~~~~~~~~~~PpIWseimRFftnp~KPmILALaRPDPkKNi  498 (1072)
T TIGR02468       422 CYGRFMPRMAVIPPGMEF---SHIVPQEDHDGDMDTETEGNEESSAKADPPIWSEIMRFFTNPRKPMILALARPDPKKNI  498 (1072)
T ss_pred             CCCCCCCCCEECCCCCCC---CCCCCCCCCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEECCCCCCCCHH
T ss_conf             246527732004879654---41023577755313443213356777878417889986318898779732687873014


Q ss_pred             EEE----EC-CC--CCCCCCEEEC------CCEECCCCCCC--CCCCCCEEEEEEEE----CCCCCCEEEEEE--ECCEE
Q ss_conf             565----23-55--5422211200------22303776555--44568718999980----178870089998--29979
Q gi|254780151|r  290 VIV----GP-RE--SLEVHRIYLR------EINWLGDGLFE--DAVVDGFKCFVKIR----SSQDPVPVFVQR--NDDGV  348 (408)
Q Consensus       290 ViV----g~-~~--~L~~~~i~l~------d~nWi~~~~~~--~~~~~~~~~~vkiR----~~~~pvp~~i~~--~~~~~  348 (408)
                      =++    |+ +|  +|..=.+.++      +++=.+.....  -.+.+...++-||=    |.|..||-.-+.  .-.|+
T Consensus       499 TTLvKAFGECRpLRELANLtLImGNRD~IDems~~~~sVL~svLkLID~YDLYGqVAYPKHHkqsDVP~IYRLAAktKGV  578 (1072)
T TIGR02468       499 TTLVKAFGECRPLRELANLTLIMGNRDDIDEMSSGSASVLTSVLKLIDKYDLYGQVAYPKHHKQSDVPDIYRLAAKTKGV  578 (1072)
T ss_pred             HHHHHHHCCCCCHHHHHHHHHHHCCCCCHHHHHCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHCCCCE
T ss_conf             77887633786146776577441475223545155558999999886200356554677678888872488997427965


Q ss_pred             E--EEECCC-----CCCCCCCEEEEEECCC--CCCCEEEEEEEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             9--997597-----2000696389997388--86658887689714555303477888762456
Q gi|254780151|r  349 Y--VDFEKS-----EVGVASGQACVFYTSD--SNEARVLGGGIISGSKRSDAVEESLLSVIGDE  403 (408)
Q Consensus       349 ~--V~f~eP-----~~aiAPGQ~~VfY~~D--~~~~~vLGGGiI~~t~~~~~~~~~~~~~~~~~  403 (408)
                      -  ..|-||     .-|-|-|=-.|-=.+-  |+=.++|-=|......-..|+.+..|+.++|-
T Consensus       579 FINPA~~EPFGLTLIEAAa~GLP~VATKNGGPVDI~~vL~NGLLvDPHdq~aIa~ALLkLvadK  642 (1072)
T TIGR02468       579 FINPALIEPFGLTLIEAAAYGLPMVATKNGGPVDIHRVLDNGLLVDPHDQEAIADALLKLVADK  642 (1072)
T ss_pred             EECCCCCCCCCHHHHHHHHCCCCEEEECCCCCHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             7523210456436899986399779835868133887731787336776688999999986215


No 149
>cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily. This CD includes the putative rhodanese-like protein, Psp2, of Yersinia pestis biovar Medievalis and other similar uncharacterized proteins.
Probab=66.12  E-value=6.5  Score=19.88  Aligned_cols=32  Identities=28%  Similarity=0.246  Sum_probs=17.7

Q ss_pred             CCCCCCEEEEEECCC--HHHHHHHHHHHHCCCEE
Q ss_conf             886338899996098--57999999998869849
Q gi|254780151|r   16 KNPKDMRVVVAMSGG--VDSSVVAALLKRDGYDV   47 (408)
Q Consensus        16 ~~~k~~kV~va~SGG--VDSsvaa~lL~~~G~~V   47 (408)
                      ..++++.|+|--+||  -.|+.||..|.++||+|
T Consensus        60 ~l~~d~~iVvyC~~~~~~~s~~aA~~L~~~Gf~V   93 (110)
T cd01521          60 KLDKEKLFVVYCDGPGCNGATKAALKLAELGFPV   93 (110)
T ss_pred             HCCCCCEEEEEECCCCCCCHHHHHHHHHHCCCCE
T ss_conf             6799971899978998641799999999779974


No 150
>cd02654 nuc_hydro_CjNH nuc_hydro_CjNH. Nucleoside hydrolases similar to Campylobacter jejuni nucleoside hydrolase.  This group contains eukaryotic and bacterial proteins similar to C. jejuni nucleoside hydrolase. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. C. jejuni nucleoside hydrolase is inactive against natural nucleosides or against common nucleoside analogues.
Probab=65.55  E-value=11  Score=18.26  Aligned_cols=53  Identities=19%  Similarity=0.371  Sum_probs=37.3

Q ss_pred             EEEEEEC----CCHHHHHHHHHHHH-CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             8999960----98579999999988-698499999870478766555577881899999999999809
Q gi|254780151|r   22 RVVVAMS----GGVDSSVVAALLKR-DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        22 kV~va~S----GGVDSsvaa~lL~~-~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      ||++=..    .|+|-++|..++.. .-.||.|++.-.          |-|..++..+++.++.+.+|
T Consensus         1 KvIiDtD~~~g~gvDDa~Al~lal~~p~iel~gIT~v~----------GN~~~~~~~~N~~~~L~~~g   58 (318)
T cd02654           1 KVILDNDIAMGRDTDDGLALALLLWSPEVELLGLSAVS----------GNCWLSAVTYNVLRMLELAG   58 (318)
T ss_pred             CEEEECCCCCCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             98997989999683999999999878998399999967----------98889999999999999819


No 151
>KOG0117 consensus
Probab=64.80  E-value=4.8  Score=20.86  Aligned_cols=124  Identities=15%  Similarity=0.212  Sum_probs=62.8

Q ss_pred             HHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCC
Q ss_conf             99999980995898170788663224411267870886120000154110588888740168764522531102541267
Q gi|254780151|r   76 ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGD  155 (408)
Q Consensus        76 a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~  155 (408)
                      -.-+|+..| +.  ++++     ...|||- .-.+|-.  =-..||+..    -.+..+.++..-|-+|-..++..+...
T Consensus       100 LvplfEkiG-~I--~elR-----LMmD~~s-G~nRGYA--FVtf~~Ke~----Aq~Aik~lnn~Eir~GK~igvc~Svan  164 (506)
T KOG0117         100 LVPLFEKIG-KI--YELR-----LMMDPFS-GDNRGYA--FVTFCTKEE----AQEAIKELNNYEIRPGKLLGVCVSVAN  164 (506)
T ss_pred             HHHHHHHCC-CE--EEEE-----EEECCCC-CCCCCEE--EEEEECHHH----HHHHHHHHHCCCCCCCCEEEEEEEEEC
T ss_conf             678886405-32--5788-----7524667-8875438--999704899----999999840731458977678876304


Q ss_pred             CCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCC--C-------CCCCHHHCCCEEECCC-
Q ss_conf             87731688531578787318986302022100334256899789899997412--5-------4355111023011127-
Q gi|254780151|r  156 DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMG--L-------DIADKSDSQDICFVQQ-  225 (408)
Q Consensus       156 ~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~g--l-------~~a~K~eSqgICFi~~-  225 (408)
                         .  .|.-|.-++                       ..+|+||++.+++.+  +       .-++|.-..|.|||.- 
T Consensus       165 ---~--RLFiG~IPK-----------------------~k~keeIlee~~kVteGVvdVivy~~p~dk~KNRGFaFveYe  216 (506)
T KOG0117         165 ---C--RLFIGNIPK-----------------------TKKKEEILEEMKKVTEGVVDVIVYPSPDDKTKNRGFAFVEYE  216 (506)
T ss_pred             ---C--EEEECCCCC-----------------------CCCHHHHHHHHHHHCCCEEEEEEECCCCCCCCCCCEEEEEEE
T ss_conf             ---2--367536886-----------------------423899999998617874689972586644445633899860


Q ss_pred             -CCCHHHHHHCCCCCCCCCCEE
Q ss_conf             -751034553076643467110
Q gi|254780151|r  226 -GKYFDVVKRINAGIALEGDIV  246 (408)
Q Consensus       226 -~~~~~Fl~~~~~~~~~~G~iv  246 (408)
                       ....+.-++.+-    +|.|.
T Consensus       217 ~H~~Aa~aRrKl~----~g~~k  234 (506)
T KOG0117         217 SHRAAAMARRKLM----PGKIK  234 (506)
T ss_pred             CCHHHHHHHHHCC----CCCEE
T ss_conf             4155899986426----88445


No 152
>TIGR03099 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, exosortase system type 1 associated. The sequences in this family contain the pyridoxal binding domain (pfam02784) and C-terminal sheet domain (pfam00278) of a family of Pyridoxal-dependent decarboxylases. Characterized enzymes in this family decarboxylate substrates such as ornithine, diaminopimelate and arginine. The genes of the family modeled here, with the exception of those observed in certain Burkholderia species, are all found in the context of exopolysaccharide biosynthesis loci containing the exosortase/PEP-CTERM protein sorting system. More specifically, these are characteristic of the type 1 exosortase system represented by the Genome Property GenProp0652. The substrate of these enzymes may be a precursor of the carrier or linker which is hypothesized to release the PEP-CTERM protein from the exosortase enzyme. These enzymes are apparently most closely related to the diaminopimelate decarboxylase modeled by TIGR01048
Probab=64.70  E-value=11  Score=18.15  Aligned_cols=28  Identities=11%  Similarity=0.043  Sum_probs=16.7

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             577881899999999999809958981707886
Q gi|254780151|r   64 KGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        64 ~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .+.|.+.++++.|.+    .|| ...+|-.+|.
T Consensus        99 ~gp~K~~~~l~~A~~----~gv-~i~vDS~~El  126 (398)
T TIGR03099        99 AGPGKTDAELRRALA----AGV-LINVESLREL  126 (398)
T ss_pred             CCCCCCHHHHHHHHH----CEE-EEEECCHHHH
T ss_conf             899879799998875----605-9964446889


No 153
>cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily. This CD includes putative rhodanese-related sulfurtransferases which contain 4 copies of the Rhodanese Homology Domain. Only the second and most of the fourth repeats contain the putative catalytic Cys residue. This CD aligns the 1st , 2nd, 3rd, and 4th repeats.
Probab=64.65  E-value=11  Score=18.14  Aligned_cols=33  Identities=21%  Similarity=0.113  Sum_probs=26.4

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCC-EEEE
Q ss_conf             86338899996098579999999988698-4999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGY-DVIG   49 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g   49 (408)
                      +.++.+|+|-=.+|.-|..||..|++.|| +|.-
T Consensus        53 ~~~~~~ivv~C~~G~Rs~~Aa~~L~~~G~~~V~~   86 (96)
T cd01529          53 PGRATRYVLTCDGSLLARFAAQELLALGGKPVAL   86 (96)
T ss_pred             CCCCCEEEEECCCCCHHHHHHHHHHHCCCCCEEE
T ss_conf             8999979998699846999999999858988099


No 154
>PRK06249 2-dehydropantoate 2-reductase; Provisional
Probab=64.16  E-value=12  Score=18.08  Aligned_cols=34  Identities=24%  Similarity=0.350  Sum_probs=27.3

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             88633889999609857999999998869849999
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +.++++||+|-=.|++-|.+++. |.++|++|+-+
T Consensus         1 M~~~~~kI~IiGaGAiG~~~a~~-L~~aG~~V~li   34 (313)
T PRK06249          1 MDSETPRIAIIGTGAIGGFYGAM-LARAGFDVHFL   34 (313)
T ss_pred             CCCCCCEEEEECCCHHHHHHHHH-HHHCCCCEEEE
T ss_conf             99998889999914999999999-99669956999


No 155
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated
Probab=64.05  E-value=11  Score=18.25  Aligned_cols=115  Identities=15%  Similarity=0.062  Sum_probs=56.8

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCC--CCC-CCCCHH-----HHHHHHHHHHHCCCCEE
Q ss_conf             8633889999609857999999998869849999987047876655--557-788189-----99999999998099589
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK--RKG-SCCAGQ-----DVYDARRVCDTINVSHY   88 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~--~~~-~c~~~~-----d~~~a~~va~~LgI~~~   88 (408)
                      .-++-||+|.=-||+-|.++.||. .+|.--+++.    |.+....  -.. .--+++     -.+-|++.+..++=...
T Consensus        25 ~L~~s~VlvvG~GGLG~~~~~yLa-~aGvG~i~i~----D~D~ve~sNL~RQ~l~~~~~iG~~K~~~a~~~l~~~np~i~   99 (355)
T PRK05597         25 SLFDAKVSVIGAGGLGSPALLYLA-GAGVGHITII----DDDVVDLSNLHRQVIHTTAGVGTPKAESAREAMLALNPDVK   99 (355)
T ss_pred             HHHCCCEEEECCCHHHHHHHHHHH-HCCCCEEEEE----ECCCCCCCHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             986296899877766899999999-8499759997----29992612133775654121797979999999998789974


Q ss_pred             ECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHH-HHHCCCCCCEEC
Q ss_conf             817078866322441126787088612000015411058888-874016876452
Q gi|254780151|r   89 VFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL-SVTRQLGADVLA  142 (408)
Q Consensus        89 ~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~-~~a~~~g~~~iA  142 (408)
                      +.-+.+.+...-...++..|      .=-+.|--..+-..|+ +.+..++..+|-
T Consensus       100 i~~~~~~l~~~na~~li~~~------DvVvD~tDn~~tR~lind~c~~~~~PlV~  148 (355)
T PRK05597        100 VTVSVRRLDWSNALSELADA------DVILDGSDNFDTRHVASWAAARLGIPHVW  148 (355)
T ss_pred             EEEEHHHCCHHHHHHHHHCC------CEEEECCCCHHHHHHHHHHHHHHCCCEEE
T ss_conf             27533215777899775288------78987678888999999999986998799


No 156
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain. This domain is believed to serve as a polysulfide binding and transferase domain in anaerobic gram-negative bacteria, functioning in oxidative phosphorylation with polysulfide-sulfur as a terminal electron acceptor. The active site contains the same conserved cysteine that is the catalytic residue in other Rhodanese Homology Domain proteins.
Probab=62.60  E-value=11  Score=18.34  Aligned_cols=29  Identities=21%  Similarity=0.265  Sum_probs=20.2

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             63388999960985799999999886984
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      .++++|++-=-+|.-|+.|+.+|+++||+
T Consensus        59 ~~~~~iv~~C~~G~RS~~aa~~L~~~Gy~   87 (103)
T cd01447          59 AEDKPFVFYCASGWRSALAGKTLQDMGLK   87 (103)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHCCCC
T ss_conf             88887999869980599999999985984


No 157
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ. One of the well-described hopanoid intermediates is bacteriohopanetetrol. In the conversion from hopene several reactions must occur in the side chain for which a radical mechanism might be reasonable. These include the four (presumably anaerobic) hydroxylations and a methyl shift.
Probab=62.05  E-value=13  Score=17.82  Aligned_cols=28  Identities=29%  Similarity=0.368  Sum_probs=10.2

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             899996098579999999988698499999
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |++=||--+++=--.+.+.  ..+|+++++
T Consensus        48 ~~iDa~~~~~~~~~~~~~~--~~~d~v~i~   75 (472)
T TIGR03471        48 RLVDAPPHGVTIDDTLAIA--KDYDLVVLH   75 (472)
T ss_pred             CEEECCCCCCCHHHHHHHH--CCCCEEEEE
T ss_conf             3752776689989999985--069989999


No 158
>cd02650 nuc_hydro_CaPnhB NH_hydro_CaPnhB: A subgroup of nucleoside hydrolases similar to Corynebacterium ammoniagenes Purine/pyrimidine nucleoside hydrolase (pnhB). Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity.
Probab=61.97  E-value=13  Score=17.81  Aligned_cols=53  Identities=19%  Similarity=0.317  Sum_probs=40.3

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             8999960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      ||++=-..|+|-++|..++... -.+|.|++.-.          |-|..++....|.++.+.+|
T Consensus         1 KviiDtD~GiDD~~Al~~al~~p~iel~gIT~v~----------GN~~~~~~~~na~~~l~~~g   54 (304)
T cd02650           1 KLILDTDPGIDDAMALAYALAHPDVDLIGVTTVY----------GNVTIETATRNALALLELFG   54 (304)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             9899899977999999999778998799999975----------88778999999999999848


No 159
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms]
Probab=61.73  E-value=13  Score=17.78  Aligned_cols=66  Identities=17%  Similarity=0.204  Sum_probs=32.6

Q ss_pred             CEEEEEECCCHHHHH----HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             889999609857999----99999886984999998704787665555778818999999999998099589817
Q gi|254780151|r   21 MRVVVAMSGGVDSSV----VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        21 ~kV~va~SGGVDSsv----aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      .+|+|++||+-.|.-    |+.+..+..-.-+.+|+.+.......+.     ..+-+..+.++|+.||-...++.
T Consensus       249 e~ilvcI~~~~~~e~liR~a~RlA~~~~a~~~av~v~~~~~~~~~~~-----~~~~l~~~~~Lae~lGae~~~l~  318 (890)
T COG2205         249 ERILVCISGSPGSEKLIRRAARLASRLHAKWTAVYVETPELHRLSEK-----EARRLHENLRLAEELGAEIVTLY  318 (890)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCHH-----HHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             61899978998638999999999997289769999825664444377-----99999999999998388699983


No 160
>pfam03686 UPF0146 Uncharacterized protein family (UPF0146). The function of this family of proteins is unknown.
Probab=61.71  E-value=8.8  Score=18.95  Aligned_cols=76  Identities=20%  Similarity=0.304  Sum_probs=46.5

Q ss_pred             HHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCC
Q ss_conf             99999988698499999870478766555577881899999999999809958981707886632244112678708861
Q gi|254780151|r   35 VVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETP  114 (408)
Q Consensus        35 vaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TP  114 (408)
                      -+|..|++.|++|++.-.   +..                     +-..|+++.        .++||+|-++-|+..-- 
T Consensus        27 ~vA~~L~~~g~dv~~tDi---~~~---------------------av~~gl~~v--------~DDif~P~~~lY~~A~l-   73 (127)
T pfam03686        27 DVAKRLAERGFDVLATDI---NEK---------------------AVPEGLRFV--------VDDITNPNISIYEGADL-   73 (127)
T ss_pred             HHHHHHHHCCCCEEEEEC---CCC---------------------CCCCCCCEE--------ECCCCCCCHHHHCCCCE-
T ss_conf             999999985996899977---765---------------------766788878--------72588989889558788-


Q ss_pred             CCEECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             200001541105888887401687645225
Q gi|254780151|r  115 LPCVDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       115 NPc~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                      -=-++|-+.+ ...+++.|++.|++.+-+-
T Consensus        74 IYSIRPp~El-~~~i~~lA~~v~a~liI~P  102 (127)
T pfam03686        74 IYSIRPPPEL-QSAILDVAKAVGAPLYIKP  102 (127)
T ss_pred             EEECCCCHHH-HHHHHHHHHHCCCCEEEEC
T ss_conf             9981898788-8999999998199899984


No 161
>PRK12721 secretion system apparatus protein SsaU; Reviewed
Probab=61.14  E-value=13  Score=17.71  Aligned_cols=54  Identities=13%  Similarity=0.145  Sum_probs=33.4

Q ss_pred             CCCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCC-
Q ss_conf             687645225--31102541267877316885315787873189863020221003342568997898999974125435-
Q gi|254780151|r  136 LGADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIA-  212 (408)
Q Consensus       136 ~g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a-  212 (408)
                      -.+|.|.|-  |||=.-.++......-..+.+|.|.               +           -..||++|++.|+|+- 
T Consensus       254 ~~AdvVitNPTH~AVAL~Y~~~~~~aP~vvAKG~d~---------------~-----------A~~Ir~~A~~~~vPive  307 (349)
T PRK12721        254 KKSTAVVRNPTHIAVCLGYHPGETPLPRVLEKGSDA---------------Q-----------ALYIVNLAERNGIPVVE  307 (349)
T ss_pred             CCCCEEEECCCHHHHHHHCCCCCCCCCEEEEECCCH---------------H-----------HHHHHHHHHHCCCCEEC
T ss_conf             999889988652764000268899999888853859---------------9-----------99999999987997862


Q ss_pred             CHH
Q ss_conf             511
Q gi|254780151|r  213 DKS  215 (408)
Q Consensus       213 ~K~  215 (408)
                      +++
T Consensus       308 n~~  310 (349)
T PRK12721        308 NIP  310 (349)
T ss_pred             CHH
T ss_conf             879


No 162
>cd02653 nuc_hydro_3 NH_3: A subgroup of nucleoside hydrolases. This group contains eukaryotic and bacterial proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity.
Probab=60.80  E-value=13  Score=17.67  Aligned_cols=57  Identities=23%  Similarity=0.398  Sum_probs=43.2

Q ss_pred             EEEEEECCCHHHHHHHHHH-HHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEE
Q ss_conf             8999960985799999999-88698499999870478766555577881899999999999809---9589
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALL-KRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHY   88 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL-~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~   88 (408)
                      ||++=-..|+|-++|..++ +..-.+|.|++.-.          |-|..++..+.|.++.+.+|   ||.+
T Consensus         1 KvIiDtD~G~DDa~Al~lal~~p~~ev~gITtv~----------GN~~~~~~~~Na~~~l~~~g~~diPV~   61 (320)
T cd02653           1 KVIIDCDPGIDDALALLYLLASPDLDVVGITTTA----------GNVPVEQVAANALGVLELLGRTDIPVY   61 (320)
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             9899999977999999999768998799999958----------987899999999999998389999889


No 163
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism]
Probab=60.42  E-value=11  Score=18.40  Aligned_cols=32  Identities=38%  Similarity=0.504  Sum_probs=26.3

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             86338899996098579999999988698499
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      .+++.+|+|==+.|.-|..||..|+++||..+
T Consensus        58 ~~~~~~ivv~C~~G~rS~~aa~~L~~~G~~~~   89 (110)
T COG0607          58 LPDDDPIVVYCASGVRSAAAAAALKLAGFTNV   89 (110)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHCCCCCC
T ss_conf             46798699999997558999999998699751


No 164
>PRK08118 topology modulation protein; Reviewed
Probab=60.15  E-value=10  Score=18.43  Aligned_cols=56  Identities=14%  Similarity=0.167  Sum_probs=35.3

Q ss_pred             HHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCE
Q ss_conf             9999999980995898170788663224411267870886120000154110588888740168764522531102
Q gi|254780151|r   74 YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRS  149 (408)
Q Consensus        74 ~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~  149 (408)
                      .-|+++++.+|||++.+|  +.||.           .|-++.|.-      .|...++.+-+ +-.||.-|.|.++
T Consensus        16 TlAr~L~~~~~ip~~~LD--~l~w~-----------~~w~~~~~~------e~~~~~~~~~~-~~~WIidGny~~~   71 (167)
T PRK08118         16 TLARQLGEKLNIPVHHLD--ALFWK-----------PNWEGVPKE------EQRTVQNELVK-EDEWIIDGNYGGT   71 (167)
T ss_pred             HHHHHHHHHHCCCEEECC--CEEEC-----------CCCCCCCHH------HHHHHHHHHHH-CCCEEEECCCHHH
T ss_conf             999999998896979644--34766-----------899468889------99999999983-8987994771779


No 165
>cd00455 nuc_hydro nuc_hydro: Nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity.  This group contains eukaryotic, bacterial and archeal proteins similar to the inosine-uridine preferring nucleoside hydrolase from Crithidia fasciculata,  the xanthosine-inosine-uridine-adenosine-preferring nucleoside hydrolase RihC from Salmonella enterica serovar Typhimurium, the purine-specific  inosine-adenosine-guanosine-preferring nucleoside hydrolase from Trypanosoma vivax and, pyrimidine-specific uridine-cytidine preferring nucleoside hydrolases such as URH1 from Saccharomyces cerevisiae, RihA and RihB from Escherichia coli. Nucleoside hydrolases are of interest as a target for antiprotozoan drugs as, no nucleoside hydrolase activity or genes encoding these enzymes have been detected in humans and, parasitic protozoans lack de novo purine synthesis relying on nucleosid
Probab=59.97  E-value=14  Score=17.57  Aligned_cols=51  Identities=12%  Similarity=0.260  Sum_probs=38.3

Q ss_pred             EEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             99960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      ++=-..|+|-++|..++... ..||.|++--.          |-|+.++..+++.++.+.+|
T Consensus         2 IiDtD~GiDDa~Al~lal~~p~~ev~gIT~v~----------GN~~~~~~~~N~~~~l~~~g   53 (295)
T cd00455           2 ILDTDPGIDDAFALMYALLHPEIELVGIVATY----------GNVTLEQATQNAAYLLELLG   53 (295)
T ss_pred             EEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             89898977999999999778998899999966----------98889999999999999828


No 166
>pfam03853 YjeF_N YjeF-related protein N-terminus.
Probab=59.96  E-value=14  Score=17.57  Aligned_cols=64  Identities=22%  Similarity=0.275  Sum_probs=42.5

Q ss_pred             CCCCEEEEEEC---CCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             63388999960---9857999999998869849999987047876655557788189999999999980995898170
Q gi|254780151|r   18 PKDMRVVVAMS---GGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        18 ~k~~kV~va~S---GGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      ++..||+|-..   -|=|--++|.+|++.|++|.-+.+.   ..+        ...+|...+.+.+++++++....+.
T Consensus        26 ~~~~~v~il~G~GNNGGDGlv~Ar~L~~~g~~V~v~~~~---~~~--------~~~~~~~~~~~~~~~~~~~~~~~~~   92 (170)
T pfam03853        26 PAGKRVLVLCGPGNNGGDGLAAARHLAQRGYKVTVLLLN---PDE--------KLSEDARRALEIAKKLGGKIVSLNP   92 (170)
T ss_pred             CCCCEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEEEEC---CCC--------CCCHHHHHHHHHHHHCCCCEEECCC
T ss_conf             778869999879987288999999999879907999967---855--------5999999999999986996761586


No 167
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria. In this system, EII is a lactose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. The IIC and IIB domains are expressed as a single protein from the lac operon. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include lactose, chitobiose/lichenan, ascorbate, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.
Probab=59.91  E-value=14  Score=17.56  Aligned_cols=72  Identities=13%  Similarity=0.092  Sum_probs=37.5

Q ss_pred             CEEEEEECCCHHHHHHHHHHHH----CCCEEEEEEEECCCCCCCCCCCC----CCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             8899996098579999999988----69849999987047876655557----788189999999999980995898170
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKR----DGYDVIGVTLQLYNSRKASKRKG----SCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~----~G~~V~g~~m~~~~~~~~~~~~~----~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      |||++.=|||--|++.|.-+++    +|.++..--.-.....+.-..-.    .-.-.--..+.++.|+.+|||+..+..
T Consensus         1 ~kVLl~Ca~GmSSs~la~~m~k~A~~~gi~~~i~A~~~~~~~d~~~~yDvilLaPQv~~~~~~lk~~ad~~Gi~v~~i~~   80 (99)
T cd05565           1 LNVLVLCAGGGTSGLLANALNKGAKERGVPLEAAAGAYGSHYDMIPDYDLVILAPQMASYYDELKKDTDRLGIKLVTTTG   80 (99)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHHHHCCCEEEECHHHHHHHHHHHHHHHHCCCEEEEECH
T ss_conf             90999907988589999999999998199769995103448988707999999850888899999999983991887083


No 168
>PRK08655 prephenate dehydrogenase; Provisional
Probab=59.65  E-value=14  Score=17.53  Aligned_cols=47  Identities=28%  Similarity=0.514  Sum_probs=29.7

Q ss_pred             CEE-EEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             889-9996098579999999988698499999870478766555577881899999999999809958
Q gi|254780151|r   21 MRV-VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        21 ~kV-~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      ||| +||=+|+.-... |.+|+.+||+|.-.     +              +|+..++.+|+.||+.+
T Consensus         1 mkI~IIGG~G~MG~~F-a~~f~~sGyeV~I~-----g--------------Rd~~k~~~va~~LGv~~   48 (441)
T PRK08655          1 MKISIIGGTGGLGKWF-ARFLKDKGYEVIVW-----G--------------RDPKKGKEVAKELGVEY   48 (441)
T ss_pred             CEEEEEECCCHHHHHH-HHHHHHCCCEEEEE-----E--------------CCCCHHHHHHHHHCCCC
T ss_conf             9799994798177999-99998679889998-----1--------------57313567888738622


No 169
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776    This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea . The oxaloacetate decarboxylase Na+ pump is the paradigm of the family of Na+ transport decarboxylases that present in bacteria and archaea. It a multi subunit enzyme consisting of a peripheral alpha-subunit and integral membrane subunits beta and gamma. The energy released by the decarboxylation reaction of oxaloacetate is coupled to Na+ ion pumping across the membrane.; GO: 0008948 oxaloacetate decarboxylase activity, 0006814 sodium ion transport.
Probab=59.39  E-value=3.9  Score=21.49  Aligned_cols=208  Identities=23%  Similarity=0.305  Sum_probs=100.2

Q ss_pred             CCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CCE----------
Q ss_conf             3889999-6098579999999988698499999870478766555577881899999999999809-958----------
Q gi|254780151|r   20 DMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-VSH----------   87 (408)
Q Consensus        20 ~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-I~~----------   87 (408)
                      +-||+|. .=||-=|=+- .-||||+-         -|.-           ++-++++-+|=+.|| |||          
T Consensus       286 D~RiLv~QvPGGM~SNL~-~QLkEQna---------~DkL-----------d~VL~EiPrVreDLGYpPLVTPTSQIVGt  344 (616)
T TIGR01108       286 DSRILVSQVPGGMLSNLE-SQLKEQNA---------LDKL-----------DEVLEEIPRVREDLGYPPLVTPTSQIVGT  344 (616)
T ss_pred             CCEEEEEECCCHHHHHHH-HHHHHHHH---------HHHH-----------HHHHHHCCCCHHHCCCCCCCCCCCCEEEE
T ss_conf             844899736880688999-99986237---------5578-----------88874157412326765697787521345


Q ss_pred             ---EECCHHHHHHHHCCCCCHHHHHC---CCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEE
Q ss_conf             ---98170788663224411267870---886120000154110588888740168764522531102541267877316
Q gi|254780151|r   88 ---YVFDYEERFRNAVIVPFASSYAA---GETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRR  161 (408)
Q Consensus        88 ---~~~d~~~~f~~~V~~~~~~~y~~---G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~  161 (408)
                         .-|=+=|+|+  ++..=...|.+   |+||.||-.        .|.+++..                   ++.-...
T Consensus       345 QAvlNVL~GERYk--~iT~ET~~~~kG~YGrtPApi~~--------~L~~k~L~-------------------~ekl~~i  395 (616)
T TIGR01108       345 QAVLNVLTGERYK--TITKETKDYVKGEYGRTPAPIDA--------ELVKKILG-------------------DEKLKPI  395 (616)
T ss_pred             EEEEEEEECCCHH--HHHHHHHHHHCCCCCCCCCCCCH--------HHHHHHHC-------------------CCCCCCC
T ss_conf             6677423145114--88999999848898887977798--------99998614-------------------4443686


Q ss_pred             EEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC---CCCCCHHHHHHCCCC
Q ss_conf             88531578787318986302022100334256899789899997412543551110230111---277510345530766
Q gi|254780151|r  162 IMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV---QQGKYFDVVKRINAG  238 (408)
Q Consensus       162 ~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi---~~~~~~~Fl~~~~~~  238 (408)
                      +.||+.|..+           ..|.++        +.|+|+.+.+.|+..|+.-|- ||-.+   |.. =..||+++...
T Consensus       396 ~~~RPADlL~-----------pELdk~--------~~E~~~~g~~~GiTLa~~s~E-DvL~yAlFP~~-G~~FL~~R~~~  454 (616)
T TIGR01108       396 LDCRPADLLE-----------PELDKL--------RAEVREAGIEKGITLAEESDE-DVLLYALFPQV-GKKFLENRKNG  454 (616)
T ss_pred             CEECCCCCCH-----------HHHHHH--------HHHHHHHHHHCCCCCCCCCHH-HHHHHHHHHHH-HHHHHHHHHCC
T ss_conf             2016723663-----------379999--------999999987616402346435-77888862036-79998735306


Q ss_pred             CCCCCCEECCCCCEEEE---ECCCEEEEE--CCCCCCCCCC------CCCCEEEECCCCCCEEEEECCCCC
Q ss_conf             43467110377432233---578315310--2334335657------786137631755312565235554
Q gi|254780151|r  239 IALEGDIVHLNGQILGR---HNGIINYTI--GQRRGLGVAM------GEPLFVVYLDKNSSRVIVGPRESL  298 (408)
Q Consensus       239 ~~~~G~ivd~~G~viG~---H~G~~~yTI--GQRkGL~i~~------~eP~YVv~id~~~N~ViVg~~~~L  298 (408)
                      ...|-+-+......=++   .--..||.+  |..--.++..      ...-|-+.+|=...+|-|.+....
T Consensus       455 ~~~~~PP~~~~~~~~~~teck~~~EF~~~~Hg~~~~~~~~~~~~~~~~~~~y~v~~~G~~~~V~v~p~~~~  525 (616)
T TIGR01108       455 ELIEEPPVAFEEKPEEKTECKVMSEFDKILHGENEHVQVAGKGEETHASQSYTVEVDGKAFVVKVQPGGDV  525 (616)
T ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCCCCCCCCCEEEEEECCEEEEEECCCCCEE
T ss_conf             65678887756667776321022212223314554124000021144751799998677657512454000


No 170
>KOG0622 consensus
Probab=58.41  E-value=15  Score=17.39  Aligned_cols=72  Identities=26%  Similarity=0.308  Sum_probs=39.6

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH-HCCCCCHHHHHCCCCCCCEECCCCEEEHHH-------HHHHHCCC
Q ss_conf             7788189999999999980995898170788663-224411267870886120000154110588-------88874016
Q gi|254780151|r   65 GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN-AVIVPFASSYAAGETPLPCVDCNRTVKFSD-------LLSVTRQL  136 (408)
Q Consensus        65 ~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~-~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~-------l~~~a~~~  136 (408)
                      +.|-+-++++.|    ..-|+..-++|-++|-.. ...-|=.+-..+=-|+-+-..|+-.+|||+       |++.|+++
T Consensus       130 npcK~~s~IkyA----a~~gV~~~tfDne~el~kv~~~hP~a~llLrIatdds~a~~~l~~KFG~~~~~~~~lLd~ak~l  205 (448)
T KOG0622         130 NPCKQVSQIKYA----AKHGVSVMTFDNEEELEKVAKSHPNANLLLRIATDDSTATCRLNLKFGCSLDNCRHLLDMAKEL  205 (448)
T ss_pred             CCCCCHHHHHHH----HHCCCEEEEECCHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
T ss_conf             787519999999----9759707862589999999974997338999736887455556675687778999999999871


Q ss_pred             CCCE
Q ss_conf             8764
Q gi|254780151|r  137 GADV  140 (408)
Q Consensus       137 g~~~  140 (408)
                      |..-
T Consensus       206 ~lnv  209 (448)
T KOG0622         206 ELNV  209 (448)
T ss_pred             CCEE
T ss_conf             8658


No 171
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit; InterPro: IPR006275   Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates , . CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate . The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC).   Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain . CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites . The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain.   Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein . The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP . There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia . CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains .    This entry represents glutamine-dependent CPSase (6.3.5.5 from EC) from prokaryotes and eukaryotes (CPSase II). ; GO: 0004086 carbamoyl-phosphate synthase activity, 0006807 nitrogen compound metabolic process.
Probab=57.36  E-value=15  Score=17.27  Aligned_cols=19  Identities=16%  Similarity=0.358  Sum_probs=11.2

Q ss_pred             HHHHHHHCCCCCCEECCCC
Q ss_conf             8888874016876452253
Q gi|254780151|r  127 SDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       127 ~~l~~~a~~~g~~~iATGH  145 (408)
                      +.+++-|.+...|.||-|-
T Consensus       768 dky~e~A~E~dVD~v~Dg~  786 (1089)
T TIGR01369       768 DKYLEDAVEIDVDAVSDGE  786 (1089)
T ss_pred             EEECCCCEEEEEEEEEECC
T ss_conf             8852888899998997288


No 172
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional
Probab=56.90  E-value=15  Score=17.22  Aligned_cols=116  Identities=15%  Similarity=0.206  Sum_probs=68.8

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEE
Q ss_conf             99999999980995898170788663224411267870886120000154110588888740168764522531102541
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLY  152 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~  152 (408)
                      ++.-++.|+.+||.++.+++.+.=.                            -..|++...+++.|-=.+|=-.+.-..
T Consensus        51 v~~K~k~a~~~Gi~~~~~~l~~~~s----------------------------~~el~~~I~~LN~d~~V~GIiVQlPLP  102 (288)
T PRK10792         51 VASKRKACEEVGFVSRSYDLPETTS----------------------------EAELLALIDTLNADNTIDGILVQLPLP  102 (288)
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCC----------------------------HHHHHHHHHHHHCCCCCCCEEEECCCC
T ss_conf             9999999997599799986688999----------------------------999999999996799878637836899


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCC---CHHHHHHHHHHCCCCCCCHHHCCCEEECCCCC
Q ss_conf             2678773168853157878731898630202210033425689---97898999974125435511102301112775
Q gi|254780151|r  153 VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM---KKESVRDLAREMGLDIADKSDSQDICFVQQGK  227 (408)
Q Consensus       153 ~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~---~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~  227 (408)
                         ++-....++.+.++.||    .-++++.-+.++...--.+   |-.-|.++.+.++++++.|    .++-||+.+
T Consensus       103 ---~~id~~~i~~~I~p~KD----VDGl~~~N~G~L~~~~~~~~PcTp~av~~lL~~y~i~~~Gk----~vvVvGrS~  169 (288)
T PRK10792        103 ---AGIDNVKVLERIHPDKD----VDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTFGL----NAVVIGASN  169 (288)
T ss_pred             ---CCCCHHHHHHHCCCCCC----CCCCCHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCC----EEEEECCCC
T ss_conf             ---88577999851498889----88799889987706998667871999999999747563788----899956766


No 173
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated
Probab=56.89  E-value=15  Score=17.22  Aligned_cols=60  Identities=17%  Similarity=0.175  Sum_probs=36.6

Q ss_pred             CCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE--EECCHHH
Q ss_conf             63388999-96098579999999988698499999870478766555577881899999999999809958--9817078
Q gi|254780151|r   18 PKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH--YVFDYEE   94 (408)
Q Consensus        18 ~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~--~~~d~~~   94 (408)
                      -+++.|+| |=|+|+-.++|-.|+ ++|++|+.+..                .++.++.+.+..+.++...  ...|+++
T Consensus         3 L~~Kv~lITGgs~GIG~a~a~~la-~~G~~V~~~~r----------------~~~~l~~~~~~~~~~~~~~~~~~~Dl~~   65 (246)
T PRK05653          3 LQGKTALVTGASRGIGRAIALRLA-ADGARVVIYDS----------------NEEAAEALAEELRAAGGEAALLVFDVTD   65 (246)
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             899889993897589999999999-87999999979----------------9999999999999659948999972899


No 174
>PRK09074 consensus
Probab=56.89  E-value=9.8  Score=18.63  Aligned_cols=18  Identities=28%  Similarity=0.482  Sum_probs=13.0

Q ss_pred             EEEEECCCHHHHHHHHHH
Q ss_conf             999960985799999999
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALL   40 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL   40 (408)
                      =++++|||.++-+.-+++
T Consensus       135 GLI~Lsg~~~g~v~~~l~  152 (1149)
T PRK09074        135 GLIALTGGPDGPIGRLLA  152 (1149)
T ss_pred             CEEEEECCCCCHHHHHHH
T ss_conf             979993896676999987


No 175
>COG1908 FrhD Coenzyme F420-reducing hydrogenase, delta subunit [Energy production and conversion]
Probab=56.17  E-value=16  Score=17.14  Aligned_cols=106  Identities=20%  Similarity=0.273  Sum_probs=61.9

Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEEE-CCCHHHHHHHHHHHHC--CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             655544434678886338899996-0985799999999886--9849999987047876655557788189999999999
Q gi|254780151|r    4 SEATRLNSLDLDKNPKDMRVVVAM-SGGVDSSVVAALLKRD--GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC   80 (408)
Q Consensus         4 ~~~~~~~~~~~~~~~k~~kV~va~-SGGVDSsvaa~lL~~~--G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va   80 (408)
                      |-|.-|.-+.=.++|.+.||+=-| ||-||-+..+..|++-  |.=|.|..+     ++.....|.--+++-.+.++++.
T Consensus        13 ygaaDlag~~rmqyp~~vRiIrv~CsGrvn~~fvl~Al~~GaDGV~v~GC~~-----geCHy~~GN~ka~rR~~~lke~l   87 (132)
T COG1908          13 YGAADLAGTSRMQYPPNVRIIRVMCSGRVNPEFVLKALRKGADGVLVAGCKI-----GECHYISGNYKAKRRMELLKELL   87 (132)
T ss_pred             CCCHHHHCCCCCCCCCCEEEEEEECCCCCCHHHHHHHHHCCCCEEEEECCCC-----CCEEEECCCHHHHHHHHHHHHHH
T ss_conf             6520021335564898437999632674189999999973898689934415-----61233016647999999999999


Q ss_pred             HHCCCCEEECC-----HH--HHHHHHCCCCCHHHHHCCCCCCC
Q ss_conf             98099589817-----07--88663224411267870886120
Q gi|254780151|r   81 DTINVSHYVFD-----YE--ERFRNAVIVPFASSYAAGETPLP  116 (408)
Q Consensus        81 ~~LgI~~~~~d-----~~--~~f~~~V~~~~~~~y~~G~TPNP  116 (408)
                      +.|||.-..+.     ..  +.|- +.++.|++..+ -+-|||
T Consensus        88 ~elgie~eRv~~~wiSa~E~ekf~-e~~~efv~~i~-~lGpnp  128 (132)
T COG1908          88 KELGIEPERVRVLWISAAEGEKFA-ETINEFVERIK-ELGPNP  128 (132)
T ss_pred             HHHCCCCCEEEEEEEEHHHHHHHH-HHHHHHHHHHH-HHCCCC
T ss_conf             994888442789997233688899-99999999999-729986


No 176
>PRK12772 bifunctional flagellar biosynthesis protein FliR/FlhB; Provisional
Probab=55.71  E-value=16  Score=17.09  Aligned_cols=49  Identities=18%  Similarity=0.302  Sum_probs=23.4

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             87645225--3110254126787731688531578787318986302022100334256899789899997412543
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      .+|.|.|-  |||=.-.++......-..+.+|.|.-                          -..+|++|++.++|+
T Consensus       518 ~AdVVitNPTH~AVALkYd~~~~~AP~VvAKG~d~~--------------------------A~~IreiA~e~~vPi  568 (609)
T PRK12772        518 DATVVVTNPTHIAVALKYEKGKDTAPKVVAKGADYV--------------------------ALKIKEIAKENEVPI  568 (609)
T ss_pred             CCCEEEECCCHHHEEEEECCCCCCCCEEEEECCCHH--------------------------HHHHHHHHHHCCCCE
T ss_conf             899898873336404343689999998886178599--------------------------999999999869987


No 177
>pfam01156 IU_nuc_hydro Inosine-uridine preferring nucleoside hydrolase.
Probab=55.32  E-value=16  Score=17.05  Aligned_cols=54  Identities=19%  Similarity=0.336  Sum_probs=41.4

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             88999960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      +||++=-..|+|-++|..+|..+ -++|.|++.-.          |-|+.++....|.++.+.+|
T Consensus         1 ~kvIiDtD~G~DDa~Al~~al~~~~~~l~git~~~----------Gn~~~~~~~~n~~~~l~~~g   55 (303)
T pfam01156         1 RKVILDTDPGIDDALALLLALASPELDLLGITTVA----------GNVPLEKTTRNALRLLELLG   55 (303)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             94999899974899999999669998899999925----------98689999999999999838


No 178
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT). This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes. Thiopurine S-methyltransferase (TPMT) is a cytosolic enzyme that catalyses S-methylation of aromatic and heterocyclic sulfhydryl compounds, including anticancer and immunosuppressive thiopurines.
Probab=55.22  E-value=16  Score=17.03  Aligned_cols=32  Identities=31%  Similarity=0.569  Sum_probs=24.7

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             63388999960985799999999886984999998
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      +...||+|=+.|-   +.-+..|.++||+|+|+=+
T Consensus        21 ~~~~rvlVPlCGk---s~D~~wLa~~G~~VvGvel   52 (203)
T pfam05724        21 PPGLRVLVPLCGK---ALDMVWLAEQGHFVVGVEI   52 (203)
T ss_pred             CCCCEEEEECCCC---HHHHHHHHHCCCEEEEEEC
T ss_conf             9998899968998---5999999838984899956


No 179
>TIGR01511 ATPase-IB1_Cu copper-translocating P-type ATPase; InterPro: IPR006403   ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (F-, V- and A-ATPases contain rotary motors) and in the type of ions they transport , .  F-ATPases (F1F0-ATPases) in mitochondria, chloroplasts and bacterial plasma membranes are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases) are primarily found in eukaryotic vacuoles, catalysing ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases) are found in Archaea and function like F-ATPases. P-ATPases (E1E2-ATPases) are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   P-ATPases (sometime known as E1-E2 ATPases) (3.6.3.- from EC) are found in bacteria and in a number of eukaryotic plasma membranes and organelles . P-ATPases function to transport a variety of different compounds, including ions and phospholipids, across a membrane using ATP hydrolysis for energy. There are many different classes of P-ATPases, each of which transports a specific type of ion: H^+, Na^+, K^+, Mg^2+, Ca^2+, Ag^+ and Ag^2+, Zn^2+, Co^2+, Pb^2+, Ni^2+, Cd^2+, Cu^+ and Cu^2+. P-ATPases can be composed of one or two polypeptides, and can usually assume two main conformations called E1 and E2.   This entry represents P-type ATPases that specialise in cation and copper transport; those transporting copper (3.6.3.4 from EC) have been classified as belonging to the IB subfamily , , . These proteins are involved in a variety of processes in both prokaryotes and eukaryotes. Some of these P-ATPases import copper into cells, such as in Arabidopsis sp., which require copper to create functional hormone receptors for ethylene signalling. Other P-ATPases are involved in copper export out of cells, such as occurs with the efflux of hepatic copper into the bile in eukaryotes. In bacteria, some of these P-ATPases play a role in osmotic adaptation. Certain copper ATPases have been implicated in both Wilson and Menkes diseases .   More information about this protein can be found at Protein of the Month: ATP Synthases .; GO: 0004008 copper-exporting ATPase activity, 0005524 ATP binding, 0046872 metal ion binding, 0046873 metal ion transmembrane transporter activity, 0030001 metal ion transport, 0016020 membrane.
Probab=55.14  E-value=16  Score=17.03  Aligned_cols=12  Identities=42%  Similarity=0.437  Sum_probs=8.7

Q ss_pred             HHCCCEEEEEEE
Q ss_conf             886984999998
Q gi|254780151|r   41 KRDGYDVIGVTL   52 (408)
Q Consensus        41 ~~~G~~V~g~~m   52 (408)
                      |+.|..|+|=++
T Consensus       135 K~~Gd~ViaGt~  146 (545)
T TIGR01511       135 KKVGDTVIAGTV  146 (545)
T ss_pred             CCCCCEEEEEEE
T ss_conf             278887999888


No 180
>COG0452 Dfp Phosphopantothenoylcysteine synthetase/decarboxylase [Coenzyme metabolism]
Probab=54.63  E-value=17  Score=16.97  Aligned_cols=31  Identities=26%  Similarity=0.507  Sum_probs=24.8

Q ss_pred             CCEEEEEECCCHHH---HHHHHHHHHCCCEEEEE
Q ss_conf             38899996098579---99999998869849999
Q gi|254780151|r   20 DMRVVVAMSGGVDS---SVVAALLKRDGYDVIGV   50 (408)
Q Consensus        20 ~~kV~va~SGGVDS---svaa~lL~~~G~~V~g~   50 (408)
                      .++|+|+.|||+.+   .-.+..|.++|++|.-+
T Consensus         4 ~k~ill~v~gsiaayk~~~l~r~L~~~ga~v~vv   37 (392)
T COG0452           4 GKRILLGVTGSIAAYKSVELVRLLRRSGAEVRVV   37 (392)
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             7638999417333446789999876279736897


No 181
>COG0163 UbiX 3-polyprenyl-4-hydroxybenzoate decarboxylase [Coenzyme metabolism]
Probab=54.02  E-value=17  Score=16.90  Aligned_cols=32  Identities=25%  Similarity=0.285  Sum_probs=25.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHH---HHCCCEEEEEE
Q ss_conf             388999960985799999999---88698499999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALL---KRDGYDVIGVT   51 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL---~~~G~~V~g~~   51 (408)
                      .||++||+||.--.-++..||   +++|+|++-+-
T Consensus         2 ~~riivgisGASG~iygvrlLe~L~~~~~e~hlvi   36 (191)
T COG0163           2 MKRIIVGISGASGAIYGVRLLEVLRELGVETHLVI   36 (191)
T ss_pred             CCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             82799997366428999999999974695699998


No 182
>PRK10490 sensor protein KdpD; Provisional
Probab=53.98  E-value=17  Score=16.90  Aligned_cols=68  Identities=12%  Similarity=0.116  Sum_probs=36.3

Q ss_pred             CCCEEEEEECCCHHHHH----HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             33889999609857999----99999886984999998704787665555778818999999999998099589817
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSV----VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsv----aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      -..||+|++|++-.|.-    ++.+....+-+-+.+|+..-.......     ...+.+....+.|++||-..+++-
T Consensus       249 ~~e~ilv~~~~~~~~~~lir~~~r~a~~~~~~~~~~~v~~~~~~~~~~-----~~~~~~~~~~~LAe~LGa~v~~l~  320 (895)
T PRK10490        249 TRDAILLCIGHNTGSEKLVRTAARLAARLGSVWHAVYVETPRLHRLPE-----KKRRAILSALRLAQELGAETATLS  320 (895)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEEEECCCCCCCCH-----HHHHHHHHHHHHHHHHCCEEEEEE
T ss_conf             676299998899874699999999998479986999996444457987-----789999999999998199899983


No 183
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated
Probab=53.97  E-value=17  Score=16.90  Aligned_cols=100  Identities=15%  Similarity=0.263  Sum_probs=57.9

Q ss_pred             EEEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             89999609857999999-99886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-++++|.|.-...++. -+.+.|-+|+..- ..+              .-...-.......+||....+|..+      
T Consensus        77 ~~a~~~sSGmaAi~~~ll~~l~~Gd~iv~~~-~~Y--------------ggt~~l~~~~l~~~Gi~~~~vd~~d------  135 (391)
T PRK08133         77 EACVATASGMAAILSVVMALLQAGDHVVSSR-SLF--------------GSTLSLFEKIFARFGIETTFVDLTD------  135 (391)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCCEEEECC-CCC--------------CCHHHHHHHHHHCCCEEEEECCCCC------
T ss_conf             7599965889999999998457999899678-974--------------5389999987410784444679879------


Q ss_pred             CCCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEECCCCC
Q ss_conf             44112678708861200001-----54110---588888740168764522531
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~iATGHY  146 (408)
                          ++++++..+||.++..     |+.++   +.++.+.|++.|+-.|.--.+
T Consensus       136 ----~~~~~~ai~~~T~lv~~EtpsNP~l~v~Di~~i~~iA~~~g~~~vVDNT~  185 (391)
T PRK08133        136 ----LDAWRAAVRPNTKLFFLETPSNPLTELADIAALAEIAHAAGALLVVDNCF  185 (391)
T ss_pred             ----HHHHHHHCCCCCEEEEEECCCCCCCEEECCHHHHHHHHHCCCEEEEECCC
T ss_conf             ----99999745878459999789999866555399999987558759987897


No 184
>PRK06767 methionine gamma-lyase; Provisional
Probab=53.78  E-value=17  Score=16.88  Aligned_cols=97  Identities=20%  Similarity=0.300  Sum_probs=57.5

Q ss_pred             EEEEEECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             899996098579999999--988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .-.+++|.|. +++++.+  |.+.|-+|+.-. ..+           -+   ...-...+...+||....+|..+.    
T Consensus        77 ~~a~~~sSGm-aAi~~~ll~~l~~Gd~vv~~~-~~Y-----------g~---T~~l~~~~~~~~gI~~~~~d~~~~----  136 (386)
T PRK06767         77 EEALAFGSGM-AAISATLIGFLKAGDHIICSN-GLY-----------GC---TYGFLEVLEEKFMITHSFCDMETE----  136 (386)
T ss_pred             CEEEEECCHH-HHHHHHHHHCCCCCCEEEECC-CCC-----------CC---HHHHHHHHHHHCCEEEEEECCCCH----
T ss_conf             7168852789-999999973079999899837-982-----------23---466999988873758999689888----


Q ss_pred             CCCCCHHHHHCCCCCCCEEC-----CCCEEE---HHHHHHHHCCCCCCEECCC
Q ss_conf             24411267870886120000-----154110---5888887401687645225
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVD-----CNRTVK---FSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~-----CN~~iK---F~~l~~~a~~~g~~~iATG  144 (408)
                            ++.++-.+||..+.     +|+..+   ..++.+.|++.|+-.+.--
T Consensus       137 ------~~~~~~i~~~Tklv~~EspsNP~l~v~Di~~i~~~A~~~g~~~vvDN  183 (386)
T PRK06767        137 ------ADIENKIRPNTKLIFVETPINPTMKLIDLKQVIRVAKRNGLLVIVDN  183 (386)
T ss_pred             ------HHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEEC
T ss_conf             ------99997568882599997799987671279999998600673499745


No 185
>COG0458 CarB Carbamoylphosphate synthase large subunit (split gene in MJ) [Amino acid transport and metabolism / Nucleotide transport and metabolism]
Probab=53.45  E-value=17  Score=16.84  Aligned_cols=221  Identities=15%  Similarity=0.167  Sum_probs=102.1

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .|+|..+--|.---+-|+..|++.||.|+-+-.     +....-       .|.        .+....|+.....+|-..
T Consensus         5 ~i~Igqa~efdysG~qac~aLkeeg~~vvlvns-----npAti~-------td~--------e~AD~~y~eP~~~E~v~~   64 (400)
T COG0458           5 PIVIGQAAEFDYSGTQACKALKEEGYGVVLVNS-----NPATIM-------TDP--------ELADKVYIEPITKEPVEK   64 (400)
T ss_pred             CEEEEEEEEECHHHHHHHHHHHHCCCEEEEECC-----CCCCCC-------CCC--------CCCCEEEEECCCHHHHHH
T ss_conf             606676411143678999999866975999728-----872124-------780--------005302662473788999


Q ss_pred             CCCC-CHH---HHHCCCCCCCEECCCCEEEHHHHHH--HHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             2441-126---7870886120000154110588888--740168764522531102541267877316885315787873
Q gi|254780151|r  100 VIVP-FAS---SYAAGETPLPCVDCNRTVKFSDLLS--VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus       100 V~~~-~~~---~y~~G~TPNPc~~CN~~iKF~~l~~--~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      ++.. -.|   -..-|.|+-+|..        .|-+  .+.+.|...|+|+-=|               +-.+.|..   
T Consensus        65 Ii~~E~~Dailp~~ggqt~Ln~~~--------~l~e~g~l~~~gV~vvgs~~ea---------------I~iaeDr~---  118 (400)
T COG0458          65 IIEKERPDAILPTLGGQTALNAAL--------ELKEKGVLEKYGVEVVGSDPEA---------------IEIAEDKK---  118 (400)
T ss_pred             HHHHCCCCEEECCCCCCCHHHHHH--------HHHHHCCHHHCCCEEEECCHHH---------------HHHHHHHH---
T ss_conf             997537662632468741346889--------9877264564497799458789---------------55642099---


Q ss_pred             EEEEEEECCHHHCEEECCCC---CCCHHHHHHHHHHCCCCCCCHH-HCCC---EEECC-CCCCHHHHHHCCCCCCCCCCE
Q ss_conf             18986302022100334256---8997898999974125435511-1023---01112-775103455307664346711
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLG---DMKKESVRDLAREMGLDIADKS-DSQD---ICFVQ-QGKYFDVVKRINAGIALEGDI  245 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg---~~~K~eVR~~A~~~gl~~a~K~-eSqg---ICFi~-~~~~~~Fl~~~~~~~~~~G~i  245 (408)
                            +..+.++.+=.|.-   .-+-.+..+.+.+.|+|+--|| .++|   -=++- ..++..+....+..++-    
T Consensus       119 ------~fke~m~eigi~~P~~~~~~~~e~~~~~~~ig~PvIVrP~~~lGG~G~~i~~n~eel~~~~~~~l~~s~~----  188 (400)
T COG0458         119 ------LFKEAMREIGIPVPSRIAHSVEEADEIADEIGYPVIVKPSFGLGGSGGGIAYNEEELEEIIEEGLRASPV----  188 (400)
T ss_pred             ------HHHHHHHHCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCEEEEECHHHHHHHHHHCCCCCCC----
T ss_conf             ------9999999839998841235677776557636997798068578887516871899999998732244764----


Q ss_pred             ECCCCCEEEEECCCEEEEECCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCCCCCCEEECCCEECCC
Q ss_conf             03774322335783153102334335657786137631755312565235554222112002230377
Q gi|254780151|r  246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD  313 (408)
Q Consensus       246 vd~~G~viG~H~G~~~yTIGQRkGL~i~~~eP~YVv~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~  313 (408)
                          .+++      ..      +-+ .++.+--|++--|.+.|.++|++.+.+....+...|-.-..+
T Consensus       189 ----~~vl------~e------esi-~G~ke~e~ev~rd~~~n~ivvc~men~dp~gvhtgdsi~vap  239 (400)
T COG0458         189 ----EEVL------IE------ESI-IGWKEFEYEVVRDGKDNCIVVCNMENLDPMGVHTGDSITVAP  239 (400)
T ss_pred             ----CCCE------EE------EEE-CCCEEEEEEEEEECCCCEEEEEECCCCCCCCCCCCCEEEECC
T ss_conf             ----2001------24------421-685699999998379987999867865656644432365214


No 186
>pfam08959 DUF1872 Domain of unknown function (DUF1872). The CS domain, found in Ubiquitin specific peptidase 19 (USP-19), has no known function.
Probab=53.24  E-value=18  Score=16.82  Aligned_cols=30  Identities=17%  Similarity=0.228  Sum_probs=14.0

Q ss_pred             EEEEEEEECCCCCCEEEEEEECCEEEEEEC
Q ss_conf             189999801788700899982997999975
Q gi|254780151|r  324 FKCFVKIRSSQDPVPVFVQRNDDGVYVDFE  353 (408)
Q Consensus       324 ~~~~vkiR~~~~pvp~~i~~~~~~~~V~f~  353 (408)
                      |+-.||.|++-.|-.|...+....+-|.|.
T Consensus       139 F~WqvkLrnlI~Peqc~y~ft~SriDI~Lk  168 (288)
T pfam08959       139 FRWQVKLRNLIEPEQCSYCFTPSRLDITLK  168 (288)
T ss_pred             EEEEEEEECCCCCCCEEEEECCCEEEEEEH
T ss_conf             998867500136201157713530454410


No 187
>cd06839 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Btrk Decarboxylase. This subfamily is composed of Bacillus circulans BtrK decarboxylase and similar proteins. These proteins are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases, eukaryotic ornithine decarboxylases and diaminopimelate decarboxylases. BtrK is presumed to function as a PLP-dependent decarboxylase involved in the biosynthesis of the aminoglycoside antibiotic butirosin. Homodimer formation and the presence of the PLP cofactor may be required for catalytic activity.
Probab=52.37  E-value=18  Score=16.72  Aligned_cols=37  Identities=22%  Similarity=0.218  Sum_probs=21.0

Q ss_pred             CEECCCCCEEEEECCCEEEEECCCCCCCCCCCCCCEEEEC
Q ss_conf             1103774322335783153102334335657786137631
Q gi|254780151|r  244 DIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYL  283 (408)
Q Consensus       244 ~ivd~~G~viG~H~G~~~yTIGQRkGL~i~~~eP~YVv~i  283 (408)
                      .++-+-|.-+=...|....+|--+|-   ..+++|++++-
T Consensus       254 ~l~~EPGR~lva~ag~lv~~V~~~K~---~~~~~~~~~D~  290 (382)
T cd06839         254 RVVLELGRYLVGEAGVYVTRVLDRKV---SRGETFLVTDG  290 (382)
T ss_pred             EEEEECCCEEECCCEEEEEEEEEEEE---CCCCEEEEEEC
T ss_conf             89991350032157179999999983---59957999907


No 188
>PRK05920 aromatic acid decarboxylase; Validated
Probab=52.18  E-value=18  Score=16.70  Aligned_cols=33  Identities=30%  Similarity=0.378  Sum_probs=26.5

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHH---HCCCEEEEEE
Q ss_conf             33889999609857999999998---8698499999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLK---RDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~---~~G~~V~g~~   51 (408)
                      +-+||+||+||---+..+..+|+   ++|++|+-+.
T Consensus         3 ~mkrivvgITGASG~~ya~rll~~L~~~~~ev~lvi   38 (205)
T PRK05920          3 KMKRIVLAITGASGAIYGVRLLECLLAADYEVHLVI   38 (205)
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             887599998654279999999999986799899998


No 189
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane]
Probab=52.04  E-value=18  Score=16.69  Aligned_cols=138  Identities=17%  Similarity=0.290  Sum_probs=69.5

Q ss_pred             CCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC----EEECCHHH
Q ss_conf             38899-99609857999999998869849999987047876655557788189999999999980995----89817078
Q gi|254780151|r   20 DMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS----HYVFDYEE   94 (408)
Q Consensus        20 ~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~----~~~~d~~~   94 (408)
                      .|+|+ +|=..|   +++.++.++.|-.|+|+++                |++....|++.....|.+    ....|.++
T Consensus        73 G~~lLDiGCGWG---~l~~~aA~~y~v~V~GvTl----------------S~~Q~~~~~~r~~~~gl~~~v~v~l~d~rd  133 (283)
T COG2230          73 GMTLLDIGCGWG---GLAIYAAEEYGVTVVGVTL----------------SEEQLAYAEKRIAARGLEDNVEVRLQDYRD  133 (283)
T ss_pred             CCEEEEECCCHH---HHHHHHHHHCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCCCCEEEECCCCC
T ss_conf             998987478844---9999999984997999668----------------999999999999975997660799656210


Q ss_pred             HHHHHCCCCCHH--HHHC-CCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             866322441126--7870-8861200001541105888887401687645225311025412678773168853157878
Q gi|254780151|r   95 RFRNAVIVPFAS--SYAA-GETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        95 ~f~~~V~~~~~~--~y~~-G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                       |++. ||-.+.  .+.- |.           =.++.+++.+.+.            .     .+ +++..|.-=.++.+
T Consensus       134 -~~e~-fDrIvSvgmfEhvg~-----------~~~~~ff~~~~~~------------L-----~~-~G~~llh~I~~~~~  182 (283)
T COG2230         134 -FEEP-FDRIVSVGMFEHVGK-----------ENYDDFFKKVYAL------------L-----KP-GGRMLLHSITGPDQ  182 (283)
T ss_pred             -CCCC-CCEEEEHHHHHHHCC-----------CCHHHHHHHHHHH------------C-----CC-CCEEEEEEECCCCC
T ss_conf             -3243-420556006887371-----------0289999999964------------5-----99-96599999667885


Q ss_pred             CCEEEEEEECCHHHCEEECCCCCCC-HHHHHHHHHHCCCCCC
Q ss_conf             7318986302022100334256899-7898999974125435
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLGDMK-KESVRDLAREMGLDIA  212 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg~~~-K~eVR~~A~~~gl~~a  212 (408)
                      ...     .....+.+-+||=|.+. -++|-+.+.+.|+.+.
T Consensus       183 ~~~-----~~~~~i~~yiFPgG~lPs~~~i~~~~~~~~~~v~  219 (283)
T COG2230         183 EFR-----RFPDFIDKYIFPGGELPSISEILELASEAGFVVL  219 (283)
T ss_pred             CCC-----CCHHHHHHHCCCCCCCCCHHHHHHHHHHCCCEEE
T ss_conf             544-----3327899857899848977999998875686884


No 190
>cd06843 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE. This subfamily is composed of PvsE from Vibrio parahaemolyticus and similar proteins. PvsE is a vibrioferrin biosynthesis protein which is homologous to eukaryotic ornithine decarboxylase (ODC) and diaminopimelate decarboxylase (DapDC). ODC and DapDC are fold type III PLP-dependent enzymes that contain an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. It has been suggested that PvsE may be involved in the biosynthesis of the polycarboxylate siderophore vibrioferrin. It may catalyze the decarboxylation of serine to yield ethanolamine. PvsE may require homodimer formation and the presence of the PLP cofactor for activity.
Probab=52.00  E-value=18  Score=16.68  Aligned_cols=31  Identities=16%  Similarity=0.145  Sum_probs=21.1

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             57788189999999999980995898170788663
Q gi|254780151|r   64 KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        64 ~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      .+.|.++++++.|    -..||....+|-.+|...
T Consensus        75 ~gp~K~~~~l~~a----~~~gv~~i~~DS~~El~~  105 (377)
T cd06843          75 GGPGKTDSELAQA----LAQGVERIHVESELELRR  105 (377)
T ss_pred             CCCCCCHHHHHHH----HHCCCCEEEECCHHHHHH
T ss_conf             8999999999999----987998899889999999


No 191
>PRK07411 hypothetical protein; Validated
Probab=51.85  E-value=16  Score=17.16  Aligned_cols=115  Identities=18%  Similarity=0.161  Sum_probs=56.7

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCC--CCCCCC-CCHH-----HHHHHHHHHHHCCCCEE
Q ss_conf             863388999960985799999999886984999998704787665--555778-8189-----99999999998099589
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSC-CAGQ-----DVYDARRVCDTINVSHY   88 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~--~~~~~c-~~~~-----d~~~a~~va~~LgI~~~   88 (408)
                      .-++-||+|.=-||+-|.++.||. .+|.--+++.    |.+...  +....- .+++     -.+-|++..+.|+=...
T Consensus        35 ~L~~a~VlvvG~GGLG~p~~~yLa-aaGvG~i~iv----D~D~ve~sNL~RQ~l~~~~~vG~~K~~~a~~~l~~lnp~~~  109 (390)
T PRK07411         35 RLKAASVLCIGTGGLGSPLLLYLA-AAGIGRIGIV----DFDIVDSSNLQRQVIHGTSWVGKPKIESAKNRILEINPYCQ  109 (390)
T ss_pred             HHHHCCEEEECCCHHHHHHHHHHH-HCCCCEEEEE----ECCCCCCCCCCCCCCCCHHCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             997497899888723799999999-8389759997----48994623478543666200797189999999998689864


Q ss_pred             ECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHH-HHHCCCCCCEEC
Q ss_conf             817078866322441126787088612000015411058888-874016876452
Q gi|254780151|r   89 VFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL-SVTRQLGADVLA  142 (408)
Q Consensus        89 ~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~-~~a~~~g~~~iA  142 (408)
                      +.-+.+.+...-...++..|      .=-+.|--..+-..++ +.+..+|..+|-
T Consensus       110 i~~~~~~l~~~na~~li~~~------DvvvD~tDNf~tRylindac~~~~~PlV~  158 (390)
T PRK07411        110 VDLYETRLSSENALDILAPY------DVVVDGTDNFPTRYLVNDACVLLNKPNVY  158 (390)
T ss_pred             CEEHHHHCCHHHHHHHHCCC------CEEEECCCCHHHHHHHHHHHHHHCCCEEE
T ss_conf             21034325552488742288------68996788889999989999996998799


No 192
>PRK07671 cystathionine beta-lyase; Provisional
Probab=51.63  E-value=19  Score=16.64  Aligned_cols=99  Identities=16%  Similarity=0.272  Sum_probs=58.2

Q ss_pred             EEEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             89999609857999999-99886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-.+++|.|. +++++. ++-+.|-+|+..- ..+              .-...-.+.+...+||....+|..+      
T Consensus        66 ~~a~~~sSGm-aAi~a~l~~~~~Gd~iv~~~-~~Y--------------ggT~~l~~~~l~~~Gi~v~fvd~~d------  123 (377)
T PRK07671         66 HAGFAFGSGM-AAITAVMMLFSSGDHVILTD-DVY--------------GGTYRVMTKVLNRFGIEHTFVDTTN------  123 (377)
T ss_pred             CEEEEECCHH-HHHHHHHHHHCCCCEEEECC-CCC--------------CCHHHHHHHHHHHCCCEEEEECCCC------
T ss_conf             6277516788-99999999868999899828-982--------------7789999988863697699943888------


Q ss_pred             CCCCHHHHHCCCCCCCE-ECC----CCEEE---HHHHHHHHCCCCCCEECCCCC
Q ss_conf             44112678708861200-001----54110---588888740168764522531
Q gi|254780151|r  101 IVPFASSYAAGETPLPC-VDC----NRTVK---FSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc-~~C----N~~iK---F~~l~~~a~~~g~~~iATGHY  146 (408)
                          .++.++..+||.. |.|    |+.++   ..++.+.|++.|+-.+.--.+
T Consensus       124 ----~~~~~~ai~~~Tklv~~EspsNP~l~v~Di~~ia~iA~~~g~~~vVDNT~  173 (377)
T PRK07671        124 ----LEEVEEAIRPNTKAIYVETPTNPLLKITDIKKISTLAKEKGLLTIVDNTF  173 (377)
T ss_pred             ----HHHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEECCCC
T ss_conf             ----68899647888449999789998875016799999999829969851764


No 193
>COG1852 Uncharacterized conserved protein [Function unknown]
Probab=50.87  E-value=11  Score=18.25  Aligned_cols=39  Identities=15%  Similarity=0.515  Sum_probs=31.1

Q ss_pred             CCCCCCCEECCCCEEEHHHHHHHHCCCCCC-EECCCC-CCCE
Q ss_conf             088612000015411058888874016876-452253-1102
Q gi|254780151|r  110 AGETPLPCVDCNRTVKFSDLLSVTRQLGAD-VLATGH-YIRS  149 (408)
Q Consensus       110 ~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~-~iATGH-Yar~  149 (408)
                      --.|-+-|..||+=+ ++.+.|.|.+.|+. ||+||- |++-
T Consensus       107 ~t~~G~~Ck~CgkCv-i~ei~e~ae~~gykvfIvpGgs~vkk  147 (209)
T COG1852         107 LTPTGYECKKCGKCV-IGEIKEIAEKYGYKVFIVPGGSFVKK  147 (209)
T ss_pred             CCCCCCEECCCCCEE-HHHHHHHHHHHCCEEEEECCHHHHHH
T ss_conf             266550212268765-38999899983967999658179999


No 194
>pfam07022 Phage_CI_repr Bacteriophage CI repressor helix-turn-helix domain. This family consists of several phage CI repressor proteins and related bacterial sequences. The CI repressor is known to function as a transcriptional switch, determining whether transcription is lytic or lysogenic.
Probab=50.76  E-value=6.1  Score=20.09  Aligned_cols=44  Identities=25%  Similarity=0.366  Sum_probs=31.2

Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCC--CEECCCC
Q ss_conf             99999809958981707886632244112678708861200001541105888887401687--6452253
Q gi|254780151|r   77 RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA--DVLATGH  145 (408)
Q Consensus        77 ~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~--~~iATGH  145 (408)
                      ..+|++|||+--.+.              .-++++.+|           ++.++..+.+.|+  +|++||+
T Consensus        16 ~eLA~~LgI~~stis--------------~w~~R~~~P-----------~e~iv~~~~~tGvsl~WL~~G~   61 (65)
T pfam07022        16 SELADHLGVSKSTLS--------------TWYKRDSFP-----------AEWVIRCALETGVSLDWLATGD   61 (65)
T ss_pred             HHHHHHHCCCHHHHH--------------HHHHCCCCC-----------HHHHHHHHHHHCCCHHHHHCCC
T ss_conf             999999698888899--------------999869998-----------9999999999882999997089


No 195
>KOG0336 consensus
Probab=50.67  E-value=14  Score=17.41  Aligned_cols=143  Identities=16%  Similarity=0.221  Sum_probs=64.3

Q ss_pred             HHHCCCCCHHHHHCCCC---CCC-EECCCCEEEHHHHHHHHCCCCCC-----------EECCCCCCCEEEECCCCCCCEE
Q ss_conf             63224411267870886---120-00015411058888874016876-----------4522531102541267877316
Q gi|254780151|r   97 RNAVIVPFASSYAAGET---PLP-CVDCNRTVKFSDLLSVTRQLGAD-----------VLATGHYIRSRLYVGDDGKRRR  161 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~T---PNP-c~~CN~~iKF~~l~~~a~~~g~~-----------~iATGHYar~~~~~~~~~~~~~  161 (408)
                      +.+-+.-.++..+.|.|   ||| |..=..+--..-+++-.++.|+.           -+-.||=. +.......+..-.
T Consensus       195 r~en~~it~dd~K~gekrpIPnP~ctFddAFq~~pevmenIkK~GFqKPtPIqSQaWPI~LQG~Dl-iGVAQTgtgKtL~  273 (629)
T KOG0336         195 RKENFNITCDDLKEGEKRPIPNPVCTFDDAFQCYPEVMENIKKTGFQKPTPIQSQAWPILLQGIDL-IGVAQTGTGKTLA  273 (629)
T ss_pred             HHCCCCEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCHHCCCCEEECCCCE-EEEEECCCCCCHH
T ss_conf             971893783156667736689986747878756599999999606888985320233201137644-7787448984778


Q ss_pred             EEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC--CCHHHCCCEEECCCCCCHHHHHHCCC--
Q ss_conf             88531578787318986302022100334256899789899997412543--55111023011127751034553076--
Q gi|254780151|r  162 IMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI--ADKSDSQDICFVQQGKYFDVVKRINA--  237 (408)
Q Consensus       162 ~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~--a~K~eSqgICFi~~~~~~~Fl~~~~~--  237 (408)
                      .|+.|.+..--|.-   ...|.-      -++-++=.-.|++|....+.+  ..-+-+.-+||.+.++...-++....  
T Consensus       274 ~L~pg~ihi~aqp~---~~~qr~------~p~~lvl~ptreLalqie~e~~kysyng~ksvc~ygggnR~eqie~lkrgv  344 (629)
T KOG0336         274 FLLPGFIHIDAQPK---RREQRN------GPGVLVLTPTRELALQIEGEVKKYSYNGLKSVCVYGGGNRNEQIEDLKRGV  344 (629)
T ss_pred             HHCCCEEEEECCCH---HHHCCC------CCCEEEEECCHHHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHCCC
T ss_conf             75054014514611---120368------985499833388899887677676435843288754878546899874574


Q ss_pred             --CCCCCCCEECCC
Q ss_conf             --643467110377
Q gi|254780151|r  238 --GIALEGDIVHLN  249 (408)
Q Consensus       238 --~~~~~G~ivd~~  249 (408)
                        ....||.+.|+.
T Consensus       345 eiiiatPgrlndL~  358 (629)
T KOG0336         345 EIIIATPGRLNDLQ  358 (629)
T ss_pred             EEEEECCCHHHHHH
T ss_conf             17760785176555


No 196
>COG0309 HypE Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=50.65  E-value=16  Score=17.09  Aligned_cols=78  Identities=23%  Similarity=0.325  Sum_probs=33.1

Q ss_pred             HHHHHHHHHHCCCCCCC-HHHCCCEEECCCCCCHHHHHHCCCCCC-CCCCEECCCCCEEEEECCCEEEE-ECCCCCCCCC
Q ss_conf             78989999741254355-111023011127751034553076643-46711037743223357831531-0233433565
Q gi|254780151|r  197 KESVRDLAREMGLDIAD-KSDSQDICFVQQGKYFDVVKRINAGIA-LEGDIVHLNGQILGRHNGIINYT-IGQRRGLGVA  273 (408)
Q Consensus       197 K~eVR~~A~~~gl~~a~-K~eSqgICFi~~~~~~~Fl~~~~~~~~-~~G~ivd~~G~viG~H~G~~~yT-IGQRkGL~i~  273 (408)
                      ++|||.+.+-+||.... -.|-.=|+.+ +.++.+.....+.... ++-.|+   |+++.++.+....| +|-|+=+..+
T Consensus       255 ~~eVr~vce~lGiDPl~~anEG~lv~~V-~~~~a~~~l~~L~~~~~~~A~iI---GeV~~~~~~v~l~~~~G~~r~l~~P  330 (339)
T COG0309         255 REEVRGVCELLGLDPLELANEGKLVIAV-PPEHAEEVLEALRSHGLKDAAII---GEVVEEKGGVGLETAGGGKRILEPP  330 (339)
T ss_pred             CHHHHHHHHHHCCCHHHHHCCCEEEEEE-CHHHHHHHHHHHHHCCCCCCEEE---EEEECCCCCEEEEECCCCEEECCCC
T ss_conf             4899999998398878872586099997-88999999999986499542268---9983268837999547725766888


Q ss_pred             CCCCC
Q ss_conf             77861
Q gi|254780151|r  274 MGEPL  278 (408)
Q Consensus       274 ~~eP~  278 (408)
                      .++|+
T Consensus       331 ~~Dpl  335 (339)
T COG0309         331 EGDPL  335 (339)
T ss_pred             CCCCC
T ss_conf             76757


No 197
>pfam01261 AP_endonuc_2 Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae.
Probab=50.44  E-value=19  Score=16.52  Aligned_cols=83  Identities=12%  Similarity=0.108  Sum_probs=47.8

Q ss_pred             HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCE
Q ss_conf             99988698499999870478766555577881899999999999809958981707886632244112678708861200
Q gi|254780151|r   38 ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPC  117 (408)
Q Consensus        38 ~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc  117 (408)
                      .++++.||+-+-+++.....  ..       ....+++.++.+++.|++...+...-.+               ..|++.
T Consensus         2 ~~a~~~G~~~vE~~~~~~~~--~~-------~~~~~~~l~~~~~~~gl~i~~~~~~~~~---------------~~~~~~   57 (201)
T pfam01261         2 ELAAELGFDGVELFFDDPRP--AS-------DKLEIEELKALLKEYGLEITSLNPSLGL---------------LEPDER   57 (201)
T ss_pred             HHHHHCCCCEEEECCCCCCC--CC-------CHHHHHHHHHHHHHCCCEEEEEECCCCC---------------CCCCHH
T ss_conf             78996799999973688764--45-------7258999999999709979999778654---------------588989


Q ss_pred             ECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             001541105888887401687645225
Q gi|254780151|r  118 VDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       118 ~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                      .+=...-.|...++.|.++|+..|.+.
T Consensus        58 ~r~~~~~~~~~~l~~a~~lG~~~i~~~   84 (201)
T pfam01261        58 EREAALEALKRAIELAAALGAKVVVVH   84 (201)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             999999999999999997399589982


No 198
>cd02648 nuc_hydro_1 NH_1: A subgroup of nucleoside hydrolases. This group contains fungal proteins similar to nucleoside hydrolases. Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity.
Probab=50.30  E-value=19  Score=16.50  Aligned_cols=56  Identities=16%  Similarity=0.277  Sum_probs=44.1

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC--CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             88999960985799999999886--9849999987047876655557788189999999999980995
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD--GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~--G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      .||++=-..|+|-++|..|+...  ..||.|++.-.          |-|..++..++|.++.+.+|-+
T Consensus         2 rkvIiDtDpGiDDA~AillaL~~p~~iel~gIT~v~----------GNv~~e~~~~Nal~ll~ll~r~   59 (367)
T cd02648           2 HPIIIDTDPGVDDVLAILLALSSPEEVDVALISLTF----------GNTTLDHALRNVLRLFHVLERE   59 (367)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHCCC
T ss_conf             977997999789999999998689988799999946----------9878899999999999984544


No 199
>cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein. The cysteine containing enzymatically active version of the domain is also found in the Cdc25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and certain stress proteins such as senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions (no active site cysteine) are also seen in dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases, where they are believed to play a regulatory role in multidomain proteins.
Probab=50.27  E-value=14  Score=17.57  Aligned_cols=29  Identities=34%  Similarity=0.370  Sum_probs=19.4

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             86338899996098579999999988698
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGY   45 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~   45 (408)
                      .+++.+|++-=.+|..|..||..|++.||
T Consensus        47 ~~~~~~iv~~C~~g~rs~~aa~~L~~~G~   75 (89)
T cd00158          47 LDKDKPIVVYCRSGNRSARAAKLLRKAGG   75 (89)
T ss_pred             CCCCCCEEEECCCCCCCHHHHHHHHHCCC
T ss_conf             26898778775989812789999998089


No 200
>COG4848 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=49.96  E-value=8.4  Score=19.09  Aligned_cols=114  Identities=21%  Similarity=0.310  Sum_probs=57.1

Q ss_pred             EEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHC--CCCCCCHHHCC---CEEECCCCC-C-------H
Q ss_conf             853157878731898630202210033425689978989999741--25435511102---301112775-1-------0
Q gi|254780151|r  163 MCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREM--GLDIADKSDSQ---DICFVQQGK-Y-------F  229 (408)
Q Consensus       163 L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~--gl~~a~K~eSq---gICFi~~~~-~-------~  229 (408)
                      +.-+.|..|  ||-|  +.+.+|++.     .|++++||++|.-.  .|++.-|.|+.   ..-|+-..| |       .
T Consensus       117 vyYa~DLGk--sYrl--ide~mLeke-----~ls~eeiRe~a~fNlrkL~~~~k~D~V~GN~FYF~~sNDGYDASRiLN~  187 (265)
T COG4848         117 VYYALDLGK--SYRL--IDEQMLEKE-----ELSAEEIREMALFNLRKLSEPLKADKVAGNTFYFLNSNDGYDASRILNE  187 (265)
T ss_pred             EEEEECCCC--HHHH--HHHHHHHHC-----CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHH
T ss_conf             898861670--1414--568775450-----3659999999875454168655234015725899845887218889779


Q ss_pred             HHHHHCCCCCC------CC-------CCEECCCCCEEEEECCCEEEEECCCC--CCCC----CCCCCCEEEECCC
Q ss_conf             34553076643------46-------71103774322335783153102334--3356----5778613763175
Q gi|254780151|r  230 DVVKRINAGIA------LE-------GDIVHLNGQILGRHNGIINYTIGQRR--GLGV----AMGEPLFVVYLDK  285 (408)
Q Consensus       230 ~Fl~~~~~~~~------~~-------G~ivd~~G~viG~H~G~~~yTIGQRk--GL~i----~~~eP~YVv~id~  285 (408)
                      .||.++.....      -|       ++|++..|--+=.|-...+|+-|---  -|..    |--||-|...++.
T Consensus       188 s~L~em~qk~eGem~vavPHQDVLIiadIrn~tGYDvla~mtM~Ffa~G~vPITsL~F~Y~~G~LEPiFIlaknr  262 (265)
T COG4848         188 SFLNEMSQKVEGEMAVAVPHQDVLIIADIRNETGYDVLAHMTMQFFAQGLVPITSLPFLYNNGKLEPIFILAKNR  262 (265)
T ss_pred             HHHHHHHHHHCCEEEEECCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEEECCCEECCCCCCEEEEECCCC
T ss_conf             999999986132178852676269987622464404898877999818820223311011378512379970467


No 201
>PRK13255 thiopurine S-methyltransferase; Reviewed
Probab=48.91  E-value=20  Score=16.36  Aligned_cols=32  Identities=38%  Similarity=0.610  Sum_probs=24.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             63388999960985799999999886984999998
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      +++.||+|=+.|-   |+-+.-|.++||+|+|+-+
T Consensus        36 ~~~~rVlVPlCGK---s~Dm~wLa~~G~~VvGvEl   67 (218)
T PRK13255         36 PAGSRVLVPLCGK---SLDMLWLAEQGHEVLGVEL   67 (218)
T ss_pred             CCCCEEEEECCCC---HHHHHHHHHCCCEEEEEEC
T ss_conf             8898699948986---7769999848972699835


No 202
>PRK07667 uridine kinase; Provisional
Probab=48.40  E-value=17  Score=16.85  Aligned_cols=40  Identities=20%  Similarity=0.239  Sum_probs=27.6

Q ss_pred             CCCCCEEEEEECCCHH---HHHHHHHH---HHCCCEEEEEEEECCC
Q ss_conf             8633889999609857---99999999---8869849999987047
Q gi|254780151|r   17 NPKDMRVVVAMSGGVD---SSVVAALL---KRDGYDVIGVTLQLYN   56 (408)
Q Consensus        17 ~~k~~kV~va~SGGVD---Ssvaa~lL---~~~G~~V~g~~m~~~~   56 (408)
                      ..|+.|-+||++||--   |++|..|.   .+.|..|+.+++..|.
T Consensus         9 ~~~~~r~iIgIaG~sgSGKTTla~~L~~~l~~~~~~v~v~~~Dd~~   54 (190)
T PRK07667          9 KHKENRFILGIDGLSRSGKTTFVANLKENMKQEGIPFHIFHIDDHI   54 (190)
T ss_pred             HCCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
T ss_conf             5759869999779897889999999999986659837999666242


No 203
>cd01988 Na_H_Antiporter_C The C-terminal domain of a subfamily of Na+ /H+ antiporter existed in bacteria and archea . Na+/H+ exchange proteins eject protons from cells, effectively eliminating excess acid from actively metabolising cells. Na+ /H+ exchange activity is also crucial for the regulation of cell volume, and for the reabsorption of NaCl across renal, intestinal, and other epithelia. These antiports exchange Na+ for H+ in an electroneutral manner, and this activity is carried out by a family of Na+ /H+ exchangers, or NHEs, which are known to be present in both prokaryotic and eukaryotic cells.  These exchangers are highly-regulated (glyco)phosphoproteins, which, based on their primary structure, appear to contain 10-12 membrane-spanning regions (M) at the N-terminus and a large cytoplasmic region at the C-terminus. The transmembrane regions M3-M12 share identity wit h other members of the family. The M6 and M7 regions are highly conserved. Thus, this is thought to be the regio
Probab=48.37  E-value=21  Score=16.30  Aligned_cols=99  Identities=15%  Similarity=0.142  Sum_probs=58.1

Q ss_pred             EEEEEECCCHHHHHHH----HHHHHCCCEEEEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             8999960985799999----9998869849999987047876655557--788189999999999980995898170788
Q gi|254780151|r   22 RVVVAMSGGVDSSVVA----ALLKRDGYDVIGVTLQLYNSRKASKRKG--SCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        22 kV~va~SGGVDSsvaa----~lL~~~G~~V~g~~m~~~~~~~~~~~~~--~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ||+|++.|.--|--|.    .+.+..+-+++.+|+-............  .-..++-.+.+...++.+|++.+.+-.   
T Consensus         1 rILVpvd~s~~s~~al~~A~~la~~~~a~l~~lhVv~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~---   77 (132)
T cd01988           1 RILVPVANPNTARDLLELAAALARAQNGEIIPLNVIEVPNHSSPSQLEVNVQRARKLLRQAERIAASLGVPVHTIIR---   77 (132)
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEEE---
T ss_conf             98997289889999999999999876998999999845876785566789999999999999999876995699999---


Q ss_pred             HHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             66322441126787088612000015411058888874016876452253110
Q gi|254780151|r   96 FRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        96 f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                           +.           .+|+         ...++.|++.++|.|.-|..-|
T Consensus        78 -----~~-----------~~~~---------~~I~~~a~e~~~DlIVmG~~g~  105 (132)
T cd01988          78 -----ID-----------HDIA---------SGILRTAKERQADLIIMGWHGS  105 (132)
T ss_pred             -----EC-----------CCHH---------HHHHHHHHHHCCCEEEECCCCC
T ss_conf             -----77-----------9979---------9999999984999999837999


No 204
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed
Probab=47.82  E-value=21  Score=16.24  Aligned_cols=16  Identities=31%  Similarity=0.291  Sum_probs=6.7

Q ss_pred             HHHHHHHHHHCCCEEE
Q ss_conf             9999999988698499
Q gi|254780151|r   33 SSVVAALLKRDGYDVI   48 (408)
Q Consensus        33 Ssvaa~lL~~~G~~V~   48 (408)
                      ...||+.|.+.||+|+
T Consensus       322 GLaaA~~Lar~G~~VT  337 (639)
T PRK12809        322 GLGCADILARAGVQVD  337 (639)
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             9999999997599069


No 205
>PRK06395 phosphoribosylamine--glycine ligase; Provisional
Probab=47.66  E-value=21  Score=16.23  Aligned_cols=85  Identities=14%  Similarity=0.140  Sum_probs=53.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCC-CCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             3889999609857999999998869849999987047876655557-788189999999999980995898170788663
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~-~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      .|||+|-=|||=.-++|-.|.+ .. .+.-++.-+.+..-...... ......|.+...+.|+..+|.+-++-=+.-...
T Consensus         2 ~MkVLViGsGGREHAla~kl~~-s~-~~~~~~~g~gn~g~~~~~~~~~~~~~~d~~~i~~~a~~~~idLvvvGPE~pL~~   79 (435)
T PRK06395          2 TMKVMLVGSGGREDAIARAIKR-SG-AILFSVIGHENPSIKKLSKKYLFYDEKDYDLIEDFALKNNVDIVFVGPDPVLAT   79 (435)
T ss_pred             CCEEEEECCCHHHHHHHHHHHC-CC-CCEEEEECCCCHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHHHC
T ss_conf             8779998878899999999855-98-844999899967877623234656856999999999984999999897678866


Q ss_pred             HCCCCCHH
Q ss_conf             22441126
Q gi|254780151|r   99 AVIVPFAS  106 (408)
Q Consensus        99 ~V~~~~~~  106 (408)
                      -+.|.|.+
T Consensus        80 Gi~D~l~~   87 (435)
T PRK06395         80 PLVNNLLK   87 (435)
T ss_pred             CHHHHHHH
T ss_conf             14559976


No 206
>PRK12735 elongation factor Tu; Reviewed
Probab=47.33  E-value=21  Score=16.19  Aligned_cols=34  Identities=15%  Similarity=0.325  Sum_probs=25.2

Q ss_pred             EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             999975972000696389997388866588876897145
Q gi|254780151|r  348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       348 ~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      +.++|++|. ++-+|+=-+|=+.    ++-+|+|+|.+-
T Consensus       361 v~i~l~~Pi-~~e~g~RFvlRd~----g~Tig~G~V~~v  394 (396)
T PRK12735        361 MTVELIAPI-AMEEGLRFAIREG----GRTVGAGVVAKI  394 (396)
T ss_pred             EEEEECCCE-EECCCCEEEEEEC----CEEEEEEEEEEE
T ss_conf             999989837-8653998999989----968999999998


No 207
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism]
Probab=46.92  E-value=22  Score=16.15  Aligned_cols=31  Identities=29%  Similarity=0.469  Sum_probs=17.8

Q ss_pred             CCEEEEEECCCCCCCEEEEEEEECCCCCCCHHHH
Q ss_conf             9638999738886658887689714555303477
Q gi|254780151|r  361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEE  394 (408)
Q Consensus       361 PGQ~~VfY~~D~~~~~vLGGGiI~~t~~~~~~~~  394 (408)
                      .|..+|+---|   ++++|-=.+..+-|.|+.+.
T Consensus       515 ~G~t~v~va~d---g~~~g~i~~~D~~R~~a~~a  545 (713)
T COG2217         515 EGKTVVFVAVD---GKLVGVIALADELRPDAKEA  545 (713)
T ss_pred             CCCEEEEEEEC---CEEEEEEEECCCCCHHHHHH
T ss_conf             49769999999---99999999707888349999


No 208
>COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane]
Probab=46.71  E-value=22  Score=16.13  Aligned_cols=31  Identities=32%  Similarity=0.402  Sum_probs=25.0

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             88999960985799999999886984999998
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      |||.|.=||=|-- +.+.+|.+.||+|+++=.
T Consensus         1 MkI~viGtGYVGL-v~g~~lA~~GHeVv~vDi   31 (414)
T COG1004           1 MKITVIGTGYVGL-VTGACLAELGHEVVCVDI   31 (414)
T ss_pred             CCEEEECCCHHHH-HHHHHHHHCCCEEEEEEC
T ss_conf             9158988855688-789999870984899957


No 209
>PRK00049 elongation factor Tu; Reviewed
Probab=46.69  E-value=22  Score=16.12  Aligned_cols=34  Identities=15%  Similarity=0.329  Sum_probs=25.3

Q ss_pred             EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             999975972000696389997388866588876897145
Q gi|254780151|r  348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       348 ~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      +.++|.+|. .+.+|+--+|=++    ++-+|+|+|++-
T Consensus       362 v~i~l~~Pi-~~e~g~RFvlRd~----g~Tig~G~V~~v  395 (397)
T PRK00049        362 MTVELIAPI-AMEEGLRFAIREG----GRTVGAGVVTKI  395 (397)
T ss_pred             EEEEECCCE-EECCCCEEEEEEC----CEEEEEEEEEEE
T ss_conf             999989837-8643998999989----978999999998


No 210
>TIGR01048 lysA diaminopimelate decarboxylase; InterPro: IPR002986   Pyridoxal-dependent decarboxylases that act on ornithine-, lysine-, arginine- and related substrates can be classified into different families on the basis of sequence similarity , . One of these families includes ornithine decarboxylase (ODC), which catalyses the transformation of ornithine into putrescine; prokaryotic diaminopimelic acid decarboxylase (DAPDC), which catalyses the conversion of diaminopimelic acid into lysine, the final step of lysine biosynthesis; Pseudomonas syringae pv. tabaci protein, tabA, which is probably involved in tabtoxin biosynthesis and is similar to DAPDC; and bacterial and plant biosynthetic arginine decarboxylase (ADC), which catalyses the transformation of arginine into agmatine, the first step in putrescine synthesis from arginine.   Although these proteins, which are known collectively as group IV decarboxylases , probably share a common evolutionary origin, their levels of sequence similarity are low, being confined to a few short conserved regions. These conserved motifs suggest a common structural arrangement for positioning of substrate and the cofactor pyridoxal 5'-phosphate among bacterial DAP decarboxylases, eukaryotic ornithine decarboxylases and arginine decarboxylases .   The structure of bacterial diaminopimelate decarboxylase has been determined . ; GO: 0008836 diaminopimelate decarboxylase activity, 0009089 lysine biosynthetic process via diaminopimelate.
Probab=46.68  E-value=22  Score=16.12  Aligned_cols=120  Identities=18%  Similarity=0.220  Sum_probs=57.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC--CCC------CCCEECCCCEEEHHHHHHHHCC
Q ss_conf             57788189999999999980995898170788663224411267870--886------1200001541105888887401
Q gi|254780151|r   64 KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA--GET------PLPCVDCNRTVKFSDLLSVTRQ  135 (408)
Q Consensus        64 ~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~--G~T------PNPc~~CN~~iKF~~l~~~a~~  135 (408)
                      +|-|-|.+.++.|-    .++|++..+|=.+|-..      +++-+.  |.+      =||+|.|..|            
T Consensus       107 ~Gn~Ks~~El~~Al----~~~i~~~nVdS~~El~~------l~~~A~e~G~~~~i~~RvNP~VdakTH------------  164 (431)
T TIGR01048       107 SGNGKSRAELERAL----ELGIRCINVDSFSELEL------LNEIAPELGKKARISLRVNPDVDAKTH------------  164 (431)
T ss_pred             ECCCCCHHHHHHHH----HCCCCEEEECCHHHHHH------HHHHCCCCCCEEEEEEEECCCCCCCCC------------
T ss_conf             65877889999999----63798999768899999------997352138558999972688759878------------


Q ss_pred             CCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCC--CCCEEEEEEECCHHHC--EEECCCCC-CC--HHHHHHHHHHCC
Q ss_conf             68764522531102541267877316885315787--8731898630202210--03342568-99--789899997412
Q gi|254780151|r  136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLE--RDQSYFLFATTQQQLC--DLRFPLGD-MK--KESVRDLAREMG  208 (408)
Q Consensus       136 ~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~--KDQSYfL~~l~~~~L~--~~~FPlg~-~~--K~eVR~~A~~~g  208 (408)
                         +||+|||=- .          ++    |.+..  ..+--|++.+.++-|.  -+.+=+|. ++  -+-+-..++=..
T Consensus       165 ---pyI~TG~~~-s----------KF----G~~~~sG~a~~~~~~a~~~~~l~~vG~H~HIGSQi~d~~Pf~~A~~~v~~  226 (431)
T TIGR01048       165 ---PYISTGLKD-S----------KF----GIDVESGEALEAYLYALQLENLEIVGIHCHIGSQILDLSPFVEAAEKVVK  226 (431)
T ss_pred             ---CHHHHHCCC-C----------CC----CCCCCCCCCHHHHHHHHHCCCCCEEEEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             ---312210003-6----------54----77745753178999998378993899864337301023407999999999


Q ss_pred             CCCCCHHH-CCCEEEC
Q ss_conf             54355111-0230111
Q gi|254780151|r  209 LDIADKSD-SQDICFV  223 (408)
Q Consensus       209 l~~a~K~e-SqgICFi  223 (408)
                      |-..-+.+ ..+|=|+
T Consensus       227 ~~~~l~~~yG~~l~~l  242 (431)
T TIGR01048       227 LVEELKAEYGIDLEFL  242 (431)
T ss_pred             HHHHHHHHHCCEEEEE
T ss_conf             9998888716007999


No 211
>COG1832 Predicted CoA-binding protein [General function prediction only]
Probab=46.50  E-value=15  Score=17.32  Aligned_cols=61  Identities=30%  Similarity=0.386  Sum_probs=38.9

Q ss_pred             EEEEEECC--CHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             89999609--85799999999886984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   22 RVVVAMSG--GVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        22 kV~va~SG--GVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      =.+||+|.  .-+|-..+.-|+++||+|+-|.=+.              +.+.+.--+..+.-..|| +.+|..+-|+
T Consensus        19 IAvVG~S~~P~r~sy~V~kyL~~~GY~ViPVNP~~--------------~~~eiLG~k~y~sL~dIp-e~IDiVdvFR   81 (140)
T COG1832          19 IAVVGASDKPDRPSYRVAKYLQQKGYRVIPVNPKL--------------AGEEILGEKVYPSLADIP-EPIDIVDVFR   81 (140)
T ss_pred             EEEEECCCCCCCCHHHHHHHHHHCCCEEEEECCCC--------------CHHHHCCCHHHHCHHHCC-CCCCEEEEEC
T ss_conf             99994579998618899999997899899558552--------------057762831120587588-7775799852


No 212
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism]
Probab=45.81  E-value=23  Score=16.03  Aligned_cols=120  Identities=20%  Similarity=0.111  Sum_probs=68.8

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHH-H-----HHHHHHHHHHCCCCEEECCH
Q ss_conf             33889999609857999999998869849999987047876655557788189-9-----99999999980995898170
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ-D-----VYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~-d-----~~~a~~va~~LgI~~~~~d~   92 (408)
                      ++.+|+|-=-|||-|-++-+ |.+.|..=+-+.  -.|.-..++....+++.. +     .+-.++....++ |.-.++.
T Consensus        29 ~~~~V~VvGiGGVGSw~veA-LaRsGig~itlI--D~D~v~vTN~NRQi~A~~~~iGk~Kv~vm~eri~~In-P~c~V~~  104 (263)
T COG1179          29 KQAHVCVVGIGGVGSWAVEA-LARSGIGRITLI--DMDDVCVTNTNRQIHALLGDIGKPKVEVMKERIKQIN-PECEVTA  104 (263)
T ss_pred             HCCCEEEEECCCHHHHHHHH-HHHCCCCEEEEE--ECHHCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHC-CCCEEEE
T ss_conf             50948999458453999999-998188818997--1201022232126677662314378999999998619-8746760


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCCCCEECC--CCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             7886632244112678708861200001--541105888887401687645225311
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETPLPCVDC--NRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TPNPc~~C--N~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      .++||..   ..+++|... .|.=-+.|  |-..| -.|+.++...+...|.+|--+
T Consensus       105 ~~~f~t~---en~~~~~~~-~~DyvIDaiD~v~~K-v~Li~~c~~~ki~vIss~Gag  156 (263)
T COG1179         105 INDFITE---ENLEDLLSK-GFDYVIDAIDSVRAK-VALIAYCRRNKIPVISSMGAG  156 (263)
T ss_pred             HHHHHCH---HHHHHHHCC-CCCEEEECHHHHHHH-HHHHHHHHHCCCCEEEECCCC
T ss_conf             5766068---569998168-998799813203778-999999998599779605656


No 213
>PRK08064 cystathionine beta-lyase; Provisional
Probab=45.50  E-value=23  Score=16.00  Aligned_cols=99  Identities=16%  Similarity=0.188  Sum_probs=55.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCC
Q ss_conf             99996098579999999988698499999870478766555577881899999999999809958981707886632244
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIV  102 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~  102 (408)
                      -++++|.|.--..++.++-.+|-+|+... ..+           -++   ..-.+....++||....+|..+.       
T Consensus        71 ~a~~~~SGmaAi~~~l~~l~~Gd~vv~~~-~~Y-----------g~T---~~l~~~~l~~~Gi~~~f~d~~d~-------  128 (390)
T PRK08064         71 KGFAFASGMAAISTAFLLLSKGDHVLISE-DVY-----------GGT---YRMITEVLSRFGIEHTFVDMTNL-------  128 (390)
T ss_pred             CEEEHHHHHHHHHHHHHHHCCCCEEEEEC-CCC-----------CCH---HHHHHHHHHCCCEEEEEECCCCH-------
T ss_conf             65502339999999999867999999848-885-----------679---99998676509879999788573-------


Q ss_pred             CCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEECCCCC
Q ss_conf             112678708861200001-----54110---588888740168764522531
Q gi|254780151|r  103 PFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       103 ~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~iATGHY  146 (408)
                         ++.++..+||..+..     |+..+   ..++.+.|++.|+-.+.--.+
T Consensus       129 ---~~~~~~i~~~Tklv~~EspsNP~l~v~Di~~i~~iA~~~g~~~vVDNT~  177 (390)
T PRK08064        129 ---EEVAQNIKPNTKLFYVETPSNPLLKVTDIRGVVKLAKAHGCLTFVDNTF  177 (390)
T ss_pred             ---HHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCEEEEECCC
T ss_conf             ---7799747888459999789998874127199999998839969973773


No 214
>pfam01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme. This family includes enzymes involved in cysteine and methionine metabolism. The following are members: Cystathionine gamma-lyase, Cystathionine gamma-synthase, Cystathionine beta-lyase, Methionine gamma-lyase, OAH/OAS sulfhydrylase, O-succinylhomoserine sulfhydrylase All of these members participate is slightly different reactions. All these enzymes use PLP (pyridoxal-5'-phosphate) as a cofactor.
Probab=45.44  E-value=23  Score=15.99  Aligned_cols=97  Identities=22%  Similarity=0.310  Sum_probs=56.2

Q ss_pred             EEEEECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             99996098579999999--9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   23 VVVAMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        23 V~va~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      -++++|.|. +++++.+  |.+.|-+|+..- ..+              .--..-.+...+.+||....+|..+      
T Consensus        69 ~a~~~~SGm-aAi~~~ll~l~~~Gd~il~~~-~~Y--------------g~t~~~~~~~l~~~Gi~v~~~d~~d------  126 (381)
T pfam01053        69 AALAFSSGM-AAIFAALLALLKAGDHVVATD-DLY--------------GGTYRLFEKVLPRFGIEVTFVDPSD------  126 (381)
T ss_pred             EEEEECCHH-HHHHHHHHHCCCCCCEEEEEC-CCC--------------CCHHHHHHHHHHHCCCEEEEECCCC------
T ss_conf             389935889-999999975579999899957-873--------------7589999998871585067626658------


Q ss_pred             CCCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEECCCC
Q ss_conf             44112678708861200001-----54110---58888874016876452253
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~iATGH  145 (408)
                          .++.++-.+||.++..     |..++   ..++.+.|++.|+-.|.-..
T Consensus       127 ----~~~~~~~i~~~T~li~~EspsNP~l~v~Di~~ia~iA~~~gi~~vVDNT  175 (381)
T pfam01053       127 ----LDALEAAIKPNTKAVFLETPTNPLLKVVDIEAIAKIAKKHGALVVVDNT  175 (381)
T ss_pred             ----HHHHHHHCCCCCEEEEEECCCCCCEEECCCHHHHHHHHHCCCEEEEECC
T ss_conf             ----6789975588842999974899860512609999998645735998788


No 215
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=45.18  E-value=23  Score=16.01  Aligned_cols=43  Identities=26%  Similarity=0.377  Sum_probs=29.8

Q ss_pred             CHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEE
Q ss_conf             126787088612000015411058888874016876452253110254
Q gi|254780151|r  104 FASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRL  151 (408)
Q Consensus       104 ~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~  151 (408)
                      .+|+...|.-|.==..    + .-+++++..+.|+..|||-||..+..
T Consensus       410 LlDElG~GTDP~EGaA----L-a~aile~l~~~~~~~i~TTH~~~lK~  452 (780)
T PRK00409        410 LFDELGAGTDPDEGAA----L-AISILDYLRKRGAKIIATTHYKELKA  452 (780)
T ss_pred             EECCCCCCCCHHHHHH----H-HHHHHHHHHHCCCEEEEECCHHHHHH
T ss_conf             1232358998456599----9-99999999977997999477699999


No 216
>PRK00081 coaE dephospho-CoA kinase; Reviewed
Probab=45.08  E-value=23  Score=15.95  Aligned_cols=29  Identities=34%  Similarity=0.630  Sum_probs=22.4

Q ss_pred             CEEEEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             8899996098579--9999999886984999
Q gi|254780151|r   21 MRVVVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus        21 ~kV~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      |-.+||+.||+-|  |.++.+|++.|+.|+-
T Consensus         1 ~m~~IgiTG~igsGKStv~~~l~~~G~~vid   31 (199)
T PRK00081          1 MMLIIGLTGGIGSGKSTVANIFAELGVPVID   31 (199)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             9789995788877799999999988993996


No 217
>TIGR02630 xylose_isom_A xylose isomerase; InterPro: IPR013452    Xylose isomerase (5.3.1.5 from EC) is an enzyme which interconverts D-xylose and D-xylulose.; GO: 0009045 xylose isomerase activity.
Probab=44.64  E-value=14  Score=17.44  Aligned_cols=167  Identities=18%  Similarity=0.326  Sum_probs=91.2

Q ss_pred             HHHHCCCCEEEC---CHHHHH---------HHHCCCCCHHH--------------------HH--CCCCCCCEECCCCEE
Q ss_conf             999809958981---707886---------63224411267--------------------87--088612000015411
Q gi|254780151|r   79 VCDTINVSHYVF---DYEERF---------RNAVIVPFASS--------------------YA--AGETPLPCVDCNRTV  124 (408)
Q Consensus        79 va~~LgI~~~~~---d~~~~f---------~~~V~~~~~~~--------------------y~--~G~TPNPc~~CN~~i  124 (408)
                      ++++||||++.+   |++.|-         -+.|++.+.+-                    |.  +..+|||+|.-=.-.
T Consensus        87 f~~KLgv~YyCFHD~D~aPEG~~L~E~~~nLd~~vd~~~~kq~~tg~KLLWGTAN~F~HpRYm~GAATsp~adVFAyAAA  166 (437)
T TIGR02630        87 FFEKLGVPYYCFHDVDIAPEGASLKETNANLDEIVDLIKEKQKETGVKLLWGTANLFSHPRYMHGAATSPDADVFAYAAA  166 (437)
T ss_pred             HHHHCCCCEEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEECCCCCCCCCCCCCCCCCCCCCCCCCEECHHH
T ss_conf             99871898055446102578877899999999999999999975488323365567887210165666838011411389


Q ss_pred             EHHHHHHHHCCCCCC-EECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHH
Q ss_conf             058888874016876-4522531102541267877316885315787873189863020221003342568997898999
Q gi|254780151|r  125 KFSDLLSVTRQLGAD-VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDL  203 (408)
Q Consensus       125 KF~~l~~~a~~~g~~-~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~  203 (408)
                      +-..-+|.+++||-. ||         ..-|.+|.. .+|.  .|.         .+.++.|+|.+        .=|++-
T Consensus       167 QVKkaLe~Tk~LGGENYV---------FWGGREGYe-tLLN--TD~---------~~Eld~lArF~--------~mAvdY  217 (437)
T TIGR02630       167 QVKKALEVTKKLGGENYV---------FWGGREGYE-TLLN--TDM---------KLELDHLARFL--------QMAVDY  217 (437)
T ss_pred             HHHHHHHHHHHHCCCCCE---------ECCCCHHHH-HHHH--HHH---------HHHHHHHHHHH--------HHHHHH
T ss_conf             999999999986588624---------317530332-1445--217---------78999998899--------999999


Q ss_pred             HHHCCCCCCCHHHCCCEEECCCC--------------CCHHHHHHCCCCCCCCCCEE-CCCCCEEEEECCCEEEEECCCC
Q ss_conf             97412543551110230111277--------------51034553076643467110-3774322335783153102334
Q gi|254780151|r  204 AREMGLDIADKSDSQDICFVQQG--------------KYFDVVKRINAGIALEGDIV-HLNGQILGRHNGIINYTIGQRR  268 (408)
Q Consensus       204 A~~~gl~~a~K~eSqgICFi~~~--------------~~~~Fl~~~~~~~~~~G~iv-d~~G~viG~H~G~~~yTIGQRk  268 (408)
                      |++.|+.        |.-.|+.+              -...||++|.=.    .+|. |++    ..|--+...|-=  +
T Consensus       218 a~~IGF~--------G~fLIEPKPkEPTKHQYDfDaAT~~~FL~~ygL~----~~FKlNiE----aNHAtLAGHTF~--H  279 (437)
T TIGR02630       218 AKKIGFK--------GQFLIEPKPKEPTKHQYDFDAATVIAFLKKYGLD----KDFKLNIE----ANHATLAGHTFE--H  279 (437)
T ss_pred             HHHCCCC--------CCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC----CCCEEEEE----HHHHHHHCCCHH--H
T ss_conf             8846899--------8441167631218887706799999999872896----55223110----211554022248--8


Q ss_pred             CCCCCCCCCCEEEECCCCCCEEEEE
Q ss_conf             3356577861376317553125652
Q gi|254780151|r  269 GLGVAMGEPLFVVYLDKNSSRVIVG  293 (408)
Q Consensus       269 GL~i~~~eP~YVv~id~~~N~ViVg  293 (408)
                      =|.+|.. -=---+||.+++...+|
T Consensus       280 EL~~A~~-~g~LGSiDAN~GD~LlG  303 (437)
T TIGR02630       280 ELRVARD-NGLLGSIDANQGDLLLG  303 (437)
T ss_pred             HHHHHHH-CCCCCCEECCCCCCCCC
T ss_conf             9999998-19930200047887556


No 218
>KOG1468 consensus
Probab=44.50  E-value=24  Score=15.89  Aligned_cols=14  Identities=36%  Similarity=0.712  Sum_probs=8.5

Q ss_pred             EEEEECCCEEEEEC
Q ss_conf             22335783153102
Q gi|254780151|r  252 ILGRHNGIINYTIG  265 (408)
Q Consensus       252 viG~H~G~~~yTIG  265 (408)
                      ++.+|.|+.||-.-
T Consensus       261 v~aKhhgipFyvaa  274 (354)
T KOG1468         261 VLAKHHGIPFYVAA  274 (354)
T ss_pred             HHHHHCCCCEEEEC
T ss_conf             99986498638854


No 219
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated
Probab=43.65  E-value=24  Score=15.81  Aligned_cols=26  Identities=19%  Similarity=0.403  Sum_probs=10.9

Q ss_pred             ECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             60985799999999886984999998
Q gi|254780151|r   27 MSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        27 ~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      ++-|--+.-++..|+++|.+|.++..
T Consensus       121 iTtG~S~~~ai~~l~~~G~~V~~v~v  146 (200)
T PRK00455        121 ITTGGSVLEAVEAIRAAGAEVVGVAV  146 (200)
T ss_pred             HHCCCCHHHHHHHHHHCCCEEEEEEE
T ss_conf             10470199999999987997999999


No 220
>TIGR02477 PFKA_PPi diphosphate--fructose-6-phosphate 1-phosphotransferase; InterPro: IPR011183    Diphosphate--fructose-6-phosphate 1-phosphotransferase catalyses the addition of phosphate from diphosphate (PPi) to fructose 6-phosphate to give fructose 1,6-bisphosphate (2.7.1.90 from EC). The enzyme is also known as pyrophosphate-dependent phosphofructokinase. The usage of PPi-dependent enzymes in glycolysis presumably frees up ATP for other processes . IPR012828 from INTERPRO represents the ATP-dependent 6-phosphofructokinase enzyme contained within Phosphofructokinase. This entry contains primarily bacterial, plant alpha, and plant beta sequences. These may be dimeric nonallosteric enzymes (bacteria) or allosteric heterotetramers (plants) .   For additional information please see , , , .; GO: 0005524 ATP binding, 0047334 diphosphate-fructose-6-phosphate 1-phosphotransferase activity, 0006096 glycolysis, 0005945 6-phosphofructokinase complex.
Probab=43.43  E-value=19  Score=16.54  Aligned_cols=145  Identities=14%  Similarity=0.183  Sum_probs=65.6

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEEC---CHHHHHHHHCCCCCHHHH-HCCCCCCCEECCCCEEEHHHHHHH-HC-CCCCCEE
Q ss_conf             81899999999999809958981---707886632244112678-708861200001541105888887-40-1687645
Q gi|254780151|r   68 CAGQDVYDARRVCDTINVSHYVF---DYEERFRNAVIVPFASSY-AAGETPLPCVDCNRTVKFSDLLSV-TR-QLGADVL  141 (408)
Q Consensus        68 ~~~~d~~~a~~va~~LgI~~~~~---d~~~~f~~~V~~~~~~~y-~~G~TPNPc~~CN~~iKF~~l~~~-a~-~~g~~~i  141 (408)
                      -++|+.+.|-..|++|+++=-+|   |=++-=     .=++.+| ++-.-+-+-|.|=+.|= |-|-.. .. .+|+|- 
T Consensus       152 ~T~Eq~~~al~~~k~l~LdgLVIIGGDdSNTn-----AA~LAEyF~~~~~~t~viGVPKTID-GDLKn~~iEtsFGFDT-  224 (566)
T TIGR02477       152 ETEEQFAKALETAKKLKLDGLVIIGGDDSNTN-----AALLAEYFAKKGLKTQVIGVPKTID-GDLKNQYIETSFGFDT-  224 (566)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEEECCCCCHHH-----HHHHHHHHHHCCCCCEEEEEECCCC-HHHCCCCCCCCCCCHH-
T ss_conf             68889999999987608964899747986799-----9999999997389922786402547-2110271045876104-


Q ss_pred             CCCCCCCEEEEC---CCCCCCEEEEEE--C-------------CCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHH
Q ss_conf             225311025412---678773168853--1-------------5787873189863020221003342568997898999
Q gi|254780151|r  142 ATGHYIRSRLYV---GDDGKRRRIMCR--P-------------MDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDL  203 (408)
Q Consensus       142 ATGHYar~~~~~---~~~~~~~~~L~r--~-------------~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~  203 (408)
                      ||==|+-..-+.   .-..+..||-.|  |             .-||      .+-+++|..+|      .+|=.+|-+-
T Consensus       225 acK~YSElIGNi~rDA~S~~KYwHFIrLMGRsASHiaLECALqThPN------~ciigEEv~~K------k~tL~~~~~~  292 (566)
T TIGR02477       225 ACKVYSELIGNICRDALSAKKYWHFIRLMGRSASHIALECALQTHPN------VCIIGEEVAAK------KMTLSQVTDY  292 (566)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHHHCCCCCC------EEEHHHHHHHH------CCCHHHHHHH
T ss_conf             78899887557888766428713677743763158999873214797------67512335532------5848899999


Q ss_pred             HHHCCCCCCCHHHCCCEEECCCCCCHHHH
Q ss_conf             97412543551110230111277510345
Q gi|254780151|r  204 AREMGLDIADKSDSQDICFVQQGKYFDVV  232 (408)
Q Consensus       204 A~~~gl~~a~K~eSqgICFi~~~~~~~Fl  232 (408)
                      -.+.=..-|.+-+-.|||.||+| ..+|+
T Consensus       293 I~d~i~~Ra~~G~NfGvvLiPEG-LIEFI  320 (566)
T TIGR02477       293 IADVIVKRAAKGKNFGVVLIPEG-LIEFI  320 (566)
T ss_pred             HHHHHHHHHHCCCCEEEEEECCC-CEECC
T ss_conf             99999999856894279997698-54202


No 221
>PRK06298 type III secretion system protein; Validated
Probab=43.39  E-value=24  Score=15.78  Aligned_cols=50  Identities=16%  Similarity=0.205  Sum_probs=26.8

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             87645225--31102541267877316885315787873189863020221003342568997898999974125435
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .+|.|.|-  |||=.-.++......-..+.+|.|..                          -..||++|++.|+|+-
T Consensus       256 ~A~vVitNPTH~AVAL~Y~~~~~~aP~vvAKG~d~~--------------------------A~~Ir~~A~~~~VPiv  307 (360)
T PRK06298        256 HASAVVSNPKDIAVAIGYMPEKYKAPWIIAMGINLR--------------------------AKRIIAEAEKYGIPIM  307 (360)
T ss_pred             CCCEEEECCCEEEEEEEECCCCCCCCEEEEECCCHH--------------------------HHHHHHHHHHCCCCEE
T ss_conf             998899888617888666689999998888548599--------------------------9999999998799887


No 222
>KOG0250 consensus
Probab=43.08  E-value=25  Score=15.75  Aligned_cols=74  Identities=23%  Similarity=0.274  Sum_probs=42.8

Q ss_pred             EEEEEECCCHHHHHHHHHHH-------------------HCC--CEEEEEEEECCCCCCCCC------------------
Q ss_conf             89999609857999999998-------------------869--849999987047876655------------------
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLK-------------------RDG--YDVIGVTLQLYNSRKASK------------------   62 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~-------------------~~G--~~V~g~~m~~~~~~~~~~------------------   62 (408)
                      ..+||=-|-=-|++-++|-.                   +.|  +-.+-++|.|-..+..-.                  
T Consensus        65 NfI~G~NGSGKSAIltAl~lglG~rAs~tnRgsslK~lIK~G~~~A~IsItL~N~G~~Afk~eiyG~~IiIER~I~~~~S  144 (1074)
T KOG0250          65 NFIVGNNGSGKSAILTALTLGLGGRASATNRGSSLKDLIKDGCSSAKISITLSNSGLDAFKPEIYGNSIIIERTIRRSSS  144 (1074)
T ss_pred             EEEECCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHCCCCCEEEEEEEECCCCCCCCHHHCCCEEEEEEEECCCCC
T ss_conf             37646898748999999998626531456530439999967875148999982577666774543880599986235652


Q ss_pred             -------CCCCCCCHHHHHHHHHHHHHCCCCEE------ECCHHHHH
Q ss_conf             -------55778818999999999998099589------81707886
Q gi|254780151|r   63 -------RKGSCCAGQDVYDARRVCDTINVSHY------VFDYEERF   96 (408)
Q Consensus        63 -------~~~~c~~~~d~~~a~~va~~LgI~~~------~~d~~~~f   96 (408)
                             ..|...| .--+|.+.|+.+++|++.      ..|.+.+|
T Consensus       145 ~~~~~~~~~grvVS-tKk~dl~~vv~~f~I~veNP~~~lsQD~aR~F  190 (1074)
T KOG0250         145 TYYLLRSANGRVVS-TKKEDLDTVVDHFNIQVENPMFVLSQDAARSF  190 (1074)
T ss_pred             HHHHHHHCCCCCCC-CCHHHHHHHHHHHCCCCCCCCHHHCHHHHHHH
T ss_conf             58887603676223-61988999999828677784023048889999


No 223
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional
Probab=42.95  E-value=25  Score=15.73  Aligned_cols=29  Identities=28%  Similarity=0.345  Sum_probs=23.3

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             63388999960985799999999886984
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      .|+..|+|-=..|.-|..|+.+|++.||.
T Consensus        58 dK~~~IvvyC~sG~RS~~A~~~L~~~Gy~   86 (104)
T PRK10287         58 DKNDTVKVYCNAGRQSGQAKEILSEMGYT   86 (104)
T ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHCCCC
T ss_conf             77993899869983899999999976997


No 224
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional
Probab=42.90  E-value=25  Score=15.73  Aligned_cols=44  Identities=16%  Similarity=0.091  Sum_probs=27.6

Q ss_pred             HHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   32 DSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        32 DSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      |. ++..+|++.|++|.-++=+                  +-.-+++.|++|||++......+
T Consensus        56 DG-~gi~~l~~~Gi~v~iISg~------------------~s~~v~~Ra~~Lgi~~~~~g~~d   99 (186)
T PRK09484         56 DG-YGIRCLLTSGIEVAIITGR------------------KSKIVEDRMTTLGITHIYQGQSN   99 (186)
T ss_pred             HH-HHHHHHHHCCCEEEEEECC------------------CCHHHHHHHHHHCCCEEEECHHH
T ss_conf             75-9999999879969999478------------------88899999996189889937076


No 225
>TIGR02635 RhaI_grampos L-rhamnose isomerase; InterPro: IPR013457    The proteins in this entry are closely related to the L-rhamnose isomerases (IPR013451 from INTERPRO) found in Pseudomonas stutzeri  and in a number of the Rhizobiales. They are encoded in similar genomic contexts, close to genes apparently involved in rhamnose catabolism such as rhamnulose-1-phosphate aldolase (IPR013454 from INTERPRO), sugar kinases, and sugar transporters..
Probab=42.75  E-value=18  Score=16.80  Aligned_cols=41  Identities=12%  Similarity=0.229  Sum_probs=22.4

Q ss_pred             HHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEEC
Q ss_conf             9999999999980995898170788663224411267870886120000
Q gi|254780151|r   71 QDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD  119 (408)
Q Consensus        71 ~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~  119 (408)
                      +||..-++-|+.+|+.+=.|| .+-|++.       .|+=|---||+-.
T Consensus        69 ~Dy~~L~~yAE~~Gl~~GaiN-pNlFQDD-------DYKfGSlThp~~~  109 (382)
T TIGR02635        69 DDYEELAEYAEELGLKLGAIN-PNLFQDD-------DYKFGSLTHPDKR  109 (382)
T ss_pred             CCHHHHHHHHHHCCCCCCCCC-CCCCCCC-------CCCCCCCCCHHHH
T ss_conf             026999999987288444537-8767685-------4355676573479


No 226
>PRK06029 3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Provisional
Probab=42.75  E-value=25  Score=15.71  Aligned_cols=30  Identities=23%  Similarity=0.282  Sum_probs=23.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHH----CCCEEEEE
Q ss_conf             8899996098579999999988----69849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKR----DGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~----~G~~V~g~   50 (408)
                      +||+||+||.--...+..||+.    .+.||.-+
T Consensus         2 krIvvgITGASGa~ya~rll~~L~~~~~~ev~lv   35 (187)
T PRK06029          2 KRLIVGISGASGAIYGVRLLQVLRDVEEVETHLV   35 (187)
T ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             7399998528889999999999864289569999


No 227
>TIGR01472 gmd GDP-mannose 4,6-dehydratase; InterPro: IPR006368   This family represent GDP-mannose 4,6-dehydratase, also known as GDP-D-mannose dehydratase. This enzyme converts GDP-mannose to GDP-4-dehydro-6-deoxy-D-mannose, the first of three steps for the conversion of GDP-mannose to GDP-fucose in animals, plants, and bacteria. In bacteria, GDP-L-fucose acts as a precursor of surface antigens such as the extracellular polysaccharide colanic acid of Escherichia coli. Excluded from this family are members of the clade that are poorly related because of highly dervied (phylogenetically long-branch) sequences, e.g. Aneurinibacillus thermoaerophilus Gmd, described as a bifunctional GDP-mannose 4,6-dehydratase/GDP-6-deoxy-D-lyxo-4-hexulose reductase .; GO: 0008446 GDP-mannose 46-dehydratase activity, 0019673 GDP-mannose metabolic process, 0005622 intracellular.
Probab=42.60  E-value=22  Score=16.05  Aligned_cols=95  Identities=21%  Similarity=0.290  Sum_probs=52.5

Q ss_pred             CHHHHHHHHHHHHCCCEEEEEEEECCCCC----------CCCCCCC---CCCCHHHHHHHHHHHHHCC--CCEEECCHHH
Q ss_conf             85799999999886984999998704787----------6655557---7881899999999999809--9589817078
Q gi|254780151|r   30 GVDSSVVAALLKRDGYDVIGVTLQLYNSR----------KASKRKG---SCCAGQDVYDARRVCDTIN--VSHYVFDYEE   94 (408)
Q Consensus        30 GVDSsvaa~lL~~~G~~V~g~~m~~~~~~----------~~~~~~~---~c~~~~d~~~a~~va~~Lg--I~~~~~d~~~   94 (408)
                      |=|=|.-|=+|-+.||+|+|+.=|-.+-+          .....++   ---.==|+.|+..+.+-+.  =|+++.|+.-
T Consensus        10 GQDGSYLAE~LL~~GYeVHG~~RRSSSfNT~Ri~hiY~~~h~~~~r~A~~fLHYGDlTDs~~L~~~i~~~kP~EiYNLAA   89 (365)
T TIGR01472        10 GQDGSYLAEFLLEKGYEVHGLIRRSSSFNTQRIEHIYEDPHKEEKRRALMFLHYGDLTDSSNLVKLIDEIKPTEIYNLAA   89 (365)
T ss_pred             CCCHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHCCCCEEECCCC
T ss_conf             57678999998726968764586255425224567640535410166135420442106899999974048863420202


Q ss_pred             HHHHHCCCCC-HHHHHCCCCCCCEECCCCEEEHHHH--HHHHCCCC
Q ss_conf             8663224411-2678708861200001541105888--88740168
Q gi|254780151|r   95 RFRNAVIVPF-ASSYAAGETPLPCVDCNRTVKFSDL--LSVTRQLG  137 (408)
Q Consensus        95 ~f~~~V~~~~-~~~y~~G~TPNPc~~CN~~iKF~~l--~~~a~~~g  137 (408)
                        +.+|=--| +-+|-    -|-+       =.|+|  ||..+.++
T Consensus        90 --QSHV~VSFe~PeYT----a~~~-------g~GTLrlLEA~r~hn  122 (365)
T TIGR01472        90 --QSHVKVSFEIPEYT----ADVD-------GIGTLRLLEAVRSHN  122 (365)
T ss_pred             --CCCEEEECCCCCCH----HCHH-------HHHHHHHHHHHHHHH
T ss_conf             --37103541652000----0124-------431778999874233


No 228
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=42.55  E-value=25  Score=15.69  Aligned_cols=99  Identities=15%  Similarity=0.181  Sum_probs=57.3

Q ss_pred             EEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             99996098579999999-98869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      -++++|.|.-...++.+ |.+.|-+|+..-      +         +.--...-.+.....+||....+|..+.      
T Consensus        80 ~a~~~sSGmaAi~~~l~~ll~~Gd~vv~~~------~---------~Yggt~~~~~~~l~~~Gi~v~~~d~~d~------  138 (426)
T PRK05994         80 AALAVASGHAAQFLVFHTLLQPGDEFIAAR------K---------LYGGSINQFGHAFKSFGWQVRWADADDP------  138 (426)
T ss_pred             EEEEECCHHHHHHHHHHHHHCCCCEEEECC------C---------CCHHHHHHHHHHHHHCCEEEEEECCCCH------
T ss_conf             289944889999999999727899899848------7---------4268999999998608869999789983------


Q ss_pred             CCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEE-----CCCCC
Q ss_conf             4112678708861200001-----54110---5888887401687645-----22531
Q gi|254780151|r  102 VPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVL-----ATGHY  146 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~i-----ATGHY  146 (408)
                          ++.++-.+||..+..     |+.++   ..++.+.|++.|+-.+     ||+.+
T Consensus       139 ----~~~~~~i~~~T~lv~~EspsNP~l~v~Di~~ia~iA~~~g~~~vVDNT~atP~~  192 (426)
T PRK05994        139 ----ASFEAAITPRTKAIFIESIANPGGTITDIEAIAEVAHRAGLPLIVDNTLASPYL  192 (426)
T ss_pred             ----HHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCHHHH
T ss_conf             ----889973688754999987899887234789999999971991786356520431


No 229
>TIGR02855 spore_yabG sporulation peptidase YabG; InterPro: IPR008764   Peptidases are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry. Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins.   Families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule.     The peptidases families associated with clan U- have an unknown catalytic mechanism as the protein fold of the active site domain and the active site residues have not been reported.   This is a group of peptidases belong to MEROPS peptidase family U57 (clan U-). The type example is the YabG protein of Bacillus subtilis. This is a protease involved in the synthesis and maturation of the spore coat proteins SpoIVA and YrbA of Bacillus subtilis ..
Probab=42.54  E-value=15  Score=17.20  Aligned_cols=41  Identities=7%  Similarity=0.085  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEEC
Q ss_conf             99999999980995898170788663224411267870886120000
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD  119 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~  119 (408)
                      ++-..++=++||+|.+-+-+.|.=.-.-+..+++.|      +|||.
T Consensus       126 L~~C~~~Y~~~gv~V~G~~~~E~emPe~v~~L~~~~------~PDIl  166 (292)
T TIGR02855       126 LRKCLKLYKKLGVPVVGIHCKEKEMPEKVLDLIEEV------RPDIL  166 (292)
T ss_pred             HHHHHHHHHHCCCCEEEEEEEECCCCHHHHHHHHHH------CCCEE
T ss_conf             999999886619727999984121808899999730------99789


No 230
>PRK06849 hypothetical protein; Provisional
Probab=42.42  E-value=25  Score=15.68  Aligned_cols=75  Identities=19%  Similarity=0.177  Sum_probs=36.9

Q ss_pred             CEEEEEECCC--HHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCC------CCCC-HHHHHHHHHHHHHCCCCEEEC
Q ss_conf             8899996098--57999999998869849999-987047876655557------7881-899999999999809958981
Q gi|254780151|r   21 MRVVVAMSGG--VDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKG------SCCA-GQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        21 ~kV~va~SGG--VDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~------~c~~-~~d~~~a~~va~~LgI~~~~~   90 (408)
                      ++|+|  +||  -=+.-.|.+|.++|+.|+.+ +++.+-...+....+      .... +.=+.....+++.-+|++.+=
T Consensus         5 ~tvLi--Tg~r~~~aL~laR~l~~~Gh~V~~aD~~~~~l~r~Sr~v~~~~~vP~P~~d~~~y~~~Ll~Iv~~e~idl~IP   82 (387)
T PRK06849          5 KTVLI--TGARAPAALQLARSFHNAGHTVILADSLKYPLSRFSRAVDGFYTIPSPKWDPNAYIQALLSIVKRHNIDLLIP   82 (387)
T ss_pred             CEEEE--ECCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             77999--5886078999999998789979998489877542000011279869997898999999999999838999997


Q ss_pred             CHHHHHH
Q ss_conf             7078866
Q gi|254780151|r   91 DYEERFR   97 (408)
Q Consensus        91 d~~~~f~   97 (408)
                      =.++-|.
T Consensus        83 ~~eev~~   89 (387)
T PRK06849         83 TCEEVFY   89 (387)
T ss_pred             CCCHHHH
T ss_conf             7768999


No 231
>cd02651 nuc_hydro_IU_UC_XIUA nuc_hydro_IU_UC_XIUA: inosine-uridine preferring, xanthosine-inosine-uridine-adenosine-preferring and, uridine-cytidine preferring nucleoside hydrolases.  Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. These enzymes vary in their substrate specificity. This group contains proteins similar to nucleoside hydrolases which hydrolyze both pyrimidine and purine ribonucleosides: the inosine-uridine preferring nucleoside hydrolase from Crithidia fasciculata, the inosine-uridine-xanthosine preferring nucleoside hydrolase RihC from Escherichia coli and the xanthosine-inosine-uridine-adenosine-preferring nucleoside hydrolase RihC from Salmonella enterica serovar Typhimurium. This group also contains proteins similar to the pyrimidine-specific uridine-cytidine preferring nucleoside hydrolases URH1 from Saccharomyces cerevisiae, E. coli RihA and E. coli RihB.  E. coli  RihA is equally efficient with uridine a
Probab=42.35  E-value=25  Score=15.67  Aligned_cols=57  Identities=18%  Similarity=0.254  Sum_probs=39.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEEE
Q ss_conf             999960985799999999886-98499999870478766555577881899999999999809---95898
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHYV   89 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~~   89 (408)
                      |++=-..|+|-++|..++..+ -.+|.|++.-.          |-|..++..+.+.++.+.+|   ||.+.
T Consensus         2 vIiDtD~G~DDa~Al~~al~~~~iel~gIt~v~----------GN~~~~~~~~n~~~~l~~~g~~~iPV~~   62 (302)
T cd02651           2 IIIDCDPGHDDAVAILLALFHPELDLLGITTVA----------GNVPLEKTTRNALKLLTLLGRTDVPVAA   62 (302)
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             799899967999999999778998699999797----------8868999999999999984899998763


No 232
>pfam01312 Bac_export_2 FlhB HrpN YscU SpaS Family. This family includes the following members: FlhB, HrpN, YscU, SpaS, HrcU SsaU and YopU. All of these proteins export peptides using the type III secretion system. The peptides exported are quite diverse.
Probab=42.29  E-value=25  Score=15.66  Aligned_cols=50  Identities=28%  Similarity=0.413  Sum_probs=28.4

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             87645225--31102541267877316885315787873189863020221003342568997898999974125435
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .+|.|.|-  |||=.-.++......-..+.+|.|.               +           -..+|++|++.|+|+-
T Consensus       257 ~A~vVItNPTH~AVAL~Y~~~~~~aP~vvAKG~d~---------------~-----------A~~Ir~~A~~~~VPiv  308 (343)
T pfam01312       257 KADVVVTNPTHYAVALYYDPEEMPAPRIVAKGEDE---------------Q-----------ALAIRAIAEENGIPVV  308 (343)
T ss_pred             CCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCH---------------H-----------HHHHHHHHHHCCCCEE
T ss_conf             89889999986278988788999999888854869---------------9-----------9999999998799788


No 233
>PRK12921 2-dehydropantoate 2-reductase; Provisional
Probab=42.29  E-value=25  Score=15.66  Aligned_cols=30  Identities=30%  Similarity=0.341  Sum_probs=24.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899996098579999999988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+|-=.|++-|.++ +.|.++|++|+-+.
T Consensus         1 MkI~I~GaGAiG~~~a-~~L~~~g~~V~lv~   30 (306)
T PRK12921          1 MKIAVVGAGAVGGTFG-ARLLEAGRDVTFLG   30 (306)
T ss_pred             CEEEEECCCHHHHHHH-HHHHHCCCCEEEEE
T ss_conf             9899999249999999-99983699889997


No 234
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional
Probab=42.18  E-value=25  Score=15.65  Aligned_cols=96  Identities=14%  Similarity=0.136  Sum_probs=55.7

Q ss_pred             EEEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999-9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-++++|.|.--..++.+ |.++|-+|+.-- ..+           -+   ...-.+.+...+||....+|..+      
T Consensus        89 ~~a~~~sSGMaAi~~~ll~ll~~Gd~iv~~~-~~Y-----------Gg---T~~l~~~~l~~~GI~~~~vd~~d------  147 (406)
T PRK07810         89 PACFATASGMAAVFTALGALLGAGDRLVAAR-SLF-----------GS---CFVVCNEILPRWGVETVFVDGDD------  147 (406)
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCEEEEEC-CCC-----------CC---HHHHHHHHHHCCCEEEEEECCCC------
T ss_conf             8599843899999999999728999899837-986-----------37---79999977644874999968988------


Q ss_pred             CCCCHHHHHCCCCCCCEE-C----CCCEEE---HHHHHHHHCCCCCCEEC
Q ss_conf             441126787088612000-0----154110---58888874016876452
Q gi|254780151|r  101 IVPFASSYAAGETPLPCV-D----CNRTVK---FSDLLSVTRQLGADVLA  142 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~-~----CN~~iK---F~~l~~~a~~~g~~~iA  142 (408)
                          +++.++..+||..+ .    +|+.++   ..++.+.|++.|+..|.
T Consensus       148 ----~~~~~~ai~~~Tk~v~~EtpsNP~l~v~Di~aia~iA~~~g~~~vV  193 (406)
T PRK07810        148 ----LSQWEEALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVL  193 (406)
T ss_pred             ----HHHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEE
T ss_conf             ----5999975588862899844899985611679999999974985999


No 235
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]
Probab=42.06  E-value=23  Score=15.98  Aligned_cols=59  Identities=25%  Similarity=0.447  Sum_probs=36.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCCCCCCHHHHHHHHH-HHHHCCCCEEECCHHH
Q ss_conf             9999609857999999998869849999-9870478766555577881899999999-9998099589817078
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKGSCCAGQDVYDARR-VCDTINVSHYVFDYEE   94 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~~c~~~~d~~~a~~-va~~LgI~~~~~d~~~   94 (408)
                      +++|=-+-=-|.+|..|.++-|-+|+.+ -|+.+-             .=|+--|+- ..+.-+||||.+|+.+
T Consensus         7 ~I~GPTAsGKT~lai~LAk~~~~eIIs~DSmQvYr-------------~mdIGTAKps~~e~~~vpHhliDi~~   67 (308)
T COG0324           7 VIAGPTASGKTALAIALAKRLGGEIISLDSMQVYR-------------GLDIGTAKPSLEELAGVPHHLIDIRD   67 (308)
T ss_pred             EEECCCCCCHHHHHHHHHHHCCCCEEECCHHHHCC-------------CCCCCCCCCCHHHHCCCCEEEECCCC
T ss_conf             99898875778999999998299289302355318-------------88630799999998589978754568


No 236
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=41.96  E-value=26  Score=15.63  Aligned_cols=94  Identities=14%  Similarity=0.224  Sum_probs=56.5

Q ss_pred             EEEEECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             99996098579999999--9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   23 VVVAMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        23 V~va~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      -.+++|.|. +++++.+  |.+.|-+|+..- ..+              .-...-...+...+||....+|..+.     
T Consensus        81 ~a~~~sSGm-aAis~~l~~ll~~Gd~iv~~~-~~Y--------------ggT~~l~~~~l~~~Gi~~~~vd~~d~-----  139 (433)
T PRK08134         81 GAIATASGQ-AALHLAIATLMGAGSHIVASS-ALY--------------GGSHNLLHYTLPRFGIETTFVKPRDI-----  139 (433)
T ss_pred             CEEEECCHH-HHHHHHHHHHCCCCCEEEECC-CEE--------------CCHHHHHHHHHHHCCEEEEEECCCCH-----
T ss_conf             279853889-999999997489999899718-807--------------73799999877634837999889784-----


Q ss_pred             CCCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEEC
Q ss_conf             44112678708861200001-----54110---58888874016876452
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVLA  142 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~iA  142 (408)
                           ++.++..+||..+..     |+.++   ..++.+.|++.|+..|.
T Consensus       140 -----~~~~~~i~~~Tklv~~EspsNP~l~v~Di~aia~iA~~~g~~~vV  184 (433)
T PRK08134        140 -----DGWRAAIRPNTRLLFGETLGNPGLEVLDIPTVAAIAHEAGVPLLV  184 (433)
T ss_pred             -----HHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             -----678875598752899853899975035899999999756761997


No 237
>COG4189 Predicted transcriptional regulator [Transcription]
Probab=41.94  E-value=14  Score=17.47  Aligned_cols=16  Identities=0%  Similarity=0.304  Sum_probs=11.7

Q ss_pred             HHHHHHHCCCCEEECC
Q ss_conf             9999998099589817
Q gi|254780151|r   76 ARRVCDTINVSHYVFD   91 (408)
Q Consensus        76 a~~va~~LgI~~~~~d   91 (408)
                      +..+|++||+|--++.
T Consensus        40 vneiAe~lgLpqst~s   55 (308)
T COG4189          40 VNEIAEALGLPQSTMS   55 (308)
T ss_pred             HHHHHHHHCCCHHHHH
T ss_conf             8999988588656666


No 238
>TIGR01404 FlhB_rel_III type III secretion protein, YscU/HrpY family; InterPro: IPR006307   This is one of several families of proteins related to bacterial flagellar biosynthesis proteins and involved in bacterial type III protein secretion systems. This family is homologous to, but distinguished from, the flagellar biosynthetic protein FlhB (IPR006136 from INTERPRO). This model may not identify all type III secretion system FlhB homologs. ; GO: 0006810 transport, 0016021 integral to membrane.
Probab=41.65  E-value=14  Score=17.46  Aligned_cols=13  Identities=31%  Similarity=0.345  Sum_probs=5.7

Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             8989999741254
Q gi|254780151|r  198 ESVRDLAREMGLD  210 (408)
Q Consensus       198 ~eVR~~A~~~gl~  210 (408)
                      ..||+.|+++|+|
T Consensus       295 ~~~~~~A~~~giP  307 (346)
T TIGR01404       295 LAVIAYAEEAGIP  307 (346)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999975898


No 239
>cd02067 B12-binding B12 binding domain (B12-BD). This domain binds different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide, it is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins.
Probab=41.65  E-value=26  Score=15.60  Aligned_cols=103  Identities=16%  Similarity=0.218  Sum_probs=52.7

Q ss_pred             EEEEEECCC----HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             899996098----5799999999886984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   22 RVVVAMSGG----VDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        22 kV~va~SGG----VDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      ||++|.-+|    +---+.+.+|...||+|+-+-              ...+.+++-   +.+.+.+.....+...-...
T Consensus         1 kvvi~~v~gD~H~iG~~iv~~~l~~~G~~V~~lG--------------~~vp~e~~v---~~a~~~~~d~I~lS~~~~~~   63 (119)
T cd02067           1 KVVIATVGGDGHDIGKNIVARALRDAGFEVIDLG--------------VDVPPEEIV---EAAKEEDADAIGLSGLLTTH   63 (119)
T ss_pred             CEEEEECCCCHHHHHHHHHHHHHHHCCCEEEECC--------------CCCCHHHHH---HHHHHCCCCEEEEECCCCCC
T ss_conf             9899963985677899999999997899899899--------------999999999---99997099999996220242


Q ss_pred             HHCCCCCHHHHH-CCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECC
Q ss_conf             322441126787-0886120000154110588888740168764522
Q gi|254780151|r   98 NAVIVPFASSYA-AGETPLPCVDCNRTVKFSDLLSVTRQLGADVLAT  143 (408)
Q Consensus        98 ~~V~~~~~~~y~-~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iAT  143 (408)
                      -..+..+++..+ +|. +++=+.|--.+ |..=.+.++++|+|..+.
T Consensus        64 ~~~~~~~i~~l~~~g~-~~i~v~vGG~~-~~~~~~~~~~~Gad~~~~  108 (119)
T cd02067          64 MTLMKEVIEELKEAGL-DDIPVLVGGAI-VTRDFKFLKEIGVDAYFG  108 (119)
T ss_pred             HHHHHHHHHHHHHCCC-CCCEEEEECCC-CCHHHHHHHHCCCCEEEC
T ss_conf             6899999999997699-99859998998-974399999869979977


No 240
>PRK00885 phosphoribosylamine--glycine ligase; Provisional
Probab=41.47  E-value=26  Score=15.58  Aligned_cols=116  Identities=18%  Similarity=0.156  Sum_probs=64.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      |||+|-=|||=.-+.|-.|.+..  .|.-+|+--.+..-....+.......|.+...+.|+.-+|.+-++-=+.-.-..+
T Consensus         1 MkVLviGsGgREHAia~kl~~s~--~v~~v~~~PGN~G~~~~~~~~~i~~~d~~~l~~~a~~~~idlviiGPE~pL~~Gi   78 (424)
T PRK00885          1 MKVLVIGSGGREHALAWKLAQSP--LVEKVYVAPGNAGTALEAENVAIDVTDIEALVAFAKEEGIDLTVVGPEAPLVAGI   78 (424)
T ss_pred             CEEEEECCCHHHHHHHHHHHHCC--CCCEEEEECCCHHHHHCCEEECCCCCCHHHHHHHHHHCCCCEEEECCCHHHHHHH
T ss_conf             97999888889999999997397--9898999289758874173651285799999999998499999989667887357


Q ss_pred             CCCCHHHHHCCCCCCCEECCCCEEEHHHHHH----HHCCC-CCCEECCCCCC
Q ss_conf             4411267870886120000154110588888----74016-87645225311
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDCNRTVKFSDLLS----VTRQL-GADVLATGHYI  147 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~----~a~~~-g~~~iATGHYa  147 (408)
                      .|.|.+   +|.   ||..=   -|..+-+|    +|+++ --.-|.|.+|.
T Consensus        79 ~D~l~~---~gi---~vfGP---~k~aA~lE~SK~faK~~m~~~~IPTa~~~  121 (424)
T PRK00885         79 VDAFRA---AGL---KIFGP---TKAAAQLEGSKAFAKDFMARYGIPTAAYE  121 (424)
T ss_pred             HHHHHH---CCC---CEECC---CHHHHHHHHHHHHHHHHHHHCCCCCCCEE
T ss_conf             999950---699---46894---97898876637999999998298987548


No 241
>PRK08247 cystathionine gamma-synthase; Reviewed
Probab=41.45  E-value=26  Score=15.58  Aligned_cols=98  Identities=14%  Similarity=0.148  Sum_probs=56.6

Q ss_pred             EEEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999-9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .=.+++|.|. +++++.+ +.++|-+|+.-- ..+           -++   ..-.......+||....+|..+.     
T Consensus        68 ~~a~~f~SGm-aAi~~~l~~l~~Gd~vv~~~-~~Y-----------g~t---~~~~~~~l~~~Gi~~~~~d~~d~-----  126 (366)
T PRK08247         68 DQGFACSSGM-AAIQLVMSLFRSGDELIVSS-DLY-----------GGT---YRLFEEHWKKWGVRFVYVNTASI-----  126 (366)
T ss_pred             CCEEECCCHH-HHHHHHHHHHCCCCEEEEEC-CCC-----------CCH---HHHHHHHHCCCCEEEEEECCCCH-----
T ss_conf             5053116689-99999999738999899958-968-----------648---89988775077469998488897-----


Q ss_pred             CCCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEECCCC
Q ss_conf             44112678708861200001-----54110---58888874016876452253
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~iATGH  145 (408)
                           ++.++..+||.++..     |+.++   ..++.+.|++.|+-.|.--.
T Consensus       127 -----~~~~~~i~~~Tkli~~Esp~NP~l~v~Di~~i~~iA~~~g~~~vvDNT  174 (366)
T PRK08247        127 -----KAIEQAITPNTKAIFIETPTNPLMQETDIAAIAKIAKKHGLLLIVDNT  174 (366)
T ss_pred             -----HHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEECCC
T ss_conf             -----999975386754999855999853501599999998646704984177


No 242
>KOG2666 consensus
Probab=41.41  E-value=19  Score=16.53  Aligned_cols=42  Identities=19%  Similarity=0.485  Sum_probs=29.1

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             7788189999999999980995898170788663224411267870886
Q gi|254780151|r   65 GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGET  113 (408)
Q Consensus        65 ~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~T  113 (408)
                      |.-|..+|+-..--+|+-||+|-     ..+||.+|++  ++.|.+-+-
T Consensus       269 GGSCFQKDiLnLvYiCe~~~LPe-----vA~YWqqVi~--iNdyQk~RF  310 (481)
T KOG2666         269 GGSCFQKDILNLVYICECLNLPE-----VAEYWQQVIK--INDYQKRRF  310 (481)
T ss_pred             CCHHHHHHHHHHHHHHHCCCCHH-----HHHHHHHHHH--HHHHHHHHH
T ss_conf             71167777777888886089768-----9999998720--427989888


No 243
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism]
Probab=41.41  E-value=26  Score=15.57  Aligned_cols=15  Identities=20%  Similarity=0.184  Sum_probs=8.4

Q ss_pred             HHHHHCCCEEEEEEE
Q ss_conf             999886984999998
Q gi|254780151|r   38 ALLKRDGYDVIGVTL   52 (408)
Q Consensus        38 ~lL~~~G~~V~g~~m   52 (408)
                      +..+.+|-.|..+.-
T Consensus        26 ~~~~~~g~~v~vfkp   40 (201)
T COG1435          26 RRYKEAGMKVLVFKP   40 (201)
T ss_pred             HHHHHCCCEEEEEEC
T ss_conf             999975980899852


No 244
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed
Probab=41.32  E-value=26  Score=15.56  Aligned_cols=47  Identities=23%  Similarity=0.339  Sum_probs=31.5

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHH
Q ss_conf             9999999998099589817078866322441126787088612000015411058
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS  127 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~  127 (408)
                      ..+--.-|++-|||+.++.       .=++++++....+..|+.-+.||+ ++|.
T Consensus        78 F~eF~~~~~~~~ip~~IvS-------~G~d~~I~~~L~~~~~~~~I~aN~-~~~~  124 (219)
T PRK09552         78 FHEFVQFVNENNISFYVIS-------GGMDFFVYPLLQGLIPKEQIYCNE-TDFS  124 (219)
T ss_pred             HHHHHHHHHHCCCCEEEEC-------CCCHHHHHHHHHHCCCCCCEEEEE-EEEC
T ss_conf             9999999998599799987-------994699999999608877489635-6873


No 245
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein; InterPro: IPR012693   ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems. ABC transporters are minimally constituted of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These regions can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs.   ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain .    The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyze ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarize the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site , , .   The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis , , , , , .   Proteins known to belong to this family are classified in several functional subfamilies depending on the substrate used (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1).     Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.; GO: 0005524 ATP binding, 0015416 phosphonate transmembrane-transporting ATPase activity, 0015716 phosphonate transport, 0016020 membrane.
Probab=41.29  E-value=26  Score=15.56  Aligned_cols=26  Identities=27%  Similarity=0.515  Sum_probs=15.1

Q ss_pred             CCCCCCCCCCEEEEEECCCHHHHHHH
Q ss_conf             46788863388999960985799999
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGVDSSVVA   37 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGVDSsvaa   37 (408)
                      +.|.=.|...=+++|.||-==|++-=
T Consensus        21 inl~i~~GE~~~~IG~SGAGKSTLLR   46 (253)
T TIGR02315        21 INLEINPGEFVAVIGPSGAGKSTLLR   46 (253)
T ss_pred             ECCEEECCEEEEEECCCCCCHHHHHH
T ss_conf             11434165179997378872679998


No 246
>pfam09778 Guanylate_cyc_2 Guanylyl cyclase. Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate.
Probab=41.28  E-value=26  Score=15.56  Aligned_cols=58  Identities=16%  Similarity=-0.023  Sum_probs=26.5

Q ss_pred             HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCC-CCHHHHHHHHH---HHHHCCCCEEECCHH
Q ss_conf             99999886984999998704787665555778-81899999999---999809958981707
Q gi|254780151|r   36 VAALLKRDGYDVIGVTLQLYNSRKASKRKGSC-CAGQDVYDARR---VCDTINVSHYVFDYE   93 (408)
Q Consensus        36 aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c-~~~~d~~~a~~---va~~LgI~~~~~d~~   93 (408)
                      -|+||++-|....=.|.-+.-.......+=+. +.++|.+.+.+   -|+.-||..+.-..+
T Consensus        51 LayLL~~fgV~h~f~T~TlGvnp~y~~~~FY~~~~~~D~~RV~~lF~~A~~~gI~Ie~rSvs  112 (212)
T pfam09778        51 LAYLLKKFGVRHSYFTQTLGANPNYSVETFYKKHFDADEVRVNELFQKAESAGIDVECRSVS  112 (212)
T ss_pred             HHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             99999982987799965147687755301687753228999999999999749806991027


No 247
>pfam05005 Ocnus Janus/Ocnus family (Ocnus). This family is comprised of the Ocnus, Janus-A and Janus-B proteins. These proteins have been found to be testes specific in Drosophila melanogaster.
Probab=41.26  E-value=11  Score=18.13  Aligned_cols=12  Identities=42%  Similarity=0.739  Sum_probs=8.9

Q ss_pred             EEEEEEEECCCC
Q ss_conf             888768971455
Q gi|254780151|r  376 RVLGGGIISGSK  387 (408)
Q Consensus       376 ~vLGGGiI~~t~  387 (408)
                      +|||||.|....
T Consensus        63 eclGGGrI~h~~   74 (109)
T pfam05005        63 ECLGGGRIEHDQ   74 (109)
T ss_pred             EEECCEEEEECC
T ss_conf             987780688668


No 248
>PRK07811 cystathionine gamma-synthase; Provisional
Probab=41.22  E-value=26  Score=15.55  Aligned_cols=99  Identities=17%  Similarity=0.195  Sum_probs=58.2

Q ss_pred             EEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             99996098579999999-98869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      -++++|.|.--..++.+ |.+.|-+|+..- ..+              .-...-...++..+||....+|..+.      
T Consensus        75 ~a~~~sSGmaAi~~~l~~ll~~Gd~iv~~~-~~Y--------------ggT~~l~~~~l~~~Gi~~~~vd~~d~------  133 (386)
T PRK07811         75 YGRAFSSGMAATDCLLRAVLRPGDHIVIPN-DAY--------------GGTFRLIDKVFTRWGVEYTPVDLSDL------  133 (386)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCEEEECC-CCC--------------HHHHHHHHHHHHHCCEEEEEECCCCH------
T ss_conf             789833399999999999838999899378-765--------------21999999998735804997788787------


Q ss_pred             CCCHHHHHCCCCCCCEEC-----CCCEEE---HHHHHHHHCCCCCCEECCCCC
Q ss_conf             411267870886120000-----154110---588888740168764522531
Q gi|254780151|r  102 VPFASSYAAGETPLPCVD-----CNRTVK---FSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~-----CN~~iK---F~~l~~~a~~~g~~~iATGHY  146 (408)
                          ++.++-.+||..+.     +|+.++   ..++.+.|++.|+..|+--.+
T Consensus       134 ----~~~~~~i~~~Tkli~~Esp~NP~l~v~Di~~i~~ia~~~g~~~vVDNT~  182 (386)
T PRK07811        134 ----DAVRAAITPRTKLIWVETPTNPLLSITDIAAIAELAHDAGAKVVVDNTF  182 (386)
T ss_pred             ----HHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCEEEEECCC
T ss_conf             ----8898655888349999779998764058589999998557818831673


No 249
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily. This CD includes Escherichia coli YgaP, and similar uncharacterized putative rhodanese-related sulfurtransferases.
Probab=41.06  E-value=26  Score=15.54  Aligned_cols=31  Identities=10%  Similarity=-0.010  Sum_probs=21.4

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             8863388999960985799999999886984
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      ..++++.|++-=.+|.-|+.||.+|+++|+.
T Consensus        50 ~~~~~~~vv~~C~~G~RS~~aa~~L~~~g~~   80 (99)
T cd01527          50 PLVGANAIIFHCRSGMRTQQNAERLAAISAG   80 (99)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHCCCC
T ss_conf             3578986999879973699999999985998


No 250
>COG2012 RPB5 DNA-directed RNA polymerase, subunit H, RpoH/RPB5 [Transcription]
Probab=40.82  E-value=25  Score=15.66  Aligned_cols=54  Identities=22%  Similarity=0.335  Sum_probs=40.2

Q ss_pred             HHCEEECCCCC-CCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECC
Q ss_conf             21003342568-997898999974125435511102301112775103455307664346711037
Q gi|254780151|r  184 QLCDLRFPLGD-MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL  248 (408)
Q Consensus       184 ~L~~~~FPlg~-~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~  248 (408)
                      .+...+-|=.+ +..+|.+++.+++++.-.         ++|+....|=+.++++  +++|+||-+
T Consensus         9 v~~H~lVPeH~vls~eE~~~vLk~l~i~~~---------qLPkI~~~DPva~~lg--ak~GdvVkI   63 (80)
T COG2012           9 VLDHELVPEHEVLSEEEAKEVLKELGIEPE---------QLPKIKASDPVAKALG--AKPGDVVKI   63 (80)
T ss_pred             ECCCCCCCCEEECCHHHHHHHHHHHCCCHH---------HCCCCCCCCHHHHHHC--CCCCCEEEE
T ss_conf             010222686487399999999999498978---------8885024676677706--787867999


No 251
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional
Probab=40.30  E-value=27  Score=15.46  Aligned_cols=32  Identities=25%  Similarity=0.265  Sum_probs=23.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             633889999609857999999998869849999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      ...+||+|- -+|--...||+-|...||+|+=+
T Consensus       191 ~tGKkVAII-GaGPAGLsaAy~L~~~Gh~VTVf  222 (652)
T PRK12814        191 KSGKKVAII-GAGPAGLTAAYYLLRKGHDVTIF  222 (652)
T ss_pred             CCCCEEEEE-CCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             889979996-83789999999999779906998


No 252
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated
Probab=40.09  E-value=27  Score=15.43  Aligned_cols=95  Identities=18%  Similarity=0.151  Sum_probs=54.4

Q ss_pred             EEEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999-9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-++++|.|. +++++.| +.+.|-+|+..- ..+           -+   ...-.+.....+||....+|..+.     
T Consensus        66 ~~a~~~sSGm-AAi~a~la~~~~Gd~iv~~~-~~Y-----------g~---t~~~~~~~l~~~GI~~~~vd~~d~-----  124 (379)
T PRK06176         66 VKGFAFASGL-AGIHAVFSLFQSGDHVLLGD-DVY-----------GG---TFRLFDKVLVKNGLSCTIIDTSDL-----  124 (379)
T ss_pred             CCEEECCCHH-HHHHHHHHHHCCCCEEEEEC-CCC-----------CC---HHHHHHHHHHCCCEEEEEECCCCH-----
T ss_conf             6533125579-99999999868999899818-988-----------87---767459876447849998678676-----


Q ss_pred             CCCCHHHHHCCCCCCCEEC-----CCCEEE---HHHHHHHHCCCCCCEEC
Q ss_conf             4411267870886120000-----154110---58888874016876452
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVD-----CNRTVK---FSDLLSVTRQLGADVLA  142 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~-----CN~~iK---F~~l~~~a~~~g~~~iA  142 (408)
                           ++.++..+||.++.     .|+.++   ..++.+.|++.|+-.|.
T Consensus       125 -----~~~~~~i~~~Tklv~~EspsNP~l~v~Di~~ia~ia~~~gi~~vv  169 (379)
T PRK06176        125 -----SQIKKAIKPNTKALYLETPSNPLLKITDLAQCASVAKDHGLLTIV  169 (379)
T ss_pred             -----HHHHHHCCCCCEEEEEECCCCCCCCCCCCHHHHHHHHHCCCEEEE
T ss_conf             -----889965687745999977999876015858999999976987997


No 253
>cd02929 TMADH_HD_FMN Trimethylamine dehydrogenase (TMADH) and histamine dehydrogenase (HD) FMN-binding domain.  TMADH is an iron-sulfur flavoprotein that catalyzes the oxidative demethylation of trimethylamine to form dimethylamine and formaldehyde. The protein forms a symetrical dimer with each subunit containing one 4Fe-4S cluster and one FMN cofactor.  It contains a unique flavin, in the form of a 6-S-cysteinyl FMN  which is bent by ~25 degrees along the N5-N10 axis of the flavin isoalloxazine ring. This modification of the conformation of the flavin is thought to facilitate catalysis.The closely related histamine dehydrogenase catalyzes oxidative deamination of histamine.
Probab=39.81  E-value=28  Score=15.40  Aligned_cols=44  Identities=9%  Similarity=0.006  Sum_probs=19.9

Q ss_pred             CCCEEECCCEECCCCCCC--CCCCCCE---EEEEEEECCCCCCEEEEEEE
Q ss_conf             221120022303776555--4456871---89999801788700899982
Q gi|254780151|r  300 VHRIYLREINWLGDGLFE--DAVVDGF---KCFVKIRSSQDPVPVFVQRN  344 (408)
Q Consensus       300 ~~~i~l~d~nWi~~~~~~--~~~~~~~---~~~vkiR~~~~pvp~~i~~~  344 (408)
                      .-+-.+.|+.|+......  +.+....   .|..+ -+.+.++.|.+++.
T Consensus       318 ~gR~llaDPd~~~K~~~Gr~~~I~~Ci~Cn~C~~~-~~~~~~~~C~vNP~  366 (370)
T cd02929         318 AARPSIADPFLPKKIREGRIDDIRECIGCNICISG-DEGGVPMRCTQNPT  366 (370)
T ss_pred             HHHHHHHCCHHHHHHHCCCCCCCCCCCCCHHHHHH-HHCCCCCEECCCCC
T ss_conf             34798769539999980896668758451234634-51699756056865


No 254
>pfam00551 Formyl_trans_N Formyl transferase. This family includes the following members. Glycinamide ribonucleotide transformylase catalyses the third step in de novo purine biosynthesis, the transfer of a formyl group to 5'-phosphoribosylglycinamide. Formyltetrahydrofolate deformylase produces formate from formyl- tetrahydrofolate. Methionyl-tRNA formyltransferase transfers a formyl group onto the amino terminus of the acyl moiety of the methionyl aminoacyl-tRNA. Inclusion of the following members is supported by PSI-blast. HOXX_BRAJA (P31907) contains a related domain of unknown function. PRTH_PORGI (P46071) contains a related domain of unknown function. Y09P_MYCTU (Q50721) contains a related domain of unknown function.
Probab=39.70  E-value=28  Score=15.39  Aligned_cols=57  Identities=18%  Similarity=0.292  Sum_probs=34.0

Q ss_pred             CEEEEEECCCHHHHHHHH-HHHHCCC--EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             889999609857999999-9988698--4999998704787665555778818999999999998099589817078
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAA-LLKRDGY--DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~-lL~~~G~--~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      |||+|-.||+=-...+.. -+++.++  ++..|.-   +..              -..+.+-|+..+||..+++..+
T Consensus         1 mkiavl~SG~Gsnl~~Il~a~~~~~l~~~I~~Vis---n~~--------------~~~~~~~a~~~~ip~~~~~~~~   60 (181)
T pfam00551         1 MKIAVLISGTGSNLQALLDALRKGGHEVEIVAVVT---NKD--------------KAAGLERAEQAGIPVEVFEHKN   60 (181)
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEE---CCC--------------CHHHHHHHHHCCCCEEEECCCC
T ss_conf             98999990796659999999981999988999995---895--------------7288889998599989806778


No 255
>TIGR00416 sms DNA repair protein RadA; InterPro: IPR004504   RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ).   RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC .; GO: 0003684 damaged DNA binding, 0005524 ATP binding, 0006281 DNA repair.
Probab=39.67  E-value=9.9  Score=18.59  Aligned_cols=19  Identities=21%  Similarity=0.588  Sum_probs=9.9

Q ss_pred             HHHHHHCCCCCCEECCCCC
Q ss_conf             8888740168764522531
Q gi|254780151|r  128 DLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       128 ~l~~~a~~~g~~~iATGHY  146 (408)
                      .|+.+||..++.-+--||-
T Consensus       229 ~Lmr~AKt~~iaifiVGHV  247 (481)
T TIGR00416       229 ELMRLAKTRGIAIFIVGHV  247 (481)
T ss_pred             HHHHHHHHCCCCEEEEEEE
T ss_conf             9987652168657997004


No 256
>PRK12468 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=39.45  E-value=28  Score=15.37  Aligned_cols=53  Identities=19%  Similarity=0.301  Sum_probs=31.4

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC-CC
Q ss_conf             87645225--3110254126787731688531578787318986302022100334256899789899997412543-55
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI-AD  213 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~-a~  213 (408)
                      .+|.|.|-  |||=.-.++......-..+.+|.|..                          -..||++|++.|+|+ .+
T Consensus       262 ~AdvVItNPTH~AVAL~Y~~~~~~aP~VvAKG~d~~--------------------------A~~Ir~~A~~~~VPiven  315 (383)
T PRK12468        262 KADVIVTNPTHYAVALQYNESKMSAPKVLAKGAGAV--------------------------ALRIRELGAEHRIPLLEA  315 (383)
T ss_pred             CCCEEEECCCHHHHEEEECCCCCCCCEEEEECCCHH--------------------------HHHHHHHHHHCCCCEECC
T ss_conf             898899785538742353788899998988368499--------------------------999999999869988637


Q ss_pred             HH
Q ss_conf             11
Q gi|254780151|r  214 KS  215 (408)
Q Consensus       214 K~  215 (408)
                      ++
T Consensus       316 ~p  317 (383)
T PRK12468        316 PP  317 (383)
T ss_pred             HH
T ss_conf             79


No 257
>TIGR02653 Lon_rel_chp conserved hypothetical protein; InterPro: IPR013473    This entry describes a protein family of unknown function, about 690 residues in length, in which some members show C-terminal sequence similarity to IPR008269 from INTERPRO, which is the Lon protease C-terminal proteolytic domain, from MEROPS family S16. However, the annotated catalytic sites of Escherichia coli Lon protease are not conserved in members of this family. Members have a motif GP[RK][GS]TGKS, similar to the ATP-binding P-loop motif GxxGxGK[ST]..
Probab=39.29  E-value=20  Score=16.43  Aligned_cols=21  Identities=33%  Similarity=0.654  Sum_probs=17.6

Q ss_pred             HCEEECCCCCCCHHHHHHHHH
Q ss_conf             100334256899789899997
Q gi|254780151|r  185 LCDLRFPLGDMKKESVRDLAR  205 (408)
Q Consensus       185 L~~~~FPlg~~~K~eVR~~A~  205 (408)
                      |-|||+|=|++||+|+|+...
T Consensus       420 L~KLlyP~~~~tk~~~~~~l~  440 (677)
T TIGR02653       420 LLKLLYPDGEYTKDDVREILD  440 (677)
T ss_pred             EEEEECCCCCCCHHHHHHHHH
T ss_conf             000126885568799999988


No 258
>pfam05766 NinG Bacteriophage Lambda NinG protein. NinG or Rap is involved in recombination. Rap (recombination adept with plasmid) increases lambda-by-plasmid recombination catalysed by Escherichia coli's RecBCD pathway.
Probab=39.27  E-value=13  Score=17.65  Aligned_cols=23  Identities=26%  Similarity=0.639  Sum_probs=17.8

Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCE
Q ss_conf             32244112678708861200001541
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRT  123 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~  123 (408)
                      ..+|.-||...-.|.   |||.|.+.
T Consensus        73 Q~afN~yIR~RD~~~---pCISCG~~   95 (188)
T pfam05766        73 QAAVNKYIRLRDAGL---PCISCGTK   95 (188)
T ss_pred             HHHHHHHHHHHHCCC---CCEECCCC
T ss_conf             999999999972799---84117896


No 259
>PRK13237 tyrosine phenol-lyase; Provisional
Probab=38.74  E-value=29  Score=15.29  Aligned_cols=81  Identities=20%  Similarity=0.293  Sum_probs=51.9

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCC
Q ss_conf             99609857999999998869849999987047876655557788189999999999980995898170788663224411
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPF  104 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~  104 (408)
                      .-+.|-+|=...-.++++.|-+=+++.+-.-..+...   |.--|.+.++.++++|++.|||+. +| .-+|+++  .+|
T Consensus       155 ~pFKGN~Dl~kLe~~i~~~g~~~I~~v~~tiTnN~~G---GQPVSm~Nir~v~~la~~~gipl~-lD-aaRfaEN--AyF  227 (459)
T PRK13237        155 HPFKGNVDLDKLQKLIDEVGAENIAYICLAVTVNLAG---GQPVSMANMRAVRELCDKHGIKVF-FD-ATRCVEN--AYF  227 (459)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEEECCCC---CCCCCHHHHHHHHHHHHHCCCCEE-EE-HHHHHHH--HHH
T ss_conf             8968877999999999874855600899998526878---806468999999999998099699-87-6678876--899


Q ss_pred             HHHHHCCC
Q ss_conf             26787088
Q gi|254780151|r  105 ASSYAAGE  112 (408)
Q Consensus       105 ~~~y~~G~  112 (408)
                      +.....|.
T Consensus       228 Ik~RE~gy  235 (459)
T PRK13237        228 IKEREEGY  235 (459)
T ss_pred             HHHCCCCC
T ss_conf             98344201


No 260
>PRK08229 2-dehydropantoate 2-reductase; Provisional
Probab=38.71  E-value=29  Score=15.29  Aligned_cols=30  Identities=23%  Similarity=0.272  Sum_probs=25.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899996098579999999988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+|-=.|+|-|.+++ .|.++|++|.-+.
T Consensus         3 mkI~IiGaGAvG~~~a~-~L~~aG~~V~lv~   32 (341)
T PRK08229          3 ARICVLGAGSIGCYLGG-RLAAAGADVTLIG   32 (341)
T ss_pred             CEEEEECCCHHHHHHHH-HHHHCCCCEEEEE
T ss_conf             77999896799999999-9985899879995


No 261
>PRK08156 surface presentation of antigens protein SpaS; Validated
Probab=38.66  E-value=29  Score=15.28  Aligned_cols=53  Identities=17%  Similarity=0.214  Sum_probs=30.9

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC-CC
Q ss_conf             87645225--3110254126787731688531578787318986302022100334256899789899997412543-55
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI-AD  213 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~-a~  213 (408)
                      .+|.|.|-  |||=.-.++......-..+.+|.|.-                          -..||++|++.|+|+ .+
T Consensus       250 ~AdVVItNPTH~AVALkY~~~~~~AP~VvAKG~d~~--------------------------A~~Ir~~A~e~~VPive~  303 (367)
T PRK08156        250 NSRLIVANPTHIAIGIYFNPDLAPIPFISVRETNQR--------------------------ALAVRAYAEKVGVPVVRD  303 (367)
T ss_pred             CCCEEEECCCHHHEEEEECCCCCCCCEEEEECCCHH--------------------------HHHHHHHHHHCCCCEECC
T ss_conf             999899885622046554688899998887468599--------------------------999999999869988627


Q ss_pred             HH
Q ss_conf             11
Q gi|254780151|r  214 KS  215 (408)
Q Consensus       214 K~  215 (408)
                      ++
T Consensus       304 ~p  305 (367)
T PRK08156        304 IK  305 (367)
T ss_pred             HH
T ss_conf             69


No 262
>smart00829 PKS_ER Enoylreductase. Enoylreductase in Polyketide synthases.
Probab=38.56  E-value=29  Score=15.27  Aligned_cols=61  Identities=18%  Similarity=0.381  Sum_probs=37.8

Q ss_pred             CCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC-EEECCHHH-H
Q ss_conf             3388999-9609857999999998869849999987047876655557788189999999999980995-89817078-8
Q gi|254780151|r   19 KDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS-HYVFDYEE-R   95 (408)
Q Consensus        19 k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~-~~~~d~~~-~   95 (408)
                      ++++|+| +=||||-++ |.-+++..|.+|++..                ++++.    ...++.+|++ -+++|.++ +
T Consensus       104 ~g~~VlI~gg~G~vG~~-aiqlak~~Ga~Vi~t~----------------~s~~k----~~~~~~lG~~~~~v~~~~~~~  162 (288)
T smart00829      104 PGESVLIHAAAGGVGQA-AIQLAQHLGAEVFATA----------------GSPEK----RDFLRELGIPDDHIFSSRDLS  162 (288)
T ss_pred             CCCEEEEECCCCHHHHH-HHHHHHHCCCCEEEEE----------------CCHHH----HHHHHHCCCCCCEEEECCCCC
T ss_conf             99999997898677799-9999997398300340----------------88899----999997699960762179950


Q ss_pred             HHHHC
Q ss_conf             66322
Q gi|254780151|r   96 FRNAV  100 (408)
Q Consensus        96 f~~~V  100 (408)
                      |.+.|
T Consensus       163 ~~~~v  167 (288)
T smart00829      163 FADEI  167 (288)
T ss_pred             HHHHH
T ss_conf             99999


No 263
>PRK10985 putative hydrolase; Provisional
Probab=38.02  E-value=29  Score=15.21  Aligned_cols=33  Identities=9%  Similarity=0.184  Sum_probs=24.4

Q ss_pred             EEECCCHHHHHHHH---HHHHCCCEEEEEEEECCCC
Q ss_conf             99609857999999---9988698499999870478
Q gi|254780151|r   25 VAMSGGVDSSVVAA---LLKRDGYDVIGVTLQLYNS   57 (408)
Q Consensus        25 va~SGGVDSsvaa~---lL~~~G~~V~g~~m~~~~~   57 (408)
                      -||.||-+|.....   .+.++||+|+.+.+|-...
T Consensus        65 HGL~G~s~s~Yi~~l~~~~~~~G~~~vv~n~RGc~g  100 (325)
T PRK10985         65 HGLEGSFNSPYAHGLLEAAQKRGWLGVVMHFRGCSG  100 (325)
T ss_pred             CCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             888899987799999999997899799980778999


No 264
>TIGR01632 L11_bact ribosomal protein L11; InterPro: IPR006519   Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites , . About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.    Many of ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome , .   Ribosomal protein L11 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L11 is known to bind directly to the 23S rRNA. It belongs to a family of ribosomal proteins which, on the basis of sequence similarities , groups bacterial, chloroplast, cyanelle, and most mitochondrial forms of ribosomal protein L11. L11 is a protein of 140 to 165 amino-acid residues. In E. coli, the C-terminal half of L11 has been shown  to be in an extended and loosely folded conformation and is likely to be buried within the ribosomal structure. This entry represents the bacterial, chloroplast and mitochondrial forms. ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome.
Probab=37.82  E-value=17  Score=17.00  Aligned_cols=15  Identities=27%  Similarity=0.651  Sum_probs=13.8

Q ss_pred             CCCCCHHHHHHHHHH
Q ss_conf             568997898999974
Q gi|254780151|r  192 LGDMKKESVRDLARE  206 (408)
Q Consensus       192 lg~~~K~eVR~~A~~  206 (408)
                      +|.+|+++||+||+-
T Consensus        98 VG~it~~q~~eIA~~  112 (144)
T TIGR01632        98 VGKITRKQVREIAEI  112 (144)
T ss_pred             EEEECHHHHHHHHHH
T ss_conf             720127888999986


No 265
>PRK05647 purN phosphoribosylglycinamide formyltransferase; Reviewed
Probab=37.64  E-value=30  Score=15.17  Aligned_cols=54  Identities=22%  Similarity=0.281  Sum_probs=34.0

Q ss_pred             CEEEEEECCCHHHHHHHHHHHH-CC---CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             8899996098579999999988-69---849999987047876655557788189999999999980995898170
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKR-DG---YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~-~G---~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      +||+|-.||+ .|.+.|.+-.- .|   .+|..+.-   +..              -..+-+.|+..|||..+++.
T Consensus         2 kkiavl~SG~-GSNl~aii~a~~~~~l~~~i~~Vis---n~~--------------~a~~l~~A~~~~Ip~~~i~~   59 (200)
T PRK05647          2 KRIVVLASGN-GSNLQAIIDACAAGQLPAEVVAVIS---DRP--------------DAYGLERAEQAGIPTFVLDH   59 (200)
T ss_pred             CEEEEEECCC-CHHHHHHHHHHHCCCCCCEEEEEEE---CCC--------------CCHHHHHHHHCCCCEEEECC
T ss_conf             7899999158-0449999999875999948999997---897--------------53665999975997699677


No 266
>COG4548 NorD Nitric oxide reductase activation protein [Inorganic ion transport and metabolism]
Probab=37.43  E-value=30  Score=15.15  Aligned_cols=18  Identities=22%  Similarity=0.192  Sum_probs=9.3

Q ss_pred             CEECCCCEEEHHHHHHHH
Q ss_conf             000015411058888874
Q gi|254780151|r  116 PCVDCNRTVKFSDLLSVT  133 (408)
Q Consensus       116 Pc~~CN~~iKF~~l~~~a  133 (408)
                      |...-|+.++|-.+...|
T Consensus       104 p~~~lnr~ly~wl~~~~a  121 (637)
T COG4548         104 PLRRLNRDLYFWLFAQQA  121 (637)
T ss_pred             HHHHHHHHHHHHHHHHHH
T ss_conf             176530477899999998


No 267
>PRK13210 putative L-xylulose 5-phosphate 3-epimerase; Reviewed
Probab=37.38  E-value=30  Score=15.15  Aligned_cols=93  Identities=11%  Similarity=0.132  Sum_probs=54.9

Q ss_pred             HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             99999886984999998704787665555778818999999999998099589817078866322441126787088612
Q gi|254780151|r   36 VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        36 aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                      ...+.++.|||-+=+.+   |..+.... ..-.+.+.++..++.++..||+...+-++ .+|..   ||-       .+|
T Consensus        21 ~f~~Ak~~Gfd~IE~si---De~d~~~~-~l~~~~~~~~~i~~~~~~~gl~I~s~~~s-~~~~~---pl~-------s~d   85 (284)
T PRK13210         21 RLVLAKECGFDFVEMSV---DETDERLA-RLDWSKEERLELVKAIYETGVRIPSMCLS-AHRRF---PFG-------SRD   85 (284)
T ss_pred             HHHHHHHCCCCEEEEEC---CCCCCCCC-CCCCCHHHHHHHHHHHHHCCCEEEEEECC-CCCCC---CCC-------CCC
T ss_conf             99999986998899960---67542225-78999899999999999829835664155-66689---999-------989


Q ss_pred             CEECCCCEEEHHHHHHHHCCCCCCEECC
Q ss_conf             0000154110588888740168764522
Q gi|254780151|r  116 PCVDCNRTVKFSDLLSVTRQLGADVLAT  143 (408)
Q Consensus       116 Pc~~CN~~iKF~~l~~~a~~~g~~~iAT  143 (408)
                      |.++=...=-....++.|.++|+..|..
T Consensus        86 ~~~r~~~le~l~kaI~lA~~LGi~~I~l  113 (284)
T PRK13210         86 EATRERALEIMKKAIRLAQDLGIRTIQL  113 (284)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             8999999999999999999809978996


No 268
>PRK13109 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=37.37  E-value=30  Score=15.15  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=5.9

Q ss_pred             HHHHHHHHHCCCC
Q ss_conf             8989999741254
Q gi|254780151|r  198 ESVRDLAREMGLD  210 (408)
Q Consensus       198 ~eVR~~A~~~gl~  210 (408)
                      ..+|++|++.|+|
T Consensus       301 ~~Ir~~A~~~~VP  313 (358)
T PRK13109        301 LKIREIAERNGIP  313 (358)
T ss_pred             HHHHHHHHHCCCC
T ss_conf             9999999987997


No 269
>PRK08776 cystathionine gamma-synthase; Provisional
Probab=37.27  E-value=30  Score=15.13  Aligned_cols=95  Identities=15%  Similarity=0.114  Sum_probs=58.0

Q ss_pred             EEEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999-9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-.+++|.|.--..++.+ |.+.|-+|+.-- ..+              .-...-.+.+....||....+|+.+.     
T Consensus        76 ~~a~~~sSGmaAi~~~l~~ll~~GDhiv~~~-~~Y--------------GgT~~l~~~~~~~~gi~~~~vd~~d~-----  135 (405)
T PRK08776         76 AGGVITSTGMGAINLVLNALLQPGDTLVVPH-DAY--------------GGSWRLFNALAKKGHFALITADLTDP-----  135 (405)
T ss_pred             CCEEEECCHHHHHHHHHHHHHCCCCEEEECC-CCC--------------HHHHHHHHHHHHHCCEEEEEECCCCH-----
T ss_conf             9689946799999999999738999899868-861--------------17999999987548889999689998-----


Q ss_pred             CCCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEE
Q ss_conf             44112678708861200001-----54110---5888887401687645
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVL  141 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~i  141 (408)
                           +++++..+||+.+..     |+.++   ..++.+.|++.|+-.+
T Consensus       136 -----~~~~~~i~~~Tklv~~EtpsNP~l~v~Di~~ia~iA~~~g~~~v  179 (405)
T PRK08776        136 -----RSLADALAQSPKLVLIETPSNPLLRITDLRFVIEAAHKVGALTV  179 (405)
T ss_pred             -----HHHHHHCCCCCEEEEEECCCCCCCEEECCHHHHHHHHHCCCEEE
T ss_conf             -----99997437776599998899998860275999999987399799


No 270
>pfam02037 SAP SAP domain. The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA/RNA binding domain found in diverse nuclear and cytoplasmic proteins.
Probab=37.24  E-value=28  Score=15.40  Aligned_cols=24  Identities=13%  Similarity=0.296  Sum_probs=19.7

Q ss_pred             CCCCHHHHHHHHHHCCCCCCCHHH
Q ss_conf             689978989999741254355111
Q gi|254780151|r  193 GDMKKESVRDLAREMGLDIADKSD  216 (408)
Q Consensus       193 g~~~K~eVR~~A~~~gl~~a~K~e  216 (408)
                      ..|+-+|.|+++++.||++..+|.
T Consensus         2 ~~ltv~eLk~~l~~~gL~~~G~K~   25 (35)
T pfam02037         2 SKLTVAELKEELKKRGLPTSGKKA   25 (35)
T ss_pred             CCCCHHHHHHHHHHCCCCCCCCHH
T ss_conf             726099999999986989888899


No 271
>cd03087 PGM_like1 This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=36.89  E-value=30  Score=15.09  Aligned_cols=31  Identities=26%  Similarity=0.273  Sum_probs=17.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHH----HHHCCCEEEE
Q ss_conf             338899996098579999999----9886984999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAAL----LKRDGYDVIG   49 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~l----L~~~G~~V~g   49 (408)
                      ++.+|+||...=--|-..+..    |...|.+|.=
T Consensus        32 ~~~~vvIg~D~R~~s~~~~~~~~~gl~~~G~~V~~   66 (439)
T cd03087          32 GGGTVVVGRDTRTSGPMLKNAVIAGLLSAGCDVID   66 (439)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHCCCEEEE
T ss_conf             89859999589845899999999999977996999


No 272
>PRK13435 response regulator; Provisional
Probab=36.82  E-value=31  Score=15.09  Aligned_cols=54  Identities=17%  Similarity=0.231  Sum_probs=33.7

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             3889999609857999999998869849999987047876655557788189999999999980995898170
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      +|||+|.=.--.=......+|.+.||+|+|..-                   +.+.|...++.....+-..|+
T Consensus         1 ~mRILIVEDe~~i~~~l~~~L~~~G~~vv~~A~-------------------~~~eAl~~~~~~~PDlvllDi   54 (141)
T PRK13435          1 QLRVLIVEDEALIALELEKLLEEAGHQVVGIAS-------------------TSEQALALGRRAQPDVALVDI   54 (141)
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEEC-------------------CHHHHHHHHHCCCCCEEEECC
T ss_conf             978999899899999999999987997999759-------------------999999997659998999788


No 273
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional
Probab=36.81  E-value=31  Score=15.09  Aligned_cols=33  Identities=30%  Similarity=0.291  Sum_probs=25.4

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             8633889999609857999999998869849999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      ++..+||+| +-||.-...||+-|.++||+|+=+
T Consensus       134 ~~tgkkVAV-IGaGPAGLsaA~~La~~G~~VtVf  166 (560)
T PRK12771        134 PDTGKRVAV-IGGGPAGLSAAYQLRRLGHAVTIF  166 (560)
T ss_pred             CCCCCEEEE-ECCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             778998999-897789999999999769858996


No 274
>PRK13828 rimM 16S rRNA-processing protein; Provisional
Probab=36.71  E-value=31  Score=15.07  Aligned_cols=54  Identities=24%  Similarity=0.420  Sum_probs=35.2

Q ss_pred             CEECCCCCEEEEECCCEEEEEC---------CCCCCCCCCCCCCEEEECCCCCCEEEEECCCCC
Q ss_conf             1103774322335783153102---------334335657786137631755312565235554
Q gi|254780151|r  244 DIVHLNGQILGRHNGIINYTIG---------QRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESL  298 (408)
Q Consensus       244 ~ivd~~G~viG~H~G~~~yTIG---------QRkGL~i~~~eP~YVv~id~~~N~ViVg~~~~L  298 (408)
                      .++|.+|+.+|+-..+..++-+         .++-+-||.- +-||.++|.+++.|+|-+=+.|
T Consensus       105 ~V~d~~g~~lG~V~~v~~~ga~dvl~V~~~~~~~~iLIP~v-~~~V~~VD~~~k~I~vd~PeGL  167 (177)
T PRK13828        105 AVVDTGGELLGRVKAVHNFGAGDILEITAPGGGPTLLLPFT-RAVVPTVDLAGGRVVADPPAEI  167 (177)
T ss_pred             EEEECCCCEEEEEEEEECCCCCEEEEEEECCCCCEEEEECC-CCCCCEEECCCCEEEEECCCCC
T ss_conf             99928998989999984289952999998899958998358-3101779778999999898854


No 275
>PRK06242 flavodoxin; Provisional
Probab=36.13  E-value=31  Score=15.01  Aligned_cols=18  Identities=11%  Similarity=0.012  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHCCCCEEEC
Q ss_conf             999999999809958981
Q gi|254780151|r   73 VYDARRVCDTINVSHYVF   90 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~   90 (408)
                      ..-|+.+|+.|+.++..+
T Consensus        16 ~KvA~aiae~l~~~~~~~   33 (150)
T PRK06242         16 EKIAKAMAEVLNADVIKP   33 (150)
T ss_pred             HHHHHHHHHHCCCCEEEE
T ss_conf             999999997659739974


No 276
>TIGR00655 PurU formyltetrahydrofolate deformylase; InterPro: IPR004810    An Escherichia coli gene designated purU has been identified and characterised. The gene codes for a 280-amino-acid protein, PurU (P37051 from SWISSPROT, 3.5.1.10 from EC). PurU is an enzyme that catalyses the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to FH4 and formate ,.  10-formyltetrahydrofolate + H(2)O = formate +tetrahydrofolate     Formyl-FH4 hydrolase generates the formate that is used by purT-encoded 5'-phosphoribosylglycinamide transformylase for step three of de novo purine nucleotide synthesis. Formyl-FH4 hydrolase, a hexamer of 32kDa subunits, is activated by methionine and inhibited by glycine. Heterotropic cooperativity is observed for activation by methionine in the presence of glycine and for inhibition by glycine in the presence of methionine. These results suggest that formyl-FH4 hydrolase is a regulatory enzyme whose main function is to balance the pools of FH4 and C1-FH4 in response to changing growth conditions. The enzyme uses methionine and glycine to sense the pools of C1-FH4 and FH4, respectively. ; GO: 0008864 formyltetrahydrofolate deformylase activity, 0006189 'de novo' IMP biosynthetic process.
Probab=36.13  E-value=23  Score=15.96  Aligned_cols=108  Identities=16%  Similarity=0.208  Sum_probs=53.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CC---EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             88999960985799999999886-98---499999870478766555577881899999999999809958981707886
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD-GY---DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~-G~---~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      +||++-.|=--=+..= .|++-. |-   +|.+|   ..++                +++|..++.+||||+.+...++-
T Consensus        93 krvai~vsKe~HCL~D-LL~r~~~GeL~~ei~~V---IsNH----------------~~lr~lve~F~iPF~~~p~~~~~  152 (294)
T TIGR00655        93 KRVAILVSKEDHCLGD-LLWRWYSGELDAEIALV---ISNH----------------EDLRELVERFGIPFHYIPATKDT  152 (294)
T ss_pred             CEEEEEEECCHHHHHH-HHHHHCCCCCEEEEEEE---ECCC----------------HHHHHHHHHCCCCEEEECCCCCH
T ss_conf             7689984041203589-99987389823799998---6498----------------78998866538988986378850


Q ss_pred             HHH------------------CCCC-CHHHHHCCCCC-------CCEECCCCEEEHHHH-----HHHHCCCCCCEE-CCC
Q ss_conf             632------------------2441-12678708861-------200001541105888-----887401687645-225
Q gi|254780151|r   97 RNA------------------VIVP-FASSYAAGETP-------LPCVDCNRTVKFSDL-----LSVTRQLGADVL-ATG  144 (408)
Q Consensus        97 ~~~------------------V~~~-~~~~y~~G~TP-------NPc~~CN~~iKF~~l-----~~~a~~~g~~~i-ATG  144 (408)
                      +..                  =+|. .+.-|++=+||       |+=+-=...- .+||     +..|.+.|-.-| ||-
T Consensus       153 r~e~Ek~~Lell~~yelkh~~~~DlvVLAkYMqIL~p~Fv~~~pN~iINIHHSF-LPAFiGA~PY~rA~eRGVKiIGATA  231 (294)
T TIGR00655       153 RLEHEKKELELLKQYELKHKYQVDLVVLAKYMQILSPDFVKRYPNKIINIHHSF-LPAFIGANPYQRAYERGVKIIGATA  231 (294)
T ss_pred             HHHHHHHHHHHHHCCCCCEECCCCEEEEEHHCCCCCHHHHHHCCCCEEECCCCC-CCCCCCCCCHHHHHCCCCEEEECCE
T ss_conf             568999999987403321102754698210102178357744579312112352-4554467623788708833770200


Q ss_pred             CCCCE
Q ss_conf             31102
Q gi|254780151|r  145 HYIRS  149 (408)
Q Consensus       145 HYar~  149 (408)
                      ||+.-
T Consensus       232 HYVt~  236 (294)
T TIGR00655       232 HYVTE  236 (294)
T ss_pred             EEECC
T ss_conf             10033


No 277
>PRK13789 phosphoribosylamine--glycine ligase; Provisional
Probab=35.96  E-value=31  Score=14.99  Aligned_cols=85  Identities=15%  Similarity=0.069  Sum_probs=53.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCC--CCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             3388999960985799999999886984999998704787665555--77881899999999999809958981707886
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK--GSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~--~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .+|||+|-=|||=.-++|-.|.+..  .|.-++.--.+..-.....  ..+....|.+...+.|+.-+|.+-++-=+.--
T Consensus         3 ~~MkVLviGsGGREHAia~kl~~S~--~v~~v~~aPGN~G~~~~~~~~~~~i~~~d~~~i~~fa~~~~idLvvvGPE~PL   80 (426)
T PRK13789          3 VKLKVLLIGSGGRESAIAFALRKSN--LLSELKVFPGNGGFPDDELLPADSFSILDKSSVQSFLKSNPFDLIVVGPEDPL   80 (426)
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCC--CCCEEEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCEEEECCCHHH
T ss_conf             7988999898889999999996198--98879998897611234545444338669999999999849999998966888


Q ss_pred             HHHCCCCCH
Q ss_conf             632244112
Q gi|254780151|r   97 RNAVIVPFA  105 (408)
Q Consensus        97 ~~~V~~~~~  105 (408)
                      -.-++|.|-
T Consensus        81 ~~Gi~D~l~   89 (426)
T PRK13789         81 VAGFADWAA   89 (426)
T ss_pred             HHHHHHHHH
T ss_conf             631799984


No 278
>smart00450 RHOD Rhodanese Homology Domain. An alpha beta fold found duplicated in the Rhodanese protein. The the Cysteine containing enzymatically active version of the domain is also found in the CDC25 class of protein phosphatases and a variety of proteins such as sulfide dehydrogenases and stress proteins such as Senesence specific protein 1 in plants, PspE and GlpE in bacteria and cyanide and arsenate resistance proteins. Inactive versions with a loss of the cysteine are also seen in Dual specificity phosphatases, ubiquitin hydrolases from yeast and in sulfuryltransferases. These are likely to play a role in protein interactions.
Probab=35.84  E-value=32  Score=14.98  Aligned_cols=28  Identities=39%  Similarity=0.439  Sum_probs=19.6

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             3388999960985799999999886984
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      ++.+|++-=.+|.+|+.++..|.+.|++
T Consensus        55 ~~~~vi~yc~~g~~s~~~~~~l~~~G~~   82 (100)
T smart00450       55 KDKPVVVYCRSGNRSAKAAWLLRELGFK   82 (100)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHCCCC
T ss_conf             9984999879998069999999980898


No 279
>PRK13209 L-xylulose 5-phosphate 3-epimerase; Reviewed
Probab=35.71  E-value=32  Score=14.97  Aligned_cols=94  Identities=11%  Similarity=0.115  Sum_probs=58.0

Q ss_pred             HHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCC
Q ss_conf             99999998869849999987047876655557788189999999999980995898170788663224411267870886
Q gi|254780151|r   34 SVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGET  113 (408)
Q Consensus        34 svaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~T  113 (408)
                      -=...+.++.|||-+=+.+.-++..   . ...-++++.+...++.++.-||+...+-++ -+|+-   ||-       .
T Consensus        24 ~e~~~~ak~~Gfd~iElsiDe~d~~---~-~rL~w~~~~~~~ir~~~~~~gi~i~s~cls-~~~~~---Pl~-------S   88 (283)
T PRK13209         24 LEKLRIAKTAGFDFVEMSVDETDER---L-ARLDWSREQRLALVNALVETGFRVNSMCLS-AHRRF---PLG-------S   88 (283)
T ss_pred             HHHHHHHHHCCCCEEEEECCCCCCC---C-CCCCCCHHHHHHHHHHHHHCCCCCEEEECC-CCCCC---CCC-------C
T ss_conf             9999999985998799842685310---0-358999999999999999819986033054-55579---999-------9


Q ss_pred             CCCEECCCCEEEHHHHHHHHCCCCCCEEC
Q ss_conf             12000015411058888874016876452
Q gi|254780151|r  114 PLPCVDCNRTVKFSDLLSVTRQLGADVLA  142 (408)
Q Consensus       114 PNPc~~CN~~iKF~~l~~~a~~~g~~~iA  142 (408)
                      ++|-++=...-.+...++.|.++|+..|-
T Consensus        89 ~D~~~R~~~~e~~~kaI~lA~~LGi~~I~  117 (283)
T PRK13209         89 EDDAVRAQGLEIMRKAIQLAQDLGIRVIQ  117 (283)
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             79999999999999999999980999899


No 280
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=35.66  E-value=32  Score=14.96  Aligned_cols=99  Identities=15%  Similarity=0.249  Sum_probs=57.8

Q ss_pred             EECCCCCCEEEEECCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCCCCEEEEE------------------
Q ss_conf             63175531256523555422211200223037765554456871899998017887008999------------------
Q gi|254780151|r  281 VYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ------------------  342 (408)
Q Consensus       281 v~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pvp~~i~------------------  342 (408)
                      -++|+....|++.+.+.+....-.-..+-|+++.+.    ..+.++..|+..+  .++|+|.                  
T Consensus       293 dEIDISRGDvI~~~~~~p~~s~~f~A~lvWm~e~pL----~~gr~YllK~~t~--~v~a~I~~I~~~iDinTl~~~~a~~  366 (613)
T PRK05506        293 DEIDISRGDMLARADNPPEVADQFDATLVWMAEEPL----LPGRPYLLKHGTR--TVPASVAAIKHRVDVNTLERLAAKR  366 (613)
T ss_pred             CCEECCCCCEEECCCCCCCCCCEEEEEEEEECCCCC----CCCCEEEEEECCE--EEEEEEEEEEEEECCCCCCCCCCCC
T ss_conf             626437986896489988701087899999449876----7998899998777--9999996216897267513244353


Q ss_pred             --EECC-EEEEEECCCCC------CCCCCEEEEEECCCCCCCEEEEEEEECCCCC
Q ss_conf             --8299-79999759720------0069638999738886658887689714555
Q gi|254780151|r  343 --RNDD-GVYVDFEKSEV------GVASGQACVFYTSDSNEARVLGGGIISGSKR  388 (408)
Q Consensus       343 --~~~~-~~~V~f~eP~~------aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~  388 (408)
                        .++= .+++.+++|.-      --+-|.+..+ |.  ..+.-+|+|+|..+-+
T Consensus       367 L~lNdIg~V~l~l~~pI~~D~Y~~n~~tGsFILI-D~--~tn~TVaAGmI~~alr  418 (613)
T PRK05506        367 LELNEIGRCNLSLDAPIAFDPYARNRTTGSFILI-DR--LTNATVGAGMIDFALR  418 (613)
T ss_pred             CCCCCCEEEEEEECCCCCCCCHHHCCCCCCEEEE-EC--CCCCEEEEEEECHHHC
T ss_conf             3787418999995897346836568666658999-88--9995788983705542


No 281
>cd00293 USP_Like Usp: Universal stress protein family. The universal stress protein Usp is a small cytoplasmic bacterial protein whose expression is enhanced when the cell is exposed to stress agents. Usp enhances the rate of cell survival during prolonged exposure to such conditions, and may provide a general "stress endurance" activity. The crystal structure of Haemophilus influenzae Usp reveals an alpha/beta fold similar to that of the Methanococcus jannaschii MJ0577 protein, which binds ATP, athough Usp lacks ATP-binding activity.
Probab=35.42  E-value=32  Score=14.94  Aligned_cols=98  Identities=21%  Similarity=0.229  Sum_probs=51.9

Q ss_pred             EEEEEECCCHHHHHHH----HHHHHCCCEEEEEEEECCCCCCCCCC--CCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             8999960985799999----99988698499999870478766555--57788189999999999980995898170788
Q gi|254780151|r   22 RVVVAMSGGVDSSVVA----ALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        22 kV~va~SGGVDSsvaa----~lL~~~G~~V~g~~m~~~~~~~~~~~--~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ||+|++++.-.|..++    .++++.|.+++-+|..--........  ...-...+-++..+..++..|++....-.   
T Consensus         1 ~Ilv~vd~s~~s~~al~~a~~la~~~~~~l~~v~v~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~---   77 (130)
T cd00293           1 RILVAVDGSEESERALRWAARLARRLGAELVLLHVVDPPPSSAAELAELLEEEARALLEALREALAEAGVKVETVVL---   77 (130)
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEE---
T ss_conf             99999898989999999999999872997999999728865530144678999999999999985427983899999---


Q ss_pred             HHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             66322441126787088612000015411058888874016876452253110
Q gi|254780151|r   96 FRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        96 f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                                    .|.   |         ...+++.+++.++|.|.-|...+
T Consensus        78 --------------~~~---~---------~~~i~~~a~~~~~dliV~G~~~~  104 (130)
T cd00293          78 --------------EGD---P---------AEAILEAAEELGADLIVMGSRGR  104 (130)
T ss_pred             --------------ECC---H---------HHHHHHHHHHCCCCEEEEECCCC
T ss_conf             --------------466---1---------89998877761188999947999


No 282
>cd01968 Nitrogenase_NifE_I Nitrogenase_NifE_I: a subgroup of the NifE subunit of the NifEN complex: NifE forms an alpha2beta2 tetramer with NifN.  NifE and NifN are structurally homologous to nitrogenase MoFe protein alpha and beta subunits respectively.  NifEN participates in the synthesis of the iron-molybdenum cofactor (FeMoco) of the MoFe protein.  NifB-co (an iron and sulfur containing precursor of the FeMoco) from NifB is transferred to the NifEN complex where it is further processed to FeMoco. The NifEN bound precursor of FeMoco has been identified as a molybdenum-free, iron- and sulfur- containing analog of FeMoco. It has been suggested that this NifEN bound precursor also acts as a cofactor precursor in nitrogenase systems which require a cofactor other than FeMoco: i.e. iron-vanadium cofactor (FeVco) or iron only cofactor (FeFeco).
Probab=35.28  E-value=32  Score=14.92  Aligned_cols=53  Identities=15%  Similarity=0.253  Sum_probs=29.9

Q ss_pred             EECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCH---HHHHHH-HHHHHHCCCCEEECC
Q ss_conf             96098579999999--9886984999998704787665555778818---999999-999998099589817
Q gi|254780151|r   26 AMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAG---QDVYDA-RRVCDTINVSHYVFD   91 (408)
Q Consensus        26 a~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~---~d~~~a-~~va~~LgI~~~~~d   91 (408)
                      ..-||-+-.-.+..  .++---+++++.             .+|.++   +|+.-. ++.-+..++|...++
T Consensus        66 ~VfGG~~~L~~~I~~~~~~~~P~~I~v~-------------tTC~~e~IGDDi~~v~~~~~~~~~~pvv~v~  124 (410)
T cd01968          66 VIFGGEKKLYKAILEIIERYHPKAVFVY-------------STCVVALIGDDIDAVCKTASEKFGIPVIPVH  124 (410)
T ss_pred             EEECCHHHHHHHHHHHHHHCCCCEEEEE-------------CCCHHHHHCCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             5657399999999999985499889997-------------5670887356399999998886199779832


No 283
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase; InterPro: IPR005252   This entry represents a bifunctional enzyme that catalyzes the second and third steps (cysteine ligation, (6.3.2.5 from EC), and decarboxylation, (4.1.1.36 from EC)) in the biosynthesis of coenzyme A (CoA) from pantothenate in bacteria. The amino-terminal region is responsible for the phosphopantothenoylcysteine decarboxylase activity .   In early descriptions of this flavoprotein, a ts mutation in one region of the protein appeared to cause a defect in DNA metaobolism rather than an increased need for the pantothenate precursor beta-alanine. This protein was then called dfp, for DNA/pantothenate metabolism flavoprotein [.   It has been suggested that this bifunctional protein should be renamed coaBC ..
Probab=35.11  E-value=32  Score=14.90  Aligned_cols=34  Identities=18%  Similarity=0.429  Sum_probs=27.5

Q ss_pred             CCCEEEEEECCCHHHHHHHHH---HHHCCCEEEEEEE
Q ss_conf             338899996098579999999---9886984999998
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAAL---LKRDGYDVIGVTL   52 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~l---L~~~G~~V~g~~m   52 (408)
                      ++++|+++++||+-+--+..|   |.++|.+|..+.-
T Consensus         2 ~~k~~~~~~~g~ia~~~~~~l~~~l~~~ga~v~~~~~   38 (418)
T TIGR00521         2 ENKKILLGVTGGIAAYKTVELVRELVKAGAEVKVIMT   38 (418)
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHHHHCCCCEEEEEC
T ss_conf             9865899843641456789999999856971699863


No 284
>LOAD_USPA consensus
Probab=35.08  E-value=32  Score=14.90  Aligned_cols=97  Identities=19%  Similarity=0.216  Sum_probs=51.0

Q ss_pred             CEEEEEECCCHHHHHH----HHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHH-------HHHHHCCCCEEE
Q ss_conf             8899996098579999----99998869849999987047876655557788189999999-------999980995898
Q gi|254780151|r   21 MRVVVAMSGGVDSSVV----AALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR-------RVCDTINVSHYV   89 (408)
Q Consensus        21 ~kV~va~SGGVDSsva----a~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~-------~va~~LgI~~~~   89 (408)
                      +||+|+..|.-.|..+    +.+.+..+-+++-+|+.--......  ...-..+....+++       +.++..+++.. 
T Consensus         1 k~Ilv~vd~s~~s~~a~~~A~~la~~~~a~l~~lhV~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-   77 (135)
T LOAD_USPA         1 KKILVAIDGSPESEKALRWAVDLAKRRGAELILLHVIPPSVSTAA--SPALDLALLLEEALKLLEEALELLEEAGVKID-   77 (135)
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCC--CCCCHHHHHHHHHHHHHHHHHHHHHHCCCCEE-
T ss_conf             989999869989999999999999874998999999627764444--44201468999999999999999986399739-


Q ss_pred             CCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             17078866322441126787088612000015411058888874016876452253110
Q gi|254780151|r   90 FDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        90 ~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                                                  +.--.----..+.+++++.++|.|.-|++-+
T Consensus        78 ----------------------------~~i~~g~~~~~I~~~~~~~~~dliVmG~~~~  108 (135)
T LOAD_USPA        78 ----------------------------VEVEEGSPAEAILELAEESNADLIVVGSRGR  108 (135)
T ss_pred             ----------------------------EEEEEECCHHHHHHHHHHCCCCEEEEECCCC
T ss_conf             ----------------------------9999964289999998605776799946899


No 285
>KOG1198 consensus
Probab=34.75  E-value=33  Score=14.86  Aligned_cols=58  Identities=22%  Similarity=0.365  Sum_probs=29.2

Q ss_pred             CCCEEE-EEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC----CCEEECCH
Q ss_conf             338899-99609857999999998869-8499999870478766555577881899999999999809----95898170
Q gi|254780151|r   19 KDMRVV-VAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN----VSHYVFDY   92 (408)
Q Consensus        19 k~~kV~-va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg----I~~~~~d~   92 (408)
                      +.++|+ .|=||||-+ .|.-|++..| ..|++                 ||+++..    +.++.||    ++++..|.
T Consensus       157 ~g~~vLv~ggsggVG~-~aiQlAk~~~~~~v~t-----------------~~s~e~~----~l~k~lGAd~vvdy~~~~~  214 (347)
T KOG1198         157 KGKSVLVLGGSGGVGT-AAIQLAKHAGAIKVVT-----------------ACSKEKL----ELVKKLGADEVVDYKDENV  214 (347)
T ss_pred             CCCEEEEEECCCHHHH-HHHHHHHHCCCCEEEE-----------------EECCCCH----HHHHHCCCCCCCCCCCHHH
T ss_conf             9986999938748999-9999998749747999-----------------8155416----8999729965124885779


Q ss_pred             HHHHHH
Q ss_conf             788663
Q gi|254780151|r   93 EERFRN   98 (408)
Q Consensus        93 ~~~f~~   98 (408)
                      .++..+
T Consensus       215 ~e~~kk  220 (347)
T KOG1198         215 VELIKK  220 (347)
T ss_pred             HHHHHH
T ss_conf             999876


No 286
>pfam07498 Rho_N Rho termination factor, N-terminal domain. The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts. It it thought that two copies of Rho bind to RNA and that Rho functions as a hexamer of protomers. This domain is found to the N-terminus of the RNA binding domain (pfam07497).
Probab=33.62  E-value=20  Score=16.40  Aligned_cols=31  Identities=23%  Similarity=0.517  Sum_probs=20.3

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCHHHCCCEEE
Q ss_conf             5689978989999741254355111023011
Q gi|254780151|r  192 LGDMKKESVRDLAREMGLDIADKSDSQDICF  222 (408)
Q Consensus       192 lg~~~K~eVR~~A~~~gl~~a~K~eSqgICF  222 (408)
                      |-.++=+|.+++|+++|++.+.+---|++-|
T Consensus         2 L~~~~~~eL~~iA~elgI~~~s~~rKqeLIf   32 (43)
T pfam07498         2 LKEKTLAELREIAKELGIENYSRLRKQELIF   32 (43)
T ss_pred             CCCCCHHHHHHHHHHCCCCCCCCCCHHHHHH
T ss_conf             3318899999999994998700145999999


No 287
>COG0223 Fmt Methionyl-tRNA formyltransferase [Translation, ribosomal structure and biogenesis]
Probab=33.37  E-value=34  Score=14.71  Aligned_cols=65  Identities=20%  Similarity=0.290  Sum_probs=36.2

Q ss_pred             CEEEEEECCCHHHHHH-HHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE-CCHHH
Q ss_conf             8899996098579999-99998869849999987047876655557788189999999999980995898-17078
Q gi|254780151|r   21 MRVVVAMSGGVDSSVV-AALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV-FDYEE   94 (408)
Q Consensus        21 ~kV~va~SGGVDSsva-a~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~-~d~~~   94 (408)
                      |||+.+  |=-|.|+. +..|-+.||+|++|+-+-   +....+ +.+-.   ...++.+|.++|||++. .++++
T Consensus         2 mkivF~--GTp~fa~~~L~~L~~~~~eivaV~Tqp---dkp~gR-~~~l~---~spVk~~A~~~~ipv~qP~~l~~   68 (307)
T COG0223           2 MRIVFF--GTPEFAVPSLEALIEAGHEIVAVVTQP---DKPAGR-GKKLT---PSPVKRLALELGIPVFQPEKLND   68 (307)
T ss_pred             CEEEEE--CCCHHHHHHHHHHHHCCCCEEEEEECC---CCCCCC-CCCCC---CCHHHHHHHHCCCCEECCCCCCC
T ss_conf             179997--674454999999982898048999489---976678-78588---88389999974995566444786


No 288
>PRK07050 cystathionine beta-lyase; Provisional
Probab=32.99  E-value=35  Score=14.67  Aligned_cols=98  Identities=13%  Similarity=0.111  Sum_probs=58.4

Q ss_pred             EEEEEECCCHHHHHHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             899996098579999999-9886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-++++|.|.--..++.+ |.++|-+|+... ..              ..-...-.+.+.+++||....+|..+.     
T Consensus        81 ~~a~~~sSGmaAi~~~ll~ll~~Gd~vv~~~-~~--------------Yg~T~~~~~~~l~~~Gi~v~f~d~~d~-----  140 (394)
T PRK07050         81 RHALLQPSGLAAISNVYFGLVKAGDDVLIPD-NV--------------YGPNRDFGEWLAKDFGITVRFYDPMIG-----  140 (394)
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCCEEEECC-CC--------------CHHHHHHHHHHHHCCCEEEEEECCCCH-----
T ss_conf             7499965789999999999607998578356-66--------------333899999875318879999799998-----


Q ss_pred             CCCCHHHHHCCCCCCCEEC-----CCCEEE---HHHHHHHHCCCCCCEECCC
Q ss_conf             4411267870886120000-----154110---5888887401687645225
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVD-----CNRTVK---FSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~-----CN~~iK---F~~l~~~a~~~g~~~iATG  144 (408)
                           +++++-.+||.++.     +|+.++   ..++.+.|++.|+-.|.--
T Consensus       141 -----~~~~~~i~~~Tkli~~Esp~NP~l~v~Di~~ia~~A~~~g~~~vVDN  187 (394)
T PRK07050        141 -----AGIADLIQPNTRLIWLEAPGSVTMEVPDVPAITAAARARGVVTAIDN  187 (394)
T ss_pred             -----HHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEEEC
T ss_conf             -----99984368664499984489876254372999999987598699857


No 289
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB; InterPro: IPR014132   This entry describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria. Although ybaN null mutants have only a mild sporulation defect, ybaN/ytrI double mutants show drastically reduced sporulation efficiencies. This synthetic defect suggests the role of this sigmaE-controlled gene in sporulation had been masked by functional redundancy. Members of this family are homologous to a characterised polysaccharide deacetylase; the exact function this protein family is unknown..
Probab=32.98  E-value=33  Score=14.82  Aligned_cols=83  Identities=28%  Similarity=0.364  Sum_probs=48.6

Q ss_pred             EECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC-CCH--HHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCC------
Q ss_conf             302022100334256899789899997412543-551--11023011127751034553076643467110377------
Q gi|254780151|r  179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI-ADK--SDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN------  249 (408)
Q Consensus       179 ~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~-a~K--~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~------  249 (408)
                      -+..+.-.=+++|=|++.|.-+ ++|+++|+.+ -=-  -||.|  .=..| --.-+++-+. ..+||+||..-      
T Consensus        96 ~~~g~~p~LlRpP~G~fn~~~~-~~ae~~GY~~V~WsWHvdS~D--WkNPG-~e~iv~~V~~-~~~~GdIiL~HDASd~~  170 (198)
T TIGR02764        96 KLTGKKPTLLRPPNGAFNKAVL-KLAESLGYTVVHWSWHVDSLD--WKNPG-VESIVDRVVK-NTKPGDIILLHDASDSA  170 (198)
T ss_pred             HHCCCCEEEEECCCCCCCHHHH-HHHHHCCCCEEEEECCCCCCC--CCCCC-EEHHHHHHHC-CCCCCCEEEEEECCCCC
T ss_conf             5105550165688986046899-999973991898624558835--45786-1000111331-27998569876348797


Q ss_pred             ---CC----EEE--EECCCEEEEECC
Q ss_conf             ---43----223--357831531023
Q gi|254780151|r  250 ---GQ----ILG--RHNGIINYTIGQ  266 (408)
Q Consensus       250 ---G~----viG--~H~G~~~yTIGQ  266 (408)
                         ++    +|-  +-+|+.+-||++
T Consensus       171 KqT~~ALp~Ii~~LK~~GY~fv~ise  196 (198)
T TIGR02764       171 KQTVKALPEIIKKLKEKGYEFVTISE  196 (198)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEEHHC
T ss_conf             44177899998998754953434220


No 290
>TIGR01326 OAH_OAS_sulfhy O-acetylhomoserine aminocarboxypropyltransferase/cysteine synthase; InterPro: IPR006235   This family of sequences is a distinct clade of the Cys/Met metabolism pyridoxal phosphate-dependent enzyme superfamily. Members include examples of OAH/OAS sulfhydrylase, an enzyme with activity both as O-acetylhomoserine sulfhydrylase (OAH, 2.5.1.49 from EC) and O-acetylserine sulfhydrylase (OAS, 2.5.1.47 from EC). An alternate name for OAH sulfhydrylase is homocysteine synthase.; GO: 0016765 transferase activity transferring alkyl or aryl (other than methyl) groups, 0006520 amino acid metabolic process.
Probab=32.89  E-value=35  Score=14.66  Aligned_cols=188  Identities=18%  Similarity=0.294  Sum_probs=96.9

Q ss_pred             EEECCCHHHH-HHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH--HHHHHCC
Q ss_conf             9960985799-999999886984999998704787665555778818999999999998099589817078--8663224
Q gi|254780151|r   25 VAMSGGVDSS-VVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE--RFRNAVI  101 (408)
Q Consensus        25 va~SGGVDSs-vaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~--~f~~~V~  101 (408)
                      +++|.|-=-. +|..=|.++|-+++.-- +++..        +      ++--+--=++|||..+-+|-.+  |=|+.+|
T Consensus        76 l~~ASG~AA~~~Ailnla~AGDnIVsS~-~LYGG--------T------ynLF~~TlkrlGIevrFvd~dd~pe~~~k~i  140 (434)
T TIGR01326        76 LAVASGQAAITYAILNLAQAGDNIVSSS-YLYGG--------T------YNLFKHTLKRLGIEVRFVDGDDDPEELEKAI  140 (434)
T ss_pred             HHHCHHHHHHHHHHHHHHHCCCCEEECC-CCCCH--------H------HHHHHHHHHHCCEEEEEECCCCCHHHHHHHC
T ss_conf             2101157999999999972698269806-44422--------5------7899995554481488727888878999760


Q ss_pred             CC-----CHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC--CCCEECCCCCCCEEEECCCCCCCEE-EEEECCCCCCCC
Q ss_conf             41-----126787088612000015411058888874016--8764522531102541267877316-885315787873
Q gi|254780151|r  102 VP-----FASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL--GADVLATGHYIRSRLYVGDDGKRRR-IMCRPMDLERDQ  173 (408)
Q Consensus       102 ~~-----~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~--g~~~iATGHYar~~~~~~~~~~~~~-~L~r~~D~~KDQ  173 (408)
                      ++     |+++-     -||.+.   -+=|.++-+.|++.  |+.-|.            ||.-..+ +|||+.|.-=| 
T Consensus       141 d~nTKAvf~EtI-----gNP~~~---v~Die~~a~~Ah~~PhgvPliV------------DNT~atpGYL~rPi~hGAD-  199 (434)
T TIGR01326       141 DENTKAVFAETI-----GNPALN---VPDIEAVAEVAHAHPHGVPLIV------------DNTFATPGYLCRPIDHGAD-  199 (434)
T ss_pred             CCCCEEEEEECC-----CCCCCC---CCCHHHHHHHHHHCCCCCEEEE------------ECCCCCCCCCCCHHHCCCC-
T ss_conf             667518984012-----387767---6785899999986789834887------------4786876410064564986-


Q ss_pred             EEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCCEE
Q ss_conf             18986302022100334256899789899997412543551110230111277510345530766434671103774322
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL  253 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~vi  253 (408)
                                    ++  +...||=            +-----|.|=|-|-.|+|.|..++       +|++-....=-=
T Consensus       200 --------------IV--vhSaTK~------------iGGHG~aiGG~ivD~G~FndW~~~-------~gkFP~f~~Pdp  244 (434)
T TIGR01326       200 --------------IV--VHSATKY------------IGGHGTAIGGVIVDGGKFNDWANN-------PGKFPLFTTPDP  244 (434)
T ss_pred             --------------EE--EEEECCC------------CCCCEEEEEEEEEECCCCCCCCCC-------CCCCCCCCCCCC
T ss_conf             --------------79--9610010------------126314650478826755630147-------874777888888


Q ss_pred             EEECCCEEEE-ECCCCCCCCCCCCCCEEEECCCC
Q ss_conf             3357831531-02334335657786137631755
Q gi|254780151|r  254 GRHNGIINYT-IGQRRGLGVAMGEPLFVVYLDKN  286 (408)
Q Consensus       254 G~H~G~~~yT-IGQRkGL~i~~~eP~YVv~id~~  286 (408)
                      +-| |+-+.+ .|+-.+||++  .|-|-++..+.
T Consensus       245 sYH-Gl~f~E~~g~~~~~G~~--~~Afi~~~Rv~  275 (434)
T TIGR01326       245 SYH-GLVFTETFGEFEGLGLG--NIAFIVKARVQ  275 (434)
T ss_pred             CCC-CCEEEECCCCCCCCCCC--CHHEEEEEEEE
T ss_conf             658-71265315575777850--00003444674


No 291
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104   Members of this family are encoded by slr1293, a carotenoid biosynthesis protein which was shown to be the C-3',4' desaturase (CrtD) of myxoxanthophyll biosynthesis in Synechocystis sp. (strain PCC 6803), and close homologues (presumed to be functionally equivalent) from other cyanobacteria, where myxoxanthophyll biosynthesis is either known or expected. This enzyme can act on neurosporene and so presumably catalyses the first step that is committed to myxoxanthophyll..
Probab=32.69  E-value=35  Score=14.64  Aligned_cols=76  Identities=24%  Similarity=0.434  Sum_probs=47.4

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCH-------HH--------HHH---HHHHHHHCCC
Q ss_conf             99960985799999999886984999998704787665555778818-------99--------999---9999998099
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAG-------QD--------VYD---ARRVCDTINV   85 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~-------~d--------~~~---a~~va~~LgI   85 (408)
                      +|-+=||+==..||+||.++||+|+=+=-+.        -.|.|-+.       -|        +|.   =.+|-++|+|
T Consensus         4 VvVIGaGIaGLTaAALLA~~G~~Vtl~E~h~--------q~GGCAgTFrRr~ftFDVGATQVAGLEpGGiH~riF~~L~~   75 (499)
T TIGR02733         4 VVVIGAGIAGLTAAALLAKRGYRVTLLEQHA--------QLGGCAGTFRRRGFTFDVGATQVAGLEPGGIHARIFRELGL   75 (499)
T ss_pred             EEEEECCHHHHHHHHHHHHCCCCEEEEEEEC--------CCCCCCCCCCCCCEEEECCCEEECCCCCCCHHHHHHHHCCC
T ss_conf             6998187267899999985399679997401--------27875443436874540455221367898579999985488


Q ss_pred             CEEECCHHHHHHHHCCCCCHHHHHC-CCCCC
Q ss_conf             5898170788663224411267870-88612
Q gi|254780151|r   86 SHYVFDYEERFRNAVIVPFASSYAA-GETPL  115 (408)
Q Consensus        86 ~~~~~d~~~~f~~~V~~~~~~~y~~-G~TPN  115 (408)
                      |+=..+        |.||-.--|.- |.+|-
T Consensus        76 pLP~A~--------~lDPAC~V~L~dg~~PI   98 (499)
T TIGR02733        76 PLPEAK--------ILDPACAVYLPDGSEPI   98 (499)
T ss_pred             CCCCCC--------CCCCCCEEECCCCCCCC
T ss_conf             789884--------06883367778795110


No 292
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane]
Probab=32.59  E-value=35  Score=14.62  Aligned_cols=28  Identities=36%  Similarity=0.646  Sum_probs=21.8

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             99609857999999998869849999987
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGVTLQ   53 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~~m~   53 (408)
                      .|.. |-|-|.-|-||.++||+|+|+.-+
T Consensus         8 TGIT-GQDGsYLa~lLLekGY~VhGi~Rr   35 (345)
T COG1089           8 TGIT-GQDGSYLAELLLEKGYEVHGIKRR   35 (345)
T ss_pred             ECCC-CCCHHHHHHHHHHCCCEEEEEEEC
T ss_conf             5445-875389999998569489878603


No 293
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis. This pathway is unique to microorganisms and plants, rendering the enzyme an attractive target for the development of antimicrobials and herbicides. This subgroup also includes cystathionine gamma-lyases (CGL), O-acetylhomoserine sulfhydrylases and O-acetylhomoserine thiol lyases. CGL's are very similar to CGS's. Members of this group are widely distributed among all three forms of life.
Probab=32.53  E-value=36  Score=14.62  Aligned_cols=96  Identities=20%  Similarity=0.316  Sum_probs=54.4

Q ss_pred             EEEEEECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             899996098579999999--988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .-++++|.|. |+.++.+  |.+.|-+|+... ..+              .-...-.+.....+||....+|..+.    
T Consensus        56 ~~a~~~sSGm-aAi~~~l~~l~~~Gd~vl~~~-~~Y--------------g~t~~~~~~~l~~~Gi~v~~~d~~d~----  115 (369)
T cd00614          56 EAALAFSSGM-AAISTVLLALLKAGDHVVASD-DLY--------------GGTYRLFERLLPKLGIEVTFVDPDDP----  115 (369)
T ss_pred             CCEEEECCHH-HHHHHHHHHHCCCCCEEEEEC-CCC--------------CCHHHHHHHHHHCCCEEEEEECCCCH----
T ss_conf             8089965789-999999998528899999957-885--------------23999999778608923897678786----


Q ss_pred             CCCCCHHHHHCCCCCCCEEC-C----CCEEE---HHHHHHHHCCCCCCEECC
Q ss_conf             24411267870886120000-1----54110---588888740168764522
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVD-C----NRTVK---FSDLLSVTRQLGADVLAT  143 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~-C----N~~iK---F~~l~~~a~~~g~~~iAT  143 (408)
                            ++.++-.+||..+. |    |..++   +.++.+.|++.|+-.+.-
T Consensus       116 ------~~~~~~i~~~t~li~~EspsNP~l~v~Di~~i~~~A~~~g~~~vvD  161 (369)
T cd00614         116 ------EALEAAIKPETKLVYVESPTNPTLKVVDIEAIAELAHEHGALLVVD  161 (369)
T ss_pred             ------HHHHHHCCCCCEEEEEECCCCCCCEECCCHHHHHHHHHCCEEEEEE
T ss_conf             ------8899763878508999658999706227299999997667179974


No 294
>PRK13238 tnaA tryptophanase; Provisional
Probab=32.33  E-value=36  Score=14.60  Aligned_cols=81  Identities=17%  Similarity=0.254  Sum_probs=49.5

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCC
Q ss_conf             99609857999999998869849999987047876655557788189999999999980995898170788663224411
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPF  104 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~  104 (408)
                      .-+.|-+|=...-.++++.|-+=+++.+-.-..+...   |.--|.+.++.++++|++.|||+. +| .-+|+++  .+|
T Consensus       155 ~pFKGN~Dl~kLe~~i~~~g~~~I~~v~~tiTnN~~G---GQPVSm~Nir~v~~la~~~~ip~~-lD-aaRfaEN--AyF  227 (461)
T PRK13238        155 YPFKGNFDLEKLEALIEEVGADNIPFIVMTITNNSAG---GQPVSMANLRAVYEIAKKYGIPVV-LD-AARFAEN--AYF  227 (461)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCCCEEEEEEEECCCC---CCCCCHHHHHHHHHHHHHCCCCEE-EE-HHHHHHH--HHH
T ss_conf             8978877999999999873844654899998626878---816468999999999998299599-86-5667664--578


Q ss_pred             HHHHHCCC
Q ss_conf             26787088
Q gi|254780151|r  105 ASSYAAGE  112 (408)
Q Consensus       105 ~~~y~~G~  112 (408)
                      +.....|.
T Consensus       228 Ik~RE~gY  235 (461)
T PRK13238        228 IKQREPGY  235 (461)
T ss_pred             HHHCCCCC
T ss_conf             87325312


No 295
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.
Probab=32.20  E-value=36  Score=14.58  Aligned_cols=26  Identities=46%  Similarity=0.737  Sum_probs=19.8

Q ss_pred             EEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             9996098579--9999999886984999
Q gi|254780151|r   24 VVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus        24 ~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      +||+.||+-|  |.++.+|++.|+.|.-
T Consensus         1 iigiTG~igSGKStv~~~l~~~g~~v~~   28 (179)
T cd02022           1 IIGLTGGIGSGKSTVAKLLKELGIPVID   28 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             9886378757899999999987990996


No 296
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase; InterPro: IPR014186   This entry describes proteins from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (3.1.2.12 from EC). Eukaryotic members, particularly the human protein, are better known as esterase D (3.1.1.1 from EC), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well..
Probab=32.17  E-value=22  Score=16.13  Aligned_cols=29  Identities=31%  Similarity=0.353  Sum_probs=19.9

Q ss_pred             EEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             898630202210033425689978989999741254
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      |||++|+=.+=.-       |-|.+.++.|.++||-
T Consensus        47 ~yLsGLTCT~en~-------m~Kag~~R~AAe~G~a   75 (279)
T TIGR02821        47 YYLSGLTCTEENF-------MIKAGAQRFAAEYGLA   75 (279)
T ss_pred             EECCCCCHHHHHH-------HHHHHHHHHHHHCCCE
T ss_conf             1000013115789-------9877789999768907


No 297
>pfam04748 Polysacc_deac_2 Divergent polysaccharide deacetylase. This family is divergently related to pfam01522 (personal obs:Yeats C).
Probab=31.95  E-value=36  Score=14.55  Aligned_cols=27  Identities=19%  Similarity=0.272  Sum_probs=19.1

Q ss_pred             EEEEEE-CCCHHHHHHHHHHHHCCCEEE
Q ss_conf             899996-098579999999988698499
Q gi|254780151|r   22 RVVVAM-SGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        22 kV~va~-SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      .|-+|+ -..-+|.-.|.+..++|+||+
T Consensus        22 piT~Ai~P~~~~~~~~a~~a~~~g~Evl   49 (213)
T pfam04748        22 PVTLAILPYAPHAAELAEAARAAGHEVL   49 (213)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCEEE
T ss_conf             7589987999866999999998799499


No 298
>pfam12017 Transposase_37 Transposase protein. Protein in this family are transposases found in insects. This region is about 230 amino acids in length and is found associated with pfam05485.
Probab=31.90  E-value=36  Score=14.55  Aligned_cols=25  Identities=24%  Similarity=0.349  Sum_probs=12.4

Q ss_pred             EEEECCCEEEEECCCCCCCCCCCCCCEE
Q ss_conf             2335783153102334335657786137
Q gi|254780151|r  253 LGRHNGIINYTIGQRRGLGVAMGEPLFV  280 (408)
Q Consensus       253 iG~H~G~~~yTIGQRkGL~i~~~eP~YV  280 (408)
                      .+.|+-+-.+.+   +||.-.+..|-|.
T Consensus       163 ~~pa~~vqv~mv---rGl~~~WKQPI~y  187 (236)
T pfam12017       163 YEPSNYVQLAIV---RGLKKSWKQPVFF  187 (236)
T ss_pred             CCCCCEEEEEEH---HHHHHCCCCCEEE
T ss_conf             366655653002---7765066675799


No 299
>pfam01121 CoaE Dephospho-CoA kinase. This family catalyses the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form Coenzyme A EC:2.7.1.24. This enzyme uses ATP in its reaction.
Probab=31.79  E-value=36  Score=14.54  Aligned_cols=27  Identities=33%  Similarity=0.640  Sum_probs=21.1

Q ss_pred             EEEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             99996098579--9999999886984999
Q gi|254780151|r   23 VVVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus        23 V~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      .+||+.||+-|  |.++.+|++.|+.|+-
T Consensus         1 ~iIgiTG~IgsGKStv~~~l~~~G~~vid   29 (179)
T pfam01121         1 LIVGLTGGIGSGKSTVANLFADLGVPIVD   29 (179)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             98998578647899999999987991991


No 300
>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional
Probab=31.78  E-value=37  Score=14.53  Aligned_cols=52  Identities=12%  Similarity=0.107  Sum_probs=30.2

Q ss_pred             CCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHH-HHHHCCCCCCCHHHCCCEEE
Q ss_conf             78787318986302022100334256899789899-99741254355111023011
Q gi|254780151|r  168 DLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD-LAREMGLDIADKSDSQDICF  222 (408)
Q Consensus       168 D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~-~A~~~gl~~a~K~eSqgICF  222 (408)
                      ...=|+.-..+.=.+.|+.|++ ---+|+.+|+|. ||.+.  +.++|..--|+-.
T Consensus       121 ~~~~d~VvvV~~p~e~qv~RL~-~r~gls~~~A~aRIaaQ~--~~e~r~a~AD~VI  173 (394)
T PRK03333        121 APLFPLVVVVHADVEVRVRRLV-EQRGMAEADARARIAAQA--SDEQRRAAADVWL  173 (394)
T ss_pred             CCCCCEEEEEECCHHHHHHHHH-HCCCCCHHHHHHHHHHCC--CHHHHHHHCCEEE
T ss_conf             0369979999898899999998-637989999999999479--9999998599999


No 301
>pfam11684 DUF3280 Protein of unknown function (DUF2380). This family of proteins with unknown function appears to be restricted to Proteobacteria.
Probab=31.70  E-value=32  Score=14.97  Aligned_cols=35  Identities=31%  Similarity=0.419  Sum_probs=25.6

Q ss_pred             CHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC
Q ss_conf             1267870886120000154110588888740168764522531
Q gi|254780151|r  104 FASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       104 ~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY  146 (408)
                      --++-.++.-|.-|-.|        ....|+++|+++..||--
T Consensus        55 ~a~~~~~~~~l~~C~gC--------~~~~Ar~lGAd~~i~G~V   89 (140)
T pfam11684        55 VAAEIAKIANLAKCGGC--------DARIARKLGADYALTGEV   89 (140)
T ss_pred             HHHHHHCCCCCCCCCCH--------HHHHHHHCCCCEEEEEEE
T ss_conf             66666303895426666--------789999739988999999


No 302
>cd02647 nuc_hydro_TvIAG nuc_hydro_ TvIAG:  Nucleoside hydrolases similar to the Inosine-adenosine-guanosine-preferring nucleoside hydrolase from Trypanosoma vivax.   Nucleoside hydrolases cleave the N-glycosidic bond in nucleosides generating ribose and the respective base. Nucleoside hydrolases vary in their substrate specificity. This group contains eukaryotic and bacterial proteins similar to the purine specific inosine-adenosine-guanosine-preferring nucleoside hydrolase (IAG-NH) from T.  vivax.  T. vivax IAG-NH is of the order of a thousand to ten thousand fold more specific towards the naturally occurring purine nucleosides, than towards the pyrimidine nucleosides.
Probab=31.66  E-value=37  Score=14.52  Aligned_cols=56  Identities=23%  Similarity=0.391  Sum_probs=39.0

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             88999960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      +||++=-..|+|=++|..++... -.||.|++.-.-.        +-+..+...+.+.++...+|
T Consensus         1 r~vIiDtD~GiDDa~Al~~al~~p~~dl~gIt~t~v~--------gn~~~~~~~~n~~~ll~~~~   57 (312)
T cd02647           1 KNVIFDHDGNVDDLVALLLLLKNEKVDLKGIGVSGID--------ADCYVEPAVSVTRKLIDRLG   57 (312)
T ss_pred             CCEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEEEEC--------CCHHHHHHHHHHHHHHHHHC
T ss_conf             9889989797699999999986899868999997752--------88089999999999999838


No 303
>PRK12928 lipoyl synthase; Provisional
Probab=31.45  E-value=34  Score=14.74  Aligned_cols=34  Identities=18%  Similarity=0.239  Sum_probs=18.1

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             788863388999960985799999999886984999
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIG   49 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g   49 (408)
                      ..+.|.=.||-  +.+|-.-.-...+|++.+.+-++
T Consensus        11 ~~rkP~Wlkvk--~p~~~~~~~~~~~l~~~~L~TVC   44 (290)
T PRK12928         11 ILRLPEWLRAP--IGKASELETVQRLVKQRRLHTIC   44 (290)
T ss_pred             CCCCCHHEEEC--CCCCCHHHHHHHHHHHCCCEEEE
T ss_conf             77896432863--89983499999999977992556


No 304
>PRK08813 threonine dehydratase; Provisional
Probab=31.23  E-value=37  Score=14.47  Aligned_cols=26  Identities=31%  Similarity=0.242  Sum_probs=12.3

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEE
Q ss_conf             89999609857999999998869849
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDV   47 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V   47 (408)
                      |-+|+.|.|=-.--.|+--+..|..+
T Consensus        82 ~GVV~aSaGNHaqavA~aA~~~gi~a  107 (349)
T PRK08813         82 RPVICASAGNHAQGVAWSAYRLGVQA  107 (349)
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCE
T ss_conf             86799886489999999999869998


No 305
>TIGR01761 thiaz-red thiazolinyl imide reductase; InterPro: IPR010091   This reductase is found associated with gene clusters for the biosynthesis of various non-ribosomal peptide derived natural products in which cysteine is cyclised to a thiazoline ring containing an imide double bond. Examples include yersiniabactin and pyochelin. Yersiniabactin is a virulence factor secreted by Yersinia pestis in iron-deficient microenvironments, in order to scavenge ferric ions . .
Probab=30.85  E-value=38  Score=14.43  Aligned_cols=101  Identities=26%  Similarity=0.352  Sum_probs=58.2

Q ss_pred             CCCCCCEEE---E--EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             886338899---9--96098579999999988698499999870478766555577881899999999999809958981
Q gi|254780151|r   16 KNPKDMRVV---V--AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        16 ~~~k~~kV~---v--a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~   90 (408)
                      .-|.+.+++   |  +.-||--|++|-+||+ .|.+|+=      .+        . -..+||.+-++.|++.|-.+ .+
T Consensus        68 ~lp~~~~~ACvvvRSa~~Gg~G~~LA~aLL~-RGi~VLq------EH--------P-l~p~d~~~L~~lA~~~Gr~Y-~v  130 (378)
T TIGR01761        68 ELPDDIDIACVVVRSAIVGGKGSELARALLK-RGIHVLQ------EH--------P-LHPEDIAELLRLAERQGRRY-LV  130 (378)
T ss_pred             HCCCCCCEEEEEEEEEEECCCCHHHHHHHHH-CCCEEEE------CC--------C-CCHHHHHHHHHHHHHCCCEE-EE
T ss_conf             0468875558885225317972589999985-6751563------28--------9-88778999999999709866-42


Q ss_pred             C-------HHHHHHHHCCCCCHHH-HHCCCCC-CCEECCCCEEEHHHHHHHHCCCC
Q ss_conf             7-------0788663224411267-8708861-20000154110588888740168
Q gi|254780151|r   91 D-------YEERFRNAVIVPFASS-YAAGETP-LPCVDCNRTVKFSDLLSVTRQLG  137 (408)
Q Consensus        91 d-------~~~~f~~~V~~~~~~~-y~~G~TP-NPc~~CN~~iKF~~l~~~a~~~g  137 (408)
                      |       ....|    +++.-+. ...-++| -=++-|-..+-|+.|==.+.-+|
T Consensus       131 NTFYPh~PAv~~F----i~~~~q~rr~~~~~p~~v~at~g~Ql~ys~LD~~~~~Lg  182 (378)
T TIGR01761       131 NTFYPHLPAVRRF----IEYARQLRRAARKKPAFVEATTGVQLLYSTLDILARALG  182 (378)
T ss_pred             CCCCCCCHHHHHH----HHHHHHHHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHC
T ss_conf             0677873378999----999999999974789789840026899999999999847


No 306
>cd06831 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor. Antizyme inhibitor (AZI) is homologous to the fold type III PLP-dependent enzyme ODC but does not retain any decarboxylase activity. Like ODC, AZI is presumed to exist as a homodimer. Antizyme is a regulatory protein that binds directly to the ODC monomer to block its active site, leading to its degradation by the 26S proteasome. AZI binds to Antizyme with a higher affinity than ODC, preventing the formation of the Antizyme-ODC complex. Thus, AZI blocks the ability of Antizyme to promote ODC degradation, which leads to increased ODC enzymatic activity and polyamine levels. AZI also prevents the degradation of other proteins regulated by Antizyme, such as cyclin D1.
Probab=30.69  E-value=38  Score=14.41  Aligned_cols=30  Identities=17%  Similarity=0.279  Sum_probs=21.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             5778818999999999998099589817078866
Q gi|254780151|r   64 KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        64 ~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      .+.|-+.++++.|.    ..||.+..+|-.+|..
T Consensus        86 ~gp~Kt~~ei~~A~----~~GV~~~~~Ds~~EL~  115 (394)
T cd06831          86 TNPCKQASQIKYAA----KVGVNIMTCDNEIELK  115 (394)
T ss_pred             CCCCCCHHHHHHHH----HCCCCEEECCCHHHHH
T ss_conf             79999999999999----8599778537689999


No 307
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed
Probab=30.66  E-value=38  Score=14.41  Aligned_cols=73  Identities=12%  Similarity=0.063  Sum_probs=43.8

Q ss_pred             CEEEEEECCCHHHHHHHHHH----HHCCCEEE--EEEEECCCCCCCCCCCCCCC--CHH---HHHHHHHHHHHCCCCEEE
Q ss_conf             88999960985799999999----88698499--99987047876655557788--189---999999999980995898
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL----KRDGYDVI--GVTLQLYNSRKASKRKGSCC--AGQ---DVYDARRVCDTINVSHYV   89 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL----~~~G~~V~--g~~m~~~~~~~~~~~~~~c~--~~~---d~~~a~~va~~LgI~~~~   89 (408)
                      +||++.=|||--||+.+.-+    +++|.|+.  ++-..-.++.-... .--|+  .++   -..+.++.|+..|||...
T Consensus         2 kKILLvCaaGMSTSmlv~km~~~A~~~G~dveI~Av~~~e~~~~i~~~-~yDv~LlgPQVr~~~~~~k~~a~~~giPv~v   80 (104)
T PRK09590          2 AKALIICAAGMSSSLMAKKTTEFLKGKGKDIEVDAISATEGGKAIAAA-AFDLYLVSPQTKMYFKQFEEAGSKAGKPVVQ   80 (104)
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHHHCCCCEEEEEEEHHHHHHHHCCC-CCCEEEECHHHHHHHHHHHHHHHHCCCCEEE
T ss_conf             559999689987999999999999976983699984888988763226-8878998876887899999999872997788


Q ss_pred             CCHHH
Q ss_conf             17078
Q gi|254780151|r   90 FDYEE   94 (408)
Q Consensus        90 ~d~~~   94 (408)
                      +|..+
T Consensus        81 I~~~~   85 (104)
T PRK09590         81 IPPQA   85 (104)
T ss_pred             ECCCC
T ss_conf             78746


No 308
>PRK07226 fructose-bisphosphate aldolase; Provisional
Probab=30.51  E-value=38  Score=14.39  Aligned_cols=41  Identities=17%  Similarity=0.262  Sum_probs=20.9

Q ss_pred             CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             698499999870478766555577881899999999999809958981
Q gi|254780151|r   43 DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        43 ~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~   90 (408)
                      .|-+-+++++-. ..+.+.      -.-+++.....-|+..|+|+..+
T Consensus       105 lGAdaV~~~v~~-Gs~~E~------~~l~~l~~l~~ea~~~GlPll~~  145 (266)
T PRK07226        105 LGADAVSVHVNV-GSETEA------EMLEDLGRIARECEEWGMPLLAM  145 (266)
T ss_pred             CCCCEEEEEEEC-CCCCHH------HHHHHHHHHHHHHHHHCCCEEEE
T ss_conf             587789998547-998379------99999999999999859956999


No 309
>pfam01976 DUF116 Protein of unknown function DUF116. This archaebacterial protein has no known function. The protein contains seven conserved cysteines and may also be an integral membrane protein.
Probab=30.13  E-value=30  Score=15.17  Aligned_cols=30  Identities=20%  Similarity=0.551  Sum_probs=24.8

Q ss_pred             CEECCCCEEEHHHHHHHHCCCCCC-EECCCCC
Q ss_conf             000015411058888874016876-4522531
Q gi|254780151|r  116 PCVDCNRTVKFSDLLSVTRQLGAD-VLATGHY  146 (408)
Q Consensus       116 Pc~~CN~~iKF~~l~~~a~~~g~~-~iATGHY  146 (408)
                      =|..|.+ =..+.|.+.|+++|+. +||||-.
T Consensus        66 ~C~~CG~-C~I~~l~~la~~~G~~v~i~~Ggt   96 (158)
T pfam01976        66 NCKECGK-CDIGDLKELAEEYGYKVYIVPGGT   96 (158)
T ss_pred             CCCCCCC-CCHHHHHHHHHHCCCEEEEECCCH
T ss_conf             2878999-844279999998098799964828


No 310
>pfam03848 TehB Tellurite resistance protein TehB.
Probab=30.08  E-value=39  Score=14.34  Aligned_cols=55  Identities=18%  Similarity=0.316  Sum_probs=36.6

Q ss_pred             CEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE--EECCHHHH
Q ss_conf             8899-996098579999999988698499999870478766555577881899999999999809958--98170788
Q gi|254780151|r   21 MRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH--YVFDYEER   95 (408)
Q Consensus        21 ~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~--~~~d~~~~   95 (408)
                      -|++ +|--.|-.|    .-|.++||+|+++=     .           ++..++.++.+++.-+++.  ...|+.+.
T Consensus        32 gk~LDlgcG~GRNs----lyLa~~G~~VtavD-----~-----------n~~aL~~l~~ia~~e~l~i~~~~~Din~~   89 (192)
T pfam03848        32 GKALDLGCGQGRNS----LFLSLLGYDVTAVD-----H-----------NENSIANLQDIKEKENLDIPTALYDINSA   89 (192)
T ss_pred             CCEEEECCCCCHHH----HHHHHCCCEEEEEE-----C-----------CHHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             74666047897318----99986899179997-----9-----------99999999999997099752687315556


No 311
>PRK05451 dihydroorotase; Provisional
Probab=30.07  E-value=39  Score=14.34  Aligned_cols=41  Identities=24%  Similarity=0.350  Sum_probs=24.2

Q ss_pred             HHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             26787088612000015411058888874016876452253
Q gi|254780151|r  105 ASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       105 ~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      +.-|-+|-|-|-+..-...=++...++.+.++|..-+..|.
T Consensus        99 ~KlYPaGaTTNS~~GV~~~~~~~~~le~m~~~g~pLliHGE  139 (345)
T PRK05451         99 AKLYPAGATTNSDAGVTDIEKIYPVLEAMQKIGMPLLVHGE  139 (345)
T ss_pred             EEECCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCEEECCC
T ss_conf             63024775356742142399999999999975990452145


No 312
>KOG0776 consensus
Probab=30.00  E-value=29  Score=15.24  Aligned_cols=22  Identities=18%  Similarity=-0.003  Sum_probs=13.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC
Q ss_conf             9999609857999999998869
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDG   44 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G   44 (408)
                      -.++.--++.+++++.+-..++
T Consensus        28 ~~~~s~~~~~~~~~~~~~~~~~   49 (384)
T KOG0776          28 SKVGSWSSTLLKVAAVLSSASS   49 (384)
T ss_pred             CCCCCCCCCCCCCCHHHHHHHH
T ss_conf             0377777545455314555430


No 313
>TIGR02815 agaS_fam putative sugar isomerase, AgaS family; InterPro: IPR014180   Some members of this protein family are found in genic regions associated with N-acetyl-galactosamine and galactosamine utilisation and are suggested to be isomerases..
Probab=29.72  E-value=22  Score=16.09  Aligned_cols=139  Identities=18%  Similarity=0.224  Sum_probs=76.3

Q ss_pred             CCCCCCEEEE---EECCCHHHHHHHHHHHHCCCEEEEEE-EECCCCC-CCCC---------CCCCCCCHHHHHHHHHHHH
Q ss_conf             8863388999---96098579999999988698499999-8704787-6655---------5577881899999999999
Q gi|254780151|r   16 KNPKDMRVVV---AMSGGVDSSVVAALLKRDGYDVIGVT-LQLYNSR-KASK---------RKGSCCAGQDVYDARRVCD   81 (408)
Q Consensus        16 ~~~k~~kV~v---a~SGGVDSsvaa~lL~~~G~~V~g~~-m~~~~~~-~~~~---------~~~~c~~~~d~~~a~~va~   81 (408)
                      ++..|.||+.   |=|-=+-+.++=+|-++-|.+|.++= =.+-... ....         ...+.-|+|.+. |-+.|+
T Consensus        40 ~Pe~~LRIvLTGAGTSAF~G~~l~P~L~~~~G~~V~A~pTTDLV~nP~qyL~p~~PTLLvSfaRSGNSPESVA-AV~LAd  118 (374)
T TIGR02815        40 RPEEDLRIVLTGAGTSAFIGDALAPWLAKHLGLRVEAVPTTDLVSNPAQYLDPDRPTLLVSFARSGNSPESVA-AVELAD  118 (374)
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHCCCCCCHHEEEECCCCCCHHHHH-HHHHHH
T ss_conf             8564775898567754779999999999840981588523777788155146455412022112588765799-998874


Q ss_pred             HCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEE
Q ss_conf             80995898170788663224411267870886120000154110588888740168764522531102541267877316
Q gi|254780151|r   82 TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRR  161 (408)
Q Consensus        82 ~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~  161 (408)
                      ++==++|..                          -+-||..   |+|.++|..-.                     +..
T Consensus       119 Q~l~ecyHL--------------------------~lTCN~~---G~L~r~A~~~~---------------------~~~  148 (374)
T TIGR02815       119 QLLPECYHL--------------------------VLTCNEE---GALARNAVNRS---------------------NSF  148 (374)
T ss_pred             HCCCCCCCC--------------------------CEECCCH---HHHHHHHHCCC---------------------CCE
T ss_conf             215654203--------------------------2223800---05679872489---------------------638


Q ss_pred             EEEECCCCCCCCEEEE-EEECCHHHCEEECCCC--CCCHHHHHHHHHHC
Q ss_conf             8853157878731898-6302022100334256--89978989999741
Q gi|254780151|r  162 IMCRPMDLERDQSYFL-FATTQQQLCDLRFPLG--DMKKESVRDLAREM  207 (408)
Q Consensus       162 ~L~r~~D~~KDQSYfL-~~l~~~~L~~~~FPlg--~~~K~eVR~~A~~~  207 (408)
                      .|+-+.. ..||||-. |..+-=.|+ .+.=||  +....+.+.+|+..
T Consensus       149 ~LLMP~~-snD~sFAMTSSFscM~la-~l~~lgp~~~~~~~~~~~A~~a  195 (374)
T TIGR02815       149 ALLMPEE-SNDRSFAMTSSFSCMMLA-ALAVLGPKTLESKEEERFAKAA  195 (374)
T ss_pred             EEECCCC-CCCCCCHHHHHHHHHHHH-HHHHHCCCCCCHHHHHHHHHHH
T ss_conf             9858743-478640023358999999-9986255662114699999999


No 314
>pfam01933 UPF0052 Uncharacterized protein family UPF0052.
Probab=29.32  E-value=40  Score=14.25  Aligned_cols=34  Identities=24%  Similarity=0.306  Sum_probs=27.6

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCC
Q ss_conf             99960985799999999886984999998704787
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR   58 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~   58 (408)
                      +|++|||+-.+..+.=|++...+++++. -..|+.
T Consensus         1 IV~lgGGtG~~~ll~gLk~~~~~ltaIV-~~~DDg   34 (291)
T pfam01933         1 VVVLGGGTGLSKLLRGLKRLTSELTAIV-TVADDG   34 (291)
T ss_pred             CEEECCCCCHHHHHHHHHHCCCCEEEEE-ECCCCC
T ss_conf             9898266248899999974788659999-876488


No 315
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930    In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis. During prolonged fasting, when hepatic glycogen is exhausted, gluconeogenesis becomes the only source of plasma glucose. Gluconeogenesis (the production of new glucose molecules) occurs mainly in liver and, to a small extent, in kidneys.    Pyruvate carboxylase (6.4.1.1 from EC), a member of the biotin-dependent enzyme family, catalyses the ATP-dependent carboxylation of pyruvate to oxaloacetate, thus playing a crucial role in gluconeogenesis.  ATP + pyruvate + HCO3- = ADP + phosphate + oxaloacetate  Most well characterised forms of active enzyme consist of four identical subunits arranged in a tetrahedron-like structure. Each subunit contains three functional domains: the biotin carboxylation domain, the transcarboxylation domain and the biotin carboxyl carrier domain.; GO: 0004736 pyruvate carboxylase activity, 0006094 gluconeogenesis, 0005737 cytoplasm.
Probab=29.29  E-value=40  Score=14.25  Aligned_cols=175  Identities=16%  Similarity=0.195  Sum_probs=86.6

Q ss_pred             HHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH-HHHCCCCEEECCHHHHHHHHCCCCCHHHHHC---CCCCCC
Q ss_conf             886984999998704787665555778818999999999-9980995898170788663224411267870---886120
Q gi|254780151|r   41 KRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV-CDTINVSHYVFDYEERFRNAVIVPFASSYAA---GETPLP  116 (408)
Q Consensus        41 ~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~v-a~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~---G~TPNP  116 (408)
                      .++|-||+=+=|.-.++    ..+..  +...+-.|-.= -..=|++..-|..-+.||+.|=..+- ....   =.-|||
T Consensus       775 veAGvDvvDvAv~smSG----~TSQP--S~~a~~~aL~G~~~dpgln~~~v~~ls~YWe~~R~~Ya-~FEstt~lKsP~~  847 (1169)
T TIGR01235       775 VEAGVDVVDVAVDSMSG----LTSQP--SLGALVAALEGSERDPGLNVEDVRELSAYWEEVRKLYA-AFESTTDLKSPDS  847 (1169)
T ss_pred             HHCCCCEEHHHHHHHCC----CCHHH--HHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHH-HHHCCCCCCCCCC
T ss_conf             87588611456764104----50033--38999997278989888898999898788999974421-1110367887785


Q ss_pred             EECCCCEE--EHHHHHHHHCCCCC--CEECCCC-CCCEEEECCCCC--CCEEEEEECCCCCCCCEEEEEEECCHHHCEEE
Q ss_conf             00015411--05888887401687--6452253-110254126787--73168853157878731898630202210033
Q gi|254780151|r  117 CVDCNRTV--KFSDLLSVTRQLGA--DVLATGH-YIRSRLYVGDDG--KRRRIMCRPMDLERDQSYFLFATTQQQLCDLR  189 (408)
Q Consensus       117 c~~CN~~i--KF~~l~~~a~~~g~--~~iATGH-Yar~~~~~~~~~--~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~  189 (408)
                      +|.-|..=  -|-=|...|+++|-  .|=-+-. |++++..-||=-  ...+...  =|..      |+++++       
T Consensus       848 evY~hE~PGGQytNL~~QA~~lGLg~~w~~vk~aYr~aN~llGDIvKVTPSSKVV--GDlA------lfMV~n-------  912 (1169)
T TIGR01235       848 EVYLHEIPGGQYTNLQFQAKSLGLGDRWEEVKKAYREANQLLGDIVKVTPSSKVV--GDLA------LFMVSN-------  912 (1169)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEECCCCCHH--HHHH------HHHHHH-------
T ss_conf             4333578850446799998654831268999999999877519838983787226--5478------764303-------


Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC------CCCCCHHHHH-----H-CCCCCCCCCCEEC
Q ss_conf             4256899789899997412543551110230111------2775103455-----3-0766434671103
Q gi|254780151|r  190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFV------QQGKYFDVVK-----R-INAGIALEGDIVH  247 (408)
Q Consensus       190 FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi------~~~~~~~Fl~-----~-~~~~~~~~G~ivd  247 (408)
                          +||..+|++.|+++-||     ||-== |+      |++.|.+=|+     . ..+...+||.-+.
T Consensus       913 ----~LT~~dV~~~~~~l~FP-----~SVv~-~l~G~iGqP~gGFPE~l~~~vLk~k~~~~t~RPG~~L~  972 (1169)
T TIGR01235       913 ----DLTEDDVVEKAEELDFP-----DSVVE-FLKGDIGQPHGGFPEPLRKKVLKGKEKPITVRPGELLE  972 (1169)
T ss_pred             ----HCCHHHHHCCCCCCCCC-----HHHHH-HHCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCC
T ss_conf             ----01568731334577874-----68999-83377783348887256889960889750117876678


No 316
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism]
Probab=29.19  E-value=40  Score=14.24  Aligned_cols=128  Identities=16%  Similarity=0.104  Sum_probs=54.8

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEE-HHHHHHHHCCCCCCEECCCCCCCEEE
Q ss_conf             99999999980995898170788663224411267870886120000154110-58888874016876452253110254
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK-FSDLLSVTRQLGADVLATGHYIRSRL  151 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iK-F~~l~~~a~~~g~~~iATGHYar~~~  151 (408)
                      ..||-.+-+.-||.+..+-+    |   .+|    |..  --|+|-.-|--++ --.+-+.|+.+|-.-++-=||..-=.
T Consensus        65 ~qD~~~iLK~~GvNyvRlRv----w---ndP----~ds--ngn~yggGnnD~~k~ieiakRAk~~GmKVl~dFHYSDfwa  131 (403)
T COG3867          65 RQDALQILKNHGVNYVRLRV----W---NDP----YDS--NGNGYGGGNNDLKKAIEIAKRAKNLGMKVLLDFHYSDFWA  131 (403)
T ss_pred             HHHHHHHHHHCCCCEEEEEE----E---CCC----CCC--CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCHHHCC
T ss_conf             77899999974967699998----5---388----667--8986688750189999999998746867986402111016


Q ss_pred             ECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEECCCCCCH
Q ss_conf             12678773168853157878731898630202210033425689978989999741254--3551110230111277510
Q gi|254780151|r  152 YVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICFVQQGKYF  229 (408)
Q Consensus       152 ~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICFi~~~~~~  229 (408)
                         |.+.        .++.|-    --.++-++|.+.   +-++||.-+..+-++==+|  +----|+.+=-.-|.+..+
T Consensus       132 ---DPak--------Q~kPka----W~~l~fe~lk~a---vy~yTk~~l~~m~~eGi~pdmVQVGNEtn~gflwp~Ge~~  193 (403)
T COG3867         132 ---DPAK--------QKKPKA----WENLNFEQLKKA---VYSYTKYVLTTMKKEGILPDMVQVGNETNGGFLWPDGEGR  193 (403)
T ss_pred             ---CHHH--------CCCCHH----HHHCCHHHHHHH---HHHHHHHHHHHHHHCCCCCCCEEECCCCCCCEECCCCCCC
T ss_conf             ---8010--------178477----663489999999---9999999999999748994516754546771324678876


Q ss_pred             HH
Q ss_conf             34
Q gi|254780151|r  230 DV  231 (408)
Q Consensus       230 ~F  231 (408)
                      +|
T Consensus       194 ~f  195 (403)
T COG3867         194 NF  195 (403)
T ss_pred             CH
T ss_conf             76


No 317
>cd03706 mtEFTU_III Domain III of mitochondrial EF-TU (mtEF-TU). mtEF-TU is highly conserved and is 55-60% identical to bacterial EF-TU. The overall structure is similar to that observed in the Escherichia coli and Thermus aquaticus EF-TU. However, compared with that observed in prokaryotic EF-TU the nucleotide-binding domain (domain I) of EF-TUmt is in a different orientation relative to the rest of the structure. Furthermore, domain III is followed by a short 11-amino acid extension that forms one helical turn. This extension seems to be specific to the mitochondrial factors and has not been observed in any of the prokaryotic factors.
Probab=29.08  E-value=40  Score=14.22  Aligned_cols=39  Identities=18%  Similarity=0.400  Sum_probs=30.6

Q ss_pred             EECCE-EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             82997-999975972000696389997388866588876897145
Q gi|254780151|r  343 RNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       343 ~~~~~-~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      +.++. +.++|..|+ ++.+||--.+=++.    +-+|.|+|+.+
T Consensus        54 PGd~~~~~~~L~~p~-~le~g~rFtiREgg----~TVg~GvVte~   93 (93)
T cd03706          54 PGEDTKVTLILRRPM-VLEKGQRFTLRDGN----RTIGTGLVTDT   93 (93)
T ss_pred             CCCCEEEEEEECCCE-ECCCCCEEEEEECC----EEEEEEEEECC
T ss_conf             788289999977606-11599818893599----98998999569


No 318
>PRK05708 2-dehydropantoate 2-reductase; Provisional
Probab=29.06  E-value=40  Score=14.22  Aligned_cols=32  Identities=22%  Similarity=0.160  Sum_probs=25.8

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             388999960985799999999886984999998
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      -|||+|.=.|++-|.+++.|. ++|++|+-+.-
T Consensus         2 ~MkI~IiGaGAiG~~~a~~L~-~ag~dV~lv~r   33 (305)
T PRK05708          2 SMTWHILGAGSLGSLWACRLA-RAGLPVRLILR   33 (305)
T ss_pred             CCEEEEECCCHHHHHHHHHHH-HCCCCEEEEEE
T ss_conf             988999882399999999998-48997399994


No 319
>cd07583 nitrilase_5 Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.
Probab=28.94  E-value=41  Score=14.21  Aligned_cols=123  Identities=18%  Similarity=0.287  Sum_probs=62.6

Q ss_pred             EHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHH
Q ss_conf             05888887401687645225311025412678773168853157878731898630202210033425689978989999
Q gi|254780151|r  125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLA  204 (408)
Q Consensus       125 KF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A  204 (408)
                      |...+.+.|.+.|++.|....++-.-+.          +                   +.+....-++..-.-+.++++|
T Consensus        20 ~i~~~i~~A~~~ga~lvvfPE~~ltGY~----------~-------------------~~~~~~a~~~~~~~~~~l~~~a   70 (253)
T cd07583          20 RVESLIEEAAAAGADLIVLPEMWNTGYF----------L-------------------DDLYELADEDGGETVSFLSELA   70 (253)
T ss_pred             HHHHHHHHHHHCCCEEEEECCCCCCCCC----------H-------------------HHHHHHCCCCCCHHHHHHHHHH
T ss_conf             9999999999883989991898635899----------7-------------------8998633347829999999998


Q ss_pred             HHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCCEEEEECCCEEEEE-CCCCCCCCCCCCCCEEEEC
Q ss_conf             741254355111023011127751034553076643467110377432233578315310-2334335657786137631
Q gi|254780151|r  205 REMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTI-GQRRGLGVAMGEPLFVVYL  283 (408)
Q Consensus       205 ~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~viG~H~G~~~yTI-GQRkGL~i~~~eP~YVv~i  283 (408)
                      +++++.+.-     |  .++.++-..   -|.     .--+++.+|+++|.|+=.|.|+. +.++-..-  |+...|.+.
T Consensus        71 ~~~~i~iv~-----G--~~~e~~~~~---~yN-----sa~~i~~~G~i~~~yrK~hl~~~~~E~~~f~~--G~~~~v~~~  133 (253)
T cd07583          71 KKHGVNIVA-----G--SVAEKEGGK---LYN-----TAYVIDPDGELIATYRKIHLFGLMGEDKYLTA--GDELEVFEL  133 (253)
T ss_pred             HHHCCEEEE-----E--EEEEEECCE---EEE-----EEEEECCCCEEEEEEECCCCCCCCCCCEEEEC--CCCCCEEEE
T ss_conf             874979999-----0--069800994---999-----99999089859999923026997661537864--886413764


Q ss_pred             CCCCCEEEEE
Q ss_conf             7553125652
Q gi|254780151|r  284 DKNSSRVIVG  293 (408)
Q Consensus       284 d~~~N~ViVg  293 (408)
                      +.-+=-+.+|
T Consensus       134 ~~~~iG~~IC  143 (253)
T cd07583         134 DGGKVGLFIC  143 (253)
T ss_pred             CCEEEEEEEE
T ss_conf             4527885786


No 320
>TIGR02723 phenyl_P_alpha phenylphosphate carboxylase, alpha subunit; InterPro: IPR014095   Members of this protein family are the alpha subunit of phenylphosphate carboxylase. Phenol (methyl-benzene) is converted to phenylphosphate, then para-carboxylated by this four-subunit enzyme, with the release of phosphate, to 4-hydroxybenzoate. The enzyme contains neither biotin nor thiamin pyrophosphate. This alpha subunit is homologous to the beta subunit and, more broadly, to UbiD family decarboxylases..
Probab=28.92  E-value=39  Score=14.36  Aligned_cols=70  Identities=21%  Similarity=0.304  Sum_probs=34.0

Q ss_pred             EECCCCEEEHHHHHHHHC--------CCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEE
Q ss_conf             000154110588888740--------168764522531102541267877316885315787873189863020221003
Q gi|254780151|r  117 CVDCNRTVKFSDLLSVTR--------QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL  188 (408)
Q Consensus       117 c~~CN~~iKF~~l~~~a~--------~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~  188 (408)
                      |.-|...|-.|.=.|..+        .-|-.|+-|=|-.-+++-.  .+.-.+.+.|-.           +-+...++-.
T Consensus       112 daPCkenillG~dvdltklPvPlvhdGdGGryvGtWhavit~hPv--rGdvnWGmyrqm-----------mWdGrtmsGa  178 (485)
T TIGR02723       112 DAPCKENILLGDDVDLTKLPVPLVHDGDGGRYVGTWHAVITKHPV--RGDVNWGMYRQM-----------MWDGRTMSGA  178 (485)
T ss_pred             CCCCCCCEEECCCCCHHCCCCCEEEECCCCCEEEEEEEEEECCCC--CCCCCHHHHHHH-----------HHCCCEECCE
T ss_conf             888300123147532100674326608986144444445441763--334321234334-----------3236400100


Q ss_pred             ECCCCCCCHHH
Q ss_conf             34256899789
Q gi|254780151|r  189 RFPLGDMKKES  199 (408)
Q Consensus       189 ~FPlg~~~K~e  199 (408)
                      +||..++-|.=
T Consensus       179 vfPfsdlGkal  189 (485)
T TIGR02723       179 VFPFSDLGKAL  189 (485)
T ss_pred             ECCHHHHHHHH
T ss_conf             04525655688


No 321
>KOG1372 consensus
Probab=28.83  E-value=41  Score=14.19  Aligned_cols=35  Identities=29%  Similarity=0.527  Sum_probs=23.2

Q ss_pred             CCCEEE--EEECCCHHHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             338899--996098579999999988698499999870
Q gi|254780151|r   19 KDMRVV--VAMSGGVDSSVVAALLKRDGYDVIGVTLQL   54 (408)
Q Consensus        19 k~~kV~--va~SGGVDSsvaa~lL~~~G~~V~g~~m~~   54 (408)
                      .+.||+  -|++| -|-|..|-+|.++||+|+|+.-+-
T Consensus        26 r~rkvALITGItG-QDGSYLaEfLL~KgYeVHGiiRRs   62 (376)
T KOG1372          26 RPRKVALITGITG-QDGSYLAEFLLSKGYEVHGIIRRS   62 (376)
T ss_pred             CCCEEEEEECCCC-CCCHHHHHHHHCCCCEEEEEEEEC
T ss_conf             6541799962368-872699999870885676788604


No 322
>pfam02879 PGM_PMM_II Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II.
Probab=28.65  E-value=41  Score=14.17  Aligned_cols=34  Identities=29%  Similarity=0.447  Sum_probs=28.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             3388999960985799999999886984999998
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      ++.||++-...|+=+.++..||++.|.+++.+..
T Consensus        19 ~~lkv~vD~~~G~~~~~~~~ll~~lg~~~~~~~~   52 (103)
T pfam02879        19 RGLKVVYDPLHGVGGEILPELLKRLGAEVVEENC   52 (103)
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHCCCEEEEECC
T ss_conf             8988999778863589999999986998999436


No 323
>PRK07588 hypothetical protein; Provisional
Probab=28.53  E-value=41  Score=14.16  Aligned_cols=29  Identities=21%  Similarity=0.489  Sum_probs=21.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             889999609857999999998869849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |||+|. =||+=-..+|+.|+++|++|+=+
T Consensus         1 mkVlIv-GaGiaGLalA~~L~r~G~~v~V~   29 (391)
T PRK07588          1 MKIAIS-GAGIAGATLAHWLQRTGHEPTLI   29 (391)
T ss_pred             CEEEEE-CCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             979999-93289999999998689998999


No 324
>pfam11303 DUF3105 Protein of unknown function (DUF3105). Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known.
Probab=28.43  E-value=15  Score=17.24  Aligned_cols=15  Identities=0%  Similarity=0.173  Sum_probs=6.3

Q ss_pred             CCCCHHHHHHHHHHC
Q ss_conf             689978989999741
Q gi|254780151|r  193 GDMKKESVRDLAREM  207 (408)
Q Consensus       193 g~~~K~eVR~~A~~~  207 (408)
                      -+...+-|+++-+++
T Consensus       103 d~~dd~~i~~Fi~~y  117 (130)
T pfam11303       103 DSADDPRIKAFISKY  117 (130)
T ss_pred             CCCCHHHHHHHHHHH
T ss_conf             668989999999998


No 325
>COG4930 Predicted ATP-dependent Lon-type protease [Posttranslational modification, protein turnover, chaperones]
Probab=28.34  E-value=31  Score=15.02  Aligned_cols=24  Identities=25%  Similarity=0.355  Sum_probs=20.1

Q ss_pred             HHCEEECCCCCCCHHHHHHHHHHC
Q ss_conf             210033425689978989999741
Q gi|254780151|r  184 QLCDLRFPLGDMKKESVRDLAREM  207 (408)
Q Consensus       184 ~L~~~~FPlg~~~K~eVR~~A~~~  207 (408)
                      -|-+++||=+.++|+|+|.+++-.
T Consensus       425 GLlKLL~Pd~t~~kee~k~ileyA  448 (683)
T COG4930         425 GLLKLLFPDKTFDKEELKTILEYA  448 (683)
T ss_pred             HHHHHHCCCCCCCHHHHHHHHHHH
T ss_conf             789985799886899999999999


No 326
>TIGR01307 pgm_bpd_ind 2,3-bisphosphoglycerate-independent phosphoglycerate mutase; InterPro: IPR005995   This 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (iPGAM) is a metalloenzyme found particularly in eubacteria and higher plants. It is distantly related to archaeal iPGAM (IPR004456 from INTERPRO) and distinct from the unrelated cofactor-dependent PGAM (PIRSF001490 from PIRSF). Activity has been demonstrated for proteins from a variety of organisms, including Pseudomonas syringae pv. tomato , Bacillus subtilis , Bacillus stearothermophilus , maize , castor bean , and Trypanosoma brucei . The structure of the B. stearothermophilus enzyme (PDB:1EJJ) has two domains . Residues 1-76 and 311-511 form the phosphatase domain, containing the active site residue and two metal-binding sites. This domain is similar to alkaline phosphatase (PDB:1ALK) and arylsulphatase (PDB:1AUK), which are members of the SCOP alkaline phosphatase-like superfamily, but there is meagre sequence similarity outside of the metal-binding segments. Residues 77-310 form the phosphotransferase domain, which is poorly conserved (or perhaps unrelated) in the archaeal enzymes.; GO: 0004619 phosphoglycerate mutase activity, 0006007 glucose catabolic process.
Probab=28.23  E-value=42  Score=14.12  Aligned_cols=72  Identities=14%  Similarity=0.242  Sum_probs=46.3

Q ss_pred             EEEE--CCCHHHH----HHHHH-HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC--------CEE
Q ss_conf             9996--0985799----99999-9886984999998704787665555778818999999999998099--------589
Q gi|254780151|r   24 VVAM--SGGVDSS----VVAAL-LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV--------SHY   88 (408)
Q Consensus        24 ~va~--SGGVDSs----vaa~l-L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI--------~~~   88 (408)
                      ++||  .|||=|-    +|+.. .+++|..=+.+|+  +.++...   .+|..+++++.-...++.+|.        .+|
T Consensus       118 l~GL~S~GGVHSh~~Hl~AL~~~A~~~G~~k~~lH~--f~DGRDt---~P~s~~~~L~~l~~~~~~~g~g~Iasi~GRYY  192 (529)
T TIGR01307       118 LMGLVSDGGVHSHIDHLIALIELAAERGIEKVCLHA--FTDGRDT---APKSAESYLEQLEAFLKEIGKGRIASISGRYY  192 (529)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEE--EECCCCC---CCCCHHHHHHHHHHHHHHCCCEEEEEEEEEEE
T ss_conf             997338895036088999999999668931799987--6077888---88766789999999997249448999873445


Q ss_pred             ECCHHHHHHHHCC
Q ss_conf             8170788663224
Q gi|254780151|r   89 VFDYEERFRNAVI  101 (408)
Q Consensus        89 ~~d~~~~f~~~V~  101 (408)
                      -.| ||.=|++|-
T Consensus       193 AMD-RD~RWdRve  204 (529)
T TIGR01307       193 AMD-RDQRWDRVE  204 (529)
T ss_pred             ECC-CCCCHHHHH
T ss_conf             143-467178999


No 327
>pfam04310 MukB MukB N-terminal. This family represents the N-terminal region of MukB, one of a group of bacterial proteins essential for the movement of nucleoids from mid-cell towards the cell quarters (i.e. chromosome partitioning). The structure of the N-terminal domain consists of an antiparallel six-stranded beta sheet surrounded by one helix on one side and by five helices on the other side. It contains an exposed Walker A loop in an unexpected helix-loop-helix motif (in other proteins, Walker A motifs generally adopt a P loop conformation as part of a strand-loop-helix motif embedded in a conserved topology of alternating helices and (parallel) beta strands).
Probab=28.13  E-value=39  Score=14.34  Aligned_cols=30  Identities=20%  Similarity=0.197  Sum_probs=13.3

Q ss_pred             EEEECCC----HHHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             9996098----579999999988698499999870
Q gi|254780151|r   24 VVAMSGG----VDSSVVAALLKRDGYDVIGVTLQL   54 (408)
Q Consensus        24 ~va~SGG----VDSsvaa~lL~~~G~~V~g~~m~~   54 (408)
                      ++.+|||    .-+.++|.++. .=.|..-++++|
T Consensus        29 vttLsG~NGAGKsT~m~Af~ta-lIPDl~~l~frn   62 (227)
T pfam04310        29 VTTLSGGNGAGKSTTMAAFITA-LIPDLSLLHFRN   62 (227)
T ss_pred             EEEEECCCCCCHHHHHHHHHHH-HCCCCEEEEECC
T ss_conf             6886447876548799999998-666643886215


No 328
>PRK05967 cystathionine beta-lyase; Provisional
Probab=28.05  E-value=42  Score=14.10  Aligned_cols=97  Identities=15%  Similarity=0.115  Sum_probs=54.1

Q ss_pred             EEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             9999609857999999-998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      -++++|.|---..++. -+.+.|-+|+..- .++              --...-.+.+...+||....+|..+.      
T Consensus        81 ~a~~~sSGmaAi~~~ll~~l~~Gdhiv~~~-~~Y--------------ggT~~l~~~~l~~~Gi~v~~vd~~~~------  139 (392)
T PRK05967         81 GTILVPSGLAAVTVPLLGFLSAGDHALIVD-SVY--------------YPTRHFADTMLKRLGVEVEYYDPEIG------  139 (392)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCEEEECC-CCC--------------CHHHHHHHHHHHHCCEEEEEECCCCH------
T ss_conf             779945779999999999738998899448-984--------------45899999987636869999889999------


Q ss_pred             CCCHHHHHCCCCCCCEE-CC----CCEE---EHHHHHHHHCCCCCCEECCC
Q ss_conf             41126787088612000-01----5411---05888887401687645225
Q gi|254780151|r  102 VPFASSYAAGETPLPCV-DC----NRTV---KFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~-~C----N~~i---KF~~l~~~a~~~g~~~iATG  144 (408)
                          +++++-.+||..+ .|    |+.+   -..++.+.|++.|+-.|.--
T Consensus       140 ----~~~~~~i~~~Tklv~~Etp~NP~l~v~Di~~ia~~A~~~g~~~vVDN  186 (392)
T PRK05967        140 ----AGIEKLMRPNTKVVFTESPGSNTFEIQDIPAIAEAAHRHGAIVMMDN  186 (392)
T ss_pred             ----HHHHHHCCCCCEEEEEECCCCCCCEEECHHHHHHHHHHCCCEEEEEC
T ss_conf             ----99997448786599985589986455354999999987698799617


No 329
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain. This domain adopts a Rossmann NAD binding fold. The C-terminal domain of homoserine dehydrogenase contributes a single helix to this structural domain, which is not included in the Pfam model.
Probab=27.94  E-value=42  Score=14.09  Aligned_cols=105  Identities=16%  Similarity=0.109  Sum_probs=47.3

Q ss_pred             CCHHHHHHHHHHHHC---CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCH
Q ss_conf             985799999999886---98499999870478766555577881899999999999809958981707886632244112
Q gi|254780151|r   29 GGVDSSVVAALLKRD---GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFA  105 (408)
Q Consensus        29 GGVDSsvaa~lL~~~---G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~  105 (408)
                      |-|-|.|+-.|..++   ++++.++..+.............+....|+   ..+.....|+..+-=-..+   -+.+...
T Consensus         3 G~VG~~v~~~l~~~~~~~~~~l~~v~~r~~~~~~~~~~~~~~~~~~d~---~~ll~~~~iDvVVE~~g~~---~~~~~~~   76 (116)
T pfam03447         3 GAIGSGLLELLLRQQEEIPLELVAVADRDLLSKARAALLGDEPVTLDL---DDLVADPRPDVVVECASSE---AVAEYVL   76 (116)
T ss_pred             CCHHHHHHHHHHHCCCCCCEEEEEEEECCHHHCCCCCCCCCCEEECCH---HHHHCCCCCCEEEECCCCH---HHHHHHH
T ss_conf             702899999999492035679999984783432321246667157799---9996188998999889948---9999999


Q ss_pred             HHHHCCC---CCCCEECCCCEEEHHHHHHHHCCCCCCE
Q ss_conf             6787088---6120000154110588888740168764
Q gi|254780151|r  106 SSYAAGE---TPLPCVDCNRTVKFSDLLSVTRQLGADV  140 (408)
Q Consensus       106 ~~y~~G~---TPNPc~~CN~~iKF~~l~~~a~~~g~~~  140 (408)
                      +..++|.   |+|.-.+... -.|..|++.|++.|..+
T Consensus        77 ~aL~~GkhVVTaNK~~lA~~-~~~~eL~~~A~~~g~~~  113 (116)
T pfam03447        77 KALKAGKHVVTASKGALADL-ALRERLREAAEASGVRV  113 (116)
T ss_pred             HHHHCCCEEEEECHHHHCCH-HHHHHHHHHHHHCCCEE
T ss_conf             99987998999078896785-79999999999839969


No 330
>PRK12831 putative oxidoreductase; Provisional
Probab=27.79  E-value=42  Score=14.07  Aligned_cols=31  Identities=32%  Similarity=0.404  Sum_probs=22.3

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             33889999609857999999998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      ..+||+|= -+|-=...||+-|.++||+|+=+
T Consensus       139 ~gkkVAVI-GsGPAGLsaA~~La~~G~~VtVf  169 (464)
T PRK12831        139 KGKKVAVI-GSGPAGLTCAGDLAKKGYDVTIF  169 (464)
T ss_pred             CCCEEEEE-CCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             99989998-97689999999999769917998


No 331
>PRK06852 aldolase; Validated
Probab=27.79  E-value=42  Score=14.07  Aligned_cols=78  Identities=13%  Similarity=-0.067  Sum_probs=30.3

Q ss_pred             CCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             54443467888633889999609857999999998869849999987047876655557788189999999999980995
Q gi|254780151|r    7 TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus         7 ~~~~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      +|||+.+.-.++.+.--+-.+-+.||-++...--..-|..-+|+|+-..++.+..       --+++..+.+-|+.+|+|
T Consensus        97 lKlN~~~~L~~~~~~dp~s~~~~sv~~a~~~~~~~~LGa~aVG~TIY~GSe~e~~-------ml~e~~~i~~eA~~~Gl~  169 (303)
T PRK06852         97 VKLNSKTNLVKTSQKDPFSNQWLDVDQVVEFKKNSGLNILGVGYTIYLGSEYEAE-------MLSEAAQIIYEAHKHGLV  169 (303)
T ss_pred             EEECCCCCCCCCCCCCCCHHCCCCHHHHHHHHHHCCCCCEEEEEEEECCCHHHHH-------HHHHHHHHHHHHHHCCCE
T ss_conf             9965756467766678401010679999865231158865999998579740699-------999999999999976990


Q ss_pred             EEECC
Q ss_conf             89817
Q gi|254780151|r   87 HYVFD   91 (408)
Q Consensus        87 ~~~~d   91 (408)
                      ...+-
T Consensus       170 ~VlW~  174 (303)
T PRK06852        170 AVLWI  174 (303)
T ss_pred             EEEEE
T ss_conf             89999


No 332
>PRK07012 consensus
Probab=27.66  E-value=43  Score=14.06  Aligned_cols=19  Identities=26%  Similarity=0.340  Sum_probs=11.2

Q ss_pred             EEEEEECCCHHHHHHHHHH
Q ss_conf             8999960985799999999
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALL   40 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL   40 (408)
                      .-++++||+.++-++.+|+
T Consensus       127 egLI~lsg~~~g~v~~~l~  145 (1173)
T PRK07012        127 EGLLALSGAQQGDIGLALA  145 (1173)
T ss_pred             CCEEEECCCCCCHHHHHHH
T ss_conf             9979965886676999874


No 333
>TIGR00011 YbaK_EbsC ybaK/ebsC protein; InterPro: IPR004369   The family includes P36922 from SWISSPROT, a protein which affects the expression of a receptor called binding substance, that mediates mating aggregate formation in Enterococcus faecalis . It was suggested that this may be a regulatory protein that suppresses the function or expression of ebsA and/or ebsMB. A crystallographic study of another member of this family, P45202 from SWISSPROT from Haemophilus influenzae, (HI1434, YbaK) suggests that these proteins could be involved in nucleotide or oligonucleotide binding .; GO: 0006355 regulation of transcription DNA-dependent.
Probab=27.61  E-value=43  Score=14.05  Aligned_cols=79  Identities=14%  Similarity=0.217  Sum_probs=42.4

Q ss_pred             HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             99999886984999998704787665555778818999999999998099589817078866322441126787088612
Q gi|254780151|r   36 VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        36 aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                      |+.+|.++|.+=   .+..|+.++..           -.++..+|+.||.     |...-|+.-|++-      .+.--|
T Consensus         3 A~r~L~~~kI~y---~~~~Y~~d~~~-----------~~~g~~~A~~lG~-----~~~~VfKTLv~~~------~~~~~p   57 (156)
T TIGR00011         3 AVRLLDKAKIEY---EVHEYEVDPDH-----------DLDGESAAEKLGV-----DPERVFKTLVAEG------DKKGKP   57 (156)
T ss_pred             HHHHHHHCCCCE---EEECCCCCCCC-----------CHHHHHHHHHHCC-----CCCEEEEEEEEEE------CCCCCC
T ss_conf             688899619956---87213569988-----------6158999998299-----8110688889960------789997


Q ss_pred             C---EECCCCEEEHHHHHHHHCCCCCCEEC
Q ss_conf             0---00015411058888874016876452
Q gi|254780151|r  116 P---CVDCNRTVKFSDLLSVTRQLGADVLA  142 (408)
Q Consensus       116 P---c~~CN~~iKF~~l~~~a~~~g~~~iA  142 (408)
                      |   ||-||+++=   |-..|+..|...+-
T Consensus        58 ~~VaviP~~~~L~---lK~lAka~G~KK~~   84 (156)
T TIGR00011        58 LVVAVIPVDEELD---LKKLAKASGGKKAE   84 (156)
T ss_pred             EEEEEEECCCCCC---HHHHHHHHCCCCCC
T ss_conf             1799971586218---78999880898412


No 334
>TIGR01430 aden_deam adenosine deaminase; InterPro: IPR006330    This family includes the experimentally verified adenosine deaminases of mammals and Escherichia coli. Other members of this family are predicted also to be adenosine deaminase, an enzyme of nucleotide degradation. This family is distantly related to AMP deaminase. ; GO: 0004000 adenosine deaminase activity, 0009168 purine ribonucleoside monophosphate biosynthetic process.
Probab=27.48  E-value=43  Score=14.03  Aligned_cols=46  Identities=9%  Similarity=0.132  Sum_probs=26.2

Q ss_pred             HHHHHHHCCCCEE-ECC---HHHHHH-HHCCCCCHHHHHCCCCCCCEEC-CCCEE
Q ss_conf             9999998099589-817---078866-3224411267870886120000-15411
Q gi|254780151|r   76 ARRVCDTINVSHY-VFD---YEERFR-NAVIVPFASSYAAGETPLPCVD-CNRTV  124 (408)
Q Consensus        76 a~~va~~LgI~~~-~~d---~~~~f~-~~V~~~~~~~y~~G~TPNPc~~-CN~~i  124 (408)
                      ...+|++-||++- .-+   +...|+ ..=+..|++-|=.|.   +|+. |..=+
T Consensus        19 ~l~la~k~gi~LP~~~~~~e~~~~~~~~~~L~~FL~~yd~~~---~~L~G~~~d~   70 (346)
T TIGR01430        19 LLELAQKNGIPLPDLQSLEELKEAYEKFRDLQDFLAKYDFGV---EVLRGTEDDF   70 (346)
T ss_pred             HHHHHHHCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHH---HHHCCCHHHH
T ss_conf             998886438988863121002321112678789999999998---8742899899


No 335
>PRK08166 NADH dehydrogenase subunit G; Validated
Probab=27.37  E-value=28  Score=15.38  Aligned_cols=10  Identities=40%  Similarity=0.760  Sum_probs=3.4

Q ss_pred             CCCCCEEEEE
Q ss_conf             0069638999
Q gi|254780151|r  358 GVASGQACVF  367 (408)
Q Consensus       358 aiAPGQ~~Vf  367 (408)
                      +|..|+.+-+
T Consensus       801 GI~dGd~V~V  810 (858)
T PRK08166        801 GVNAGTRVSF  810 (858)
T ss_pred             CCCCCCEEEE
T ss_conf             9999798999


No 336
>PRK07681 aspartate aminotransferase; Provisional
Probab=27.37  E-value=43  Score=14.02  Aligned_cols=72  Identities=11%  Similarity=0.032  Sum_probs=33.1

Q ss_pred             HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHH-HHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCE
Q ss_conf             998869849999987047876655557788189999999-9999809958981707886632244112678708861200
Q gi|254780151|r   39 LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR-RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPC  117 (408)
Q Consensus        39 lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~-~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc  117 (408)
                      .++.+|.+|+-+..    ++....      ..+.+.+|- +.+++-..-.+...=..++++.|.+.+-+.|  |..-+|+
T Consensus        26 ~~~~~g~~vI~l~i----G~Pd~~------~p~~i~~a~~~~~~~~~~~~y~~~G~~eLReaia~~~~~~~--g~~~~pd   93 (399)
T PRK07681         26 EKIAAGHKMIDLSI----GNPDMP------PADFVREEMVHTANEKESYGYTLSGIQEFHEAVTEYYNNTH--NVILNAD   93 (399)
T ss_pred             HHHHCCCCEEECCC----CCCCCC------CCHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHH--CCCCCCC
T ss_conf             99867998388989----889998------78999999999971877688898873999999999999986--8998988


Q ss_pred             --ECCCC
Q ss_conf             --00154
Q gi|254780151|r  118 --VDCNR  122 (408)
Q Consensus       118 --~~CN~  122 (408)
                        |.+-.
T Consensus        94 ~~I~vt~  100 (399)
T PRK07681         94 KEVLLLM  100 (399)
T ss_pred             CEEEECC
T ss_conf             8499868


No 337
>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases. Denitrification plays a major role  in completing the nitrogen cycle by converting nitrate or nitrite to nitrogen gas. The pathway for microbial denitrification has been established as NO3-  ------ NO2- ------ NO ------- N2O --------- N2. This reaction generally occurs under oxygen limiting conditions. Genetic and biochemical studies have shown that the first srep of the biochemical pathway is catalyzed by periplasmic nitrate reductases. This family is widely present in proteobacteria and firmicutes. This version of the domain is also present in some archaeal members. The function of the vWA domain in this sub-group is not known. Members of this subgroup have a conserved MIDAS motif.
Probab=27.35  E-value=43  Score=14.02  Aligned_cols=14  Identities=14%  Similarity=0.484  Sum_probs=7.3

Q ss_pred             HHCCCCEEECCHHH
Q ss_conf             98099589817078
Q gi|254780151|r   81 DTINVSHYVFDYEE   94 (408)
Q Consensus        81 ~~LgI~~~~~d~~~   94 (408)
                      +.+|+|+-+.-|..
T Consensus        34 ~~~g~~~~v~gF~s   47 (174)
T cd01454          34 EACGVPHAILGFTT   47 (174)
T ss_pred             HHCCCCEEEEECCC
T ss_conf             97699569995157


No 338
>PRK05481 lipoyl synthase; Provisional
Probab=26.95  E-value=39  Score=14.34  Aligned_cols=34  Identities=24%  Similarity=0.426  Sum_probs=18.6

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             788863388999960985799999999886984999
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIG   49 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g   49 (408)
                      +.+.|.=.|+  -+.+|-.-.-.-.+|++.+.+-++
T Consensus         3 ~~rkP~Wlkv--k~p~~~~~~~~k~~l~~~~L~TVC   36 (289)
T PRK05481          3 ILRKPDWLRV--KLPTGERYTETKALLRENGLHTVC   36 (289)
T ss_pred             CCCCCHHEEE--CCCCCCHHHHHHHHHHHCCCEEEE
T ss_conf             8879653176--389984199999999977992555


No 339
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]
Probab=26.95  E-value=44  Score=13.97  Aligned_cols=30  Identities=30%  Similarity=0.339  Sum_probs=23.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             33889999609857999999998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +.+=|+||  ||+=.+.+|+.|.++|.+|+-+
T Consensus         4 ~~~vvIIG--gGi~Gls~A~~La~~G~~V~vi   33 (387)
T COG0665           4 KMDVVIIG--GGIVGLSAAYYLAERGADVTVL   33 (387)
T ss_pred             CCEEEEEC--CCHHHHHHHHHHHHCCCEEEEE
T ss_conf             64399989--8699999999999769919999


No 340
>cd06828 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase. Diaminopimelate decarboxylase (DapDC, EC 4.1.1.20) participates in the last step of lysine biosynthesis. It converts meso-2,6-diaminoheptanedioate to L-lysine. It is a fold type III PLP-dependent enzyme that contains an N-terminal PLP-binding TIM-barrel domain and a C-terminal beta-sandwich domain, similar to bacterial alanine racemases. DapDC exists as homodimers with active sites that lie at the interface between the TIM barrel domain of one subunit and the beta-sandwich domain of the other subunit. Homodimer formation and the presence of the PLP cofactor are required for catalytic activity.
Probab=26.93  E-value=44  Score=13.97  Aligned_cols=30  Identities=10%  Similarity=0.100  Sum_probs=19.1

Q ss_pred             CCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             7788189999999999980995898170788663
Q gi|254780151|r   65 GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        65 ~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +.|.+.++++.|.    +.|+.+..+|-.+|+..
T Consensus        79 gp~K~~~~i~~A~----~~gv~~i~~Ds~~El~~  108 (373)
T cd06828          79 GNGKSDEELELAL----ELGILRINVDSLSELER  108 (373)
T ss_pred             CCCCCHHHHHHHH----HCCCCEEEECCHHHHHH
T ss_conf             7641137899999----73985676299999999


No 341
>cd06840 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bifunctional Aspartate Kinase/Diaminopimelate Decarboxylase. Bifunctional aspartate kinase/diaminopimelate decarboxylase (AspK/DapDC, EC 4.1.1.20/EC 2.7.2.4) typically exists in bacteria. These proteins contain an N-terminal AspK region and a C-terminal DapDC region, which contains a PLP-binding TIM-barrel domain followed by beta-sandwich domain, characteristic of fold type III PLP-dependent enzymes. Members of this subfamily have not been fully characterized. Based on their sequence, these proteins may catalyze both reactions catalyzed by AspK and DapDC. AspK catalyzes the phosphorylation of L-aspartate to produce 4-phospho-L-aspartate while DapDC participates in the last step of lysine biosynthesis, the conversion of meso-2,6-diaminoheptanedioate to L-lysine.
Probab=26.74  E-value=44  Score=13.94  Aligned_cols=18  Identities=6%  Similarity=0.128  Sum_probs=11.3

Q ss_pred             CCCCCCCCCCEEEEEECC
Q ss_conf             597200069638999738
Q gi|254780151|r  353 EKSEVGVASGQACVFYTS  370 (408)
Q Consensus       353 ~eP~~aiAPGQ~~VfY~~  370 (408)
                      +.+...+.+|-.+||.+-
T Consensus       329 ~~~lp~l~~GD~l~~~~~  346 (368)
T cd06840         329 DRLLPETEEGDVILIANA  346 (368)
T ss_pred             CCCCCCCCCCCEEEECCC
T ss_conf             631788999999977682


No 342
>pfam02585 PIG-L GlcNAc-PI de-N-acetylase. Members of this family are related to PIG-L an N-acetylglucosaminylphosphatidylinositol de-N-acetylase (EC:3.5.1.89) that catalyses the second step in GPI biosynthesis.
Probab=26.46  E-value=45  Score=13.91  Aligned_cols=54  Identities=20%  Similarity=0.179  Sum_probs=30.6

Q ss_pred             HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHH
Q ss_conf             999886984999998704787665555778818999999999998099-589817078
Q gi|254780151|r   38 ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEE   94 (408)
Q Consensus        38 ~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~   94 (408)
                      ..+.++|++|.-+++-......  ..... -.+.-.+++++.|+.||+ .++..++.+
T Consensus        19 ~~~~~~g~~v~vv~~t~g~~~~--~~~~~-~~~~R~~E~~~a~~~lG~~~~~~l~~~d   73 (111)
T pfam02585        19 AKLAEQGHEVHVVTLTDGEAGG--LSPEE-LGAIRRREARAAAAILGVERVIFLDFPD   73 (111)
T ss_pred             HHHHHCCCCEEEEEECCCCCCC--CCHHH-HHHHHHHHHHHHHHHHCCCCEEECCCCC
T ss_conf             9999769987999956887677--77378-9999999999999980998258999999


No 343
>TIGR00551 nadB L-aspartate oxidase; InterPro: IPR005288    L-aspartate oxidase is the B protein, NadB, of the quinolinate synthetase complex. Quinolinate synthetase makes a precursor of the pyridine nucleotide portion of NAD. This model identifies proteins that cluster as L-aspartate oxidase (a flavoprotein difficult to separate from the set of closely related flavoprotein subunits of succinate dehydrogenase and fumarate reductase) by both UPGMA and neighbour-joining trees.; GO: 0008734 L-aspartate oxidase activity, 0009435 NAD biosynthetic process, 0005737 cytoplasm.
Probab=26.44  E-value=45  Score=13.91  Aligned_cols=46  Identities=13%  Similarity=0.159  Sum_probs=26.2

Q ss_pred             EEECCHHHCEEEC---CCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC
Q ss_conf             6302022100334---256899789899997412543551110230111
Q gi|254780151|r  178 FATTQQQLCDLRF---PLGDMKKESVRDLAREMGLDIADKSDSQDICFV  223 (408)
Q Consensus       178 ~~l~~~~L~~~~F---Plg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi  223 (408)
                      +-|-..+=.|.++   |+|+|---||-.-|-...+-.-+++-.|---|+
T Consensus       267 A~Lvd~~G~Rf~~~~hp~GeLAPRDiVaRAI~~~m~~~~~dPtqacVfL  315 (546)
T TIGR00551       267 AILVDRDGKRFMADVHPRGELAPRDIVARAIDEEMKKGGKDPTQACVFL  315 (546)
T ss_pred             CEEECCCCCEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEEE
T ss_conf             4235588867026778888767404889999999972287934068887


No 344
>PRK06522 2-dehydropantoate 2-reductase; Reviewed
Probab=26.39  E-value=45  Score=13.90  Aligned_cols=30  Identities=27%  Similarity=0.361  Sum_probs=24.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899996098579999999988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+|-=.|.+-|.+|++|. ++|++|+-+.
T Consensus         1 MkI~IiGaGaiG~~~a~~L~-~ag~~V~li~   30 (307)
T PRK06522          1 MKIAILGAGAIGGLFGARLA-QAGHDVTLVA   30 (307)
T ss_pred             CEEEEECCCHHHHHHHHHHH-HCCCCEEEEE
T ss_conf             98999991499999999998-4899889997


No 345
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional
Probab=26.36  E-value=45  Score=13.90  Aligned_cols=12  Identities=17%  Similarity=0.318  Sum_probs=7.3

Q ss_pred             CCCCEEEEEECC
Q ss_conf             069638999738
Q gi|254780151|r  359 VASGQACVFYTS  370 (408)
Q Consensus       359 iAPGQ~~VfY~~  370 (408)
                      +.+|-.++|.+-
T Consensus       830 ~~~GD~L~~~~a  841 (865)
T PRK08961        830 TAPGDVILIADT  841 (865)
T ss_pred             CCCCCEEEECCC
T ss_conf             899999999189


No 346
>TIGR00151 ispF 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase; InterPro: IPR003526   This entry represents MECDP (2-C-methyl-D-erythritol 2,4-cyclodiphosphate) synthetase, an enzyme in the non-mevalonate pathway of isoprenoid synthesis, isoprenoids being essential in all organisms. Isoprenoids can also be synthesized through the mevalonate pathway. The non-mevolante route is used by many bacteria and human pathogens, including Mycobacterium tuberculosis and Plasmodium falciparum. This route appears to involve seven enzymes. MECDP synthetase catalyses the intramolecular attack by a phosphate group on a diphosphate, with cytidine monophosphate (CMP) acting as the leaving group to give the cyclic diphosphate product MEDCP. The enzyme is a trimer with three active sites shared between adjacent copies of the protein. The enzyme also has two metal binding sites, the metals playing key roles in catalysis.   A number of proteins from eukaryotes and prokaryotes share this common N-terminal signature and appear to be involved in terpenoid biosynthesis. The ygbB protein is a putative enzyme of this type .; GO: 0008685 2-C-methyl-D-erythritol 24-cyclodiphosphate synthase activity, 0016114 terpenoid biosynthetic process.
Probab=26.35  E-value=45  Score=13.90  Aligned_cols=58  Identities=17%  Similarity=0.253  Sum_probs=34.9

Q ss_pred             CCHHHHHHH----HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             985799999----99988698499999870478766555577881899999999999809958981707
Q gi|254780151|r   29 GGVDSSVVA----ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        29 GGVDSsvaa----~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      .|.||..-+    .+++++||.+.-+=...-     .+++.--+.  =-.+-.++|+-|+||..-||..
T Consensus        72 KgaDS~~lL~~~~~~~~~~gy~~~N~D~tii-----a~~PKl~P~--i~~mR~~iA~~L~i~~d~vnvK  133 (159)
T TIGR00151        72 KGADSRVLLRKAVELVKEKGYRIGNVDVTII-----AQRPKLAPH--IEAMRENIAELLGIPLDQVNVK  133 (159)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCEEEEEEEEE-----ECCCCCCCC--HHHHHHHHHHHHCCCCCCEEEE
T ss_conf             6887789999999999855880456899997-----318986222--6899999988846870211325


No 347
>TIGR01127 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789    Serine and threonine dehydratases ,  are functionally and structurally related pyridoxal-phosphate dependent enzymes. L-serine dehydratase () and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown  that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue.    A form of threonine dehydratase with two copies of the C-terminal domain  is described by . This model describes a phylogenetically distinct which branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any  domain. Many members of this model are found in species with other isoleucine biosynthetic enzymes.; GO: 0004794 L-threonine ammonia-lyase activity.
Probab=26.31  E-value=44  Score=13.96  Aligned_cols=42  Identities=17%  Similarity=0.193  Sum_probs=27.2

Q ss_pred             EEEECCCCCCEEEE--------EEECCEEEEEECCCCCCCCCCEEEEEEC
Q ss_conf             99801788700899--------9829979999759720006963899973
Q gi|254780151|r  328 VKIRSSQDPVPVFV--------QRNDDGVYVDFEKSEVGVASGQACVFYT  369 (408)
Q Consensus       328 vkiR~~~~pvp~~i--------~~~~~~~~V~f~eP~~aiAPGQ~~VfY~  369 (408)
                      +||+--=+..|..+        +...|=+.|..|.-.+-++||-.-|--+
T Consensus       307 v~I~~~~~D~PG~L~~ll~~~A~~~aNi~~i~hDR~~~~~~~G~a~v~~~  356 (381)
T TIGR01127       307 VRIETVIPDRPGALYKLLEVIAEERANIVKIEHDRLSKEIPPGFAKVELE  356 (381)
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCEEEEEE
T ss_conf             99999982389866999999998169789999737577778675389999


No 348
>PRK12342 putative electron transfer flavoprotein YdiQ; Provisional
Probab=26.25  E-value=45  Score=13.88  Aligned_cols=18  Identities=28%  Similarity=0.486  Sum_probs=12.1

Q ss_pred             HHHHHHCCCCCCEECCCC
Q ss_conf             888874016876452253
Q gi|254780151|r  128 DLLSVTRQLGADVLATGH  145 (408)
Q Consensus       128 ~l~~~a~~~g~~~iATGH  145 (408)
                      +|-...++.|+|-|-+|-
T Consensus       100 ~La~~i~~~~~DLVl~G~  117 (254)
T PRK12342        100 ALAAAIEKIGFDLLLFGE  117 (254)
T ss_pred             HHHHHHHHHCCCEEEEEC
T ss_conf             999999983969999936


No 349
>PRK05784 phosphoribosylamine--glycine ligase; Provisional
Probab=26.23  E-value=45  Score=13.88  Aligned_cols=83  Identities=14%  Similarity=0.101  Sum_probs=52.2

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECC--CCCCCCCC---CC--CCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             88999960985799999999886984999998704--78766555---57--7881899999999999809958981707
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY--NSRKASKR---KG--SCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~--~~~~~~~~---~~--~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      |||+|-=|||=.-++|-.|.+..  .|.-+|.--.  +.......   ..  .+....|.+...+.|+..+|.+-++-=+
T Consensus         1 MkVLVIGsGGREHAla~kl~~Sp--~v~~l~~aPGn~NpG~~~~a~~~~~~~~~~~~~d~~~i~~fa~~~~IDLvvVGPE   78 (485)
T PRK05784          1 MKVLLVGDGAREHAIAEALAKSP--KGYRIYALSSHLNPGIEEIVKKTGGEYFIGNPTSPGEVVKAAEEVSPDLVVIGPE   78 (485)
T ss_pred             CEEEEECCCHHHHHHHHHHHCCC--CCCEEEEEECCCCCCHHHHHHHCCCCEECCCCCCHHHHHHHHHHCCCCEEEECCH
T ss_conf             98999898889999999996098--9898999738987525677642587212048779999999999819999998973


Q ss_pred             HHHHHHCCCCCH
Q ss_conf             886632244112
Q gi|254780151|r   94 ERFRNAVIVPFA  105 (408)
Q Consensus        94 ~~f~~~V~~~~~  105 (408)
                      .-...-+.|.|-
T Consensus        79 ~PL~~Gi~D~l~   90 (485)
T PRK05784         79 EPLFAGVADALR   90 (485)
T ss_pred             HHHHHHHHHHHH
T ss_conf             887612589997


No 350
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=26.18  E-value=45  Score=13.88  Aligned_cols=95  Identities=13%  Similarity=0.154  Sum_probs=53.6

Q ss_pred             EEEEEECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             899996098579999999--988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .-++++|.|. |++++.+  |.+.|-+|+... ..+           -+   -..-...+...+||....+|..+.    
T Consensus        74 ~~a~~~~SGM-aAIs~~ll~ll~~Gd~iv~~~-~~Y-----------gg---t~~l~~~~l~~~gi~~~fvd~~d~----  133 (424)
T PRK06084         74 VGALAVASGM-AAITYAIQTVAEAGDNIVSVA-KLY-----------GG---TYNLLAHTLPRIGIQTRFAAHDDI----  133 (424)
T ss_pred             CCEEEECCHH-HHHHHHHHHHCCCCCEEEECC-CCC-----------CC---HHHHHHHHHHHCCCEEEEECCCCH----
T ss_conf             8489954789-999999998418999899827-985-----------63---899999988746861599588677----


Q ss_pred             CCCCCHHHHHCCCCCCCEE-C----CCCEEE---HHHHHHHHCCCCCCEEC
Q ss_conf             2441126787088612000-0----154110---58888874016876452
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCV-D----CNRTVK---FSDLLSVTRQLGADVLA  142 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~-~----CN~~iK---F~~l~~~a~~~g~~~iA  142 (408)
                            ++.++-.+||..+ .    +|+.++   ..++.+.|++.|+-.+.
T Consensus       134 ------~~~~~~i~~~Tklv~~EsP~NPtl~v~DI~~i~~iA~~~g~~~vV  178 (424)
T PRK06084        134 ------AALEALIDERTKAVFCESIGNPAGNIVDLQALADAAHRHGVPLIV  178 (424)
T ss_pred             ------HHHHHHCCCCCEEEEEECCCCCCCEECCHHHHHHHHHHCCCEEEE
T ss_conf             ------999975487651899843899986503789999999874995995


No 351
>PRK13256 thiopurine S-methyltransferase; Reviewed
Probab=26.17  E-value=45  Score=13.87  Aligned_cols=53  Identities=17%  Similarity=0.236  Sum_probs=35.4

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             633889999609857999999998869849999987047876655557788189999999999980995898170
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      +++.||+|-|.|=   |+-..-|.++||.|+|+=+                ++..   ++..-+..+++..+.+.
T Consensus        42 ~~~~rVfVPLCGK---SlDm~WLa~qG~~VvGvEL----------------se~A---v~~FF~E~~l~~~v~~~   94 (226)
T PRK13256         42 NDSSVCLIPMCGC---SIDMLFFLSKGVKVIGIEL----------------SEKA---VLSFFSQNTINYEVIHG   94 (226)
T ss_pred             CCCCEEEEECCCC---HHHHHHHHHCCCEEEEEEH----------------HHHH---HHHHHHHCCCCCEEECC
T ss_conf             9998699967887---8989999978982564310----------------1899---99999976998455137


No 352
>TIGR00017 cmk cytidylate kinase; InterPro: IPR003136   This family consists of cytidylate kinase (2.7.4.14 from EC), which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors .; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=26.06  E-value=27  Score=15.48  Aligned_cols=17  Identities=29%  Similarity=0.409  Sum_probs=8.2

Q ss_pred             HHHHHHCCCCCCEECCC
Q ss_conf             88887401687645225
Q gi|254780151|r  128 DLLSVTRQLGADVLATG  144 (408)
Q Consensus       128 ~l~~~a~~~g~~~iATG  144 (408)
                      .|++.+....+.|+.+-
T Consensus        59 ~L~~L~~~~di~f~~~~   75 (223)
T TIGR00017        59 ALLELISQLDIRFIPTA   75 (223)
T ss_pred             HHHHHHHHCCCEEECCC
T ss_conf             89999863260442157


No 353
>PRK00122 rimM 16S rRNA-processing protein; Provisional
Probab=26.01  E-value=45  Score=13.85  Aligned_cols=54  Identities=20%  Similarity=0.289  Sum_probs=34.6

Q ss_pred             CEECCCCCEEEEECCCEEEEECCC--------CCCCCCCCCCCEEEECCCCCCEEEEECCCCC
Q ss_conf             110377432233578315310233--------4335657786137631755312565235554
Q gi|254780151|r  244 DIVHLNGQILGRHNGIINYTIGQR--------RGLGVAMGEPLFVVYLDKNSSRVIVGPRESL  298 (408)
Q Consensus       244 ~ivd~~G~viG~H~G~~~yTIGQR--------kGL~i~~~eP~YVv~id~~~N~ViVg~~~~L  298 (408)
                      .++|.+|+.+|+-..+..+.-+.-        +-+-+|.- +-||.++|.+++.|+|-.-+.|
T Consensus       106 ~V~d~~~~~lG~V~~v~~~~a~d~l~i~~~~~ke~liP~~-~~~i~~ID~~~k~I~v~~peGL  167 (168)
T PRK00122        106 EVVTTEGEELGKVTDILETGANDVLVVKRPGGKERLIPFV-EAVVKEVDLEAKRIVVDWPEGL  167 (168)
T ss_pred             EEEECCCCEEEEEEEEECCCCCEEEEEECCCCCEEEEECC-HHCCCEEECCCCEEEEECCCCC
T ss_conf             9994899692699997216992699999189959999735-3100679778999999796424


No 354
>PRK05702 flhB flagellar biosynthesis protein FlhB; Reviewed
Probab=25.99  E-value=45  Score=13.85  Aligned_cols=50  Identities=26%  Similarity=0.366  Sum_probs=27.2

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             87645225--31102541267877316885315787873189863020221003342568997898999974125435
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      .+|.|.|-  |||=.-.++......-..+.+|.|.               +           -..+|++|++.|+|+-
T Consensus       262 ~A~vVItNPTH~AVAL~Y~~~~~~aP~VvAKG~d~---------------~-----------A~~Ir~~A~~~~VPiv  313 (352)
T PRK05702        262 KADVVITNPTHYAVALKYDRGKMAAPVVVAKGVDE---------------V-----------ALRIREIAREHNVPIV  313 (352)
T ss_pred             CCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCH---------------H-----------HHHHHHHHHHCCCCEE
T ss_conf             79789999986289988788999999887745869---------------9-----------9999999998699887


No 355
>COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism]
Probab=25.91  E-value=30  Score=15.17  Aligned_cols=66  Identities=21%  Similarity=0.195  Sum_probs=37.9

Q ss_pred             EEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCC-CCHHHHHHCCCCCCCCCCEECCCCCEEE
Q ss_conf             986302022100334256899789899997412543551110230111277-5103455307664346711037743223
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQG-KYFDVVKRINAGIALEGDIVHLNGQILG  254 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~-~~~~Fl~~~~~~~~~~G~ivd~~G~viG  254 (408)
                      -+..+.-..+.|++.--.+++|.+++++|.+             .-|||++ ...+-|..+.....+=|-+||+-|.+.|
T Consensus       246 IiGvlh~r~llr~l~e~~~~~k~d~~~~a~e-------------pyFVPe~Tpl~~QL~~F~~~k~hialVVDEYG~i~G  312 (423)
T COG4536         246 IIGVLHVRDLLRLLNEKNEFTKEDILRAADE-------------PYFVPEGTPLSDQLVAFQRNKKHIALVVDEYGDIQG  312 (423)
T ss_pred             HHHHHHHHHHHHHHHCCCCCCHHHHHHHHCC-------------CEECCCCCCHHHHHHHHHHHCCEEEEEEECCCCEEE
T ss_conf             5334319999999634586407579987448-------------745689992899999999725127999824676776


No 356
>cd00617 Tnase_like Tryptophanase family (Tnase). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to tryptophanase (Tnase) and tyrosine phenol-lyase (TPL). Tnase and TPL are active as tetramers and catalyze beta-elimination reactions. Tnase catalyzes degradation of L-tryptophan to yield indole, pyruvate and ammonia and TPL catalyzes degradation of L-tyrosine to yield phenol, pyruvate and ammonia.
Probab=25.87  E-value=46  Score=13.84  Aligned_cols=81  Identities=16%  Similarity=0.285  Sum_probs=50.1

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCC
Q ss_conf             99609857999999998869849999987047876655557788189999999999980995898170788663224411
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPF  104 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~  104 (408)
                      .-+-|.+|=.-.-.+|.+.|.+=+++.|-.-..+...   |.--|.+.++.++++|++.|||+. +|. .+|.++  .+|
T Consensus       130 ~pFKGN~Dl~kLe~~i~~~g~~~I~~v~~tiTnN~~G---GQPVSm~Nir~v~~la~~~giplv-lDa-aRfaEN--AyF  202 (431)
T cd00617         130 IPFKGNIDVAKLEKLIDEVGAENIPYIVLTITNNTAG---GQPVSMANLREVRELAHKYGIPVV-LDA-ARFAEN--AYF  202 (431)
T ss_pred             CCCCCCCCHHHHHHHHHHHCCCCEEEEEEEEEECCCC---CCCCCHHHHHHHHHHHHHCCCCEE-EEH-HHHHHH--HHH
T ss_conf             8848888999999999873866610899998636878---856678999999999998099799-876-678876--899


Q ss_pred             HHHHHCCC
Q ss_conf             26787088
Q gi|254780151|r  105 ASSYAAGE  112 (408)
Q Consensus       105 ~~~y~~G~  112 (408)
                      +.....|.
T Consensus       203 Ik~rE~gy  210 (431)
T cd00617         203 IKEREEGY  210 (431)
T ss_pred             HHHCCCCC
T ss_conf             98435302


No 357
>COG1255 Uncharacterized protein conserved in archaea [Function unknown]
Probab=25.64  E-value=46  Score=13.81  Aligned_cols=73  Identities=21%  Similarity=0.332  Sum_probs=47.0

Q ss_pred             HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             99999886984999998704787665555778818999999999998099589817078866322441126787088612
Q gi|254780151|r   36 VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        36 aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                      .|..|.+.|+||++.-..     +       |           -+. .|+.+.+        ++|++|-+.-|+..- --
T Consensus        28 VA~~L~e~g~dv~atDI~-----~-------~-----------~a~-~g~~~v~--------DDitnP~~~iY~~A~-lI   74 (129)
T COG1255          28 VAKRLAERGFDVLATDIN-----E-------K-----------TAP-EGLRFVV--------DDITNPNISIYEGAD-LI   74 (129)
T ss_pred             HHHHHHHCCCCEEEEECC-----C-------C-----------CCC-CCCEEEE--------CCCCCCCHHHHHCCC-CE
T ss_conf             999999748868998523-----0-------1-----------376-5533887--------247796477762700-12


Q ss_pred             CEECCCCEEEHHHHHHHHCCCCCCEEC
Q ss_conf             000015411058888874016876452
Q gi|254780151|r  116 PCVDCNRTVKFSDLLSVTRQLGADVLA  142 (408)
Q Consensus       116 Pc~~CN~~iKF~~l~~~a~~~g~~~iA  142 (408)
                      =-++|-+.+ +.++++.|++.|++-+-
T Consensus        75 YSiRpppEl-~~~ildva~aVga~l~I  100 (129)
T COG1255          75 YSIRPPPEL-QSAILDVAKAVGAPLYI  100 (129)
T ss_pred             EECCCCHHH-HHHHHHHHHHHCCCEEE
T ss_conf             662798899-89999999860997899


No 358
>TIGR02483 PFK_mixed phosphofructokinase; InterPro: IPR012829    Members of this family that are characterised, save one, are phosphofructokinases dependent on pyrophosphate (2.7.1.90 from EC) rather than ATP (2.7.1.11 from EC). The exception is one of three phosphofructokinases from Streptomyces coelicolor. Family members are both bacterial and archaeal.; GO: 0005524 ATP binding, 0008443 phosphofructokinase activity, 0006002 fructose 6-phosphate metabolic process, 0006096 glycolysis.
Probab=25.40  E-value=47  Score=13.78  Aligned_cols=34  Identities=26%  Similarity=0.469  Sum_probs=24.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCC
Q ss_conf             9999609857999999998869-84999998704787
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSR   58 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~   58 (408)
                      .+||. ||=||.-+|..|.++| ..|+||= |+-|.+
T Consensus       109 AlIaI-GGdGTL~~A~~l~~~GGl~vVGVP-KTIDND  143 (339)
T TIGR02483       109 ALIAI-GGDGTLGIARRLADKGGLPVVGVP-KTIDND  143 (339)
T ss_pred             EEEEE-CCCCHHHHHHHHHHCCCCCEEEEC-CCCCCC
T ss_conf             89986-687268999999965898547415-775467


No 359
>pfam12396 DUF3659 Protein of unknown function (DUF3659). This domain family is found in bacteria and eukaryotes, and is approximately 70 amino acids in length.
Probab=25.39  E-value=38  Score=14.40  Aligned_cols=14  Identities=36%  Similarity=0.999  Sum_probs=6.5

Q ss_pred             CCCEECCCCCEEEE
Q ss_conf             67110377432233
Q gi|254780151|r  242 EGDIVHLNGQILGR  255 (408)
Q Consensus       242 ~G~ivd~~G~viG~  255 (408)
                      -|.|+|.+|+++|+
T Consensus        12 ~G~V~d~~G~~vGr   25 (64)
T pfam12396        12 DGNVVDKDGNVVGR   25 (64)
T ss_pred             CCEEECCCCCEEEE
T ss_conf             86098999989889


No 360
>cd03084 phosphohexomutase The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this family include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). These enzymes play important and diverse roles in carbohydrate metabolism in organisms from bacteria to humans. Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=25.33  E-value=47  Score=13.77  Aligned_cols=15  Identities=20%  Similarity=0.200  Sum_probs=6.6

Q ss_pred             EECCHHHHHHHHCCC
Q ss_conf             981707886632244
Q gi|254780151|r   88 YVFDYEERFRNAVIV  102 (408)
Q Consensus        88 ~~~d~~~~f~~~V~~  102 (408)
                      ...|+.+.|.+.+..
T Consensus        87 ~~~d~~~~Y~~~l~~  101 (355)
T cd03084          87 KAVDILQRYFEALKK  101 (355)
T ss_pred             EECCHHHHHHHHHHH
T ss_conf             514469999999987


No 361
>PRK12550 shikimate 5-dehydrogenase; Reviewed
Probab=25.31  E-value=47  Score=13.77  Aligned_cols=67  Identities=13%  Similarity=0.125  Sum_probs=33.3

Q ss_pred             CCCCEEEEEECCCHHHH---HHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             63388999960985799---999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSS---VVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSs---vaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      .|+.++.+++|+-=-|-   +-=+.+++.|.+  ++|..+              ..+|+.++....+.+++  .-+|..-
T Consensus         6 ~~~~~~~~~~~~~p~~~~~~mHN~af~~lgl~--~~Y~~~--------------~~~~l~~~i~~lr~~~~--~G~nVTi   67 (272)
T PRK12550          6 NKDTQLCISLAARPSNFGTRFHNYLYEALGLN--FLYKAF--------------TTTDLTAAIGGVRALGI--RGCAVSM   67 (272)
T ss_pred             CCCCEEEEEECCCCCCCCHHHHHHHHHHCCCC--EEEEEE--------------CHHHHHHHHHHHHHCCC--CEEEECC
T ss_conf             89986999944698867789999999987999--299863--------------78779999998875799--8899864


Q ss_pred             HHHHHCCC
Q ss_conf             86632244
Q gi|254780151|r   95 RFRNAVIV  102 (408)
Q Consensus        95 ~f~~~V~~  102 (408)
                      -|++.|+.
T Consensus        68 P~K~~i~~   75 (272)
T PRK12550         68 PFKEACIP   75 (272)
T ss_pred             CCHHHHHH
T ss_conf             36999999


No 362
>COG1231 Monoamine oxidase [Amino acid transport and metabolism]
Probab=25.26  E-value=47  Score=13.76  Aligned_cols=36  Identities=28%  Similarity=0.410  Sum_probs=24.6

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             8863388999960985799999999886984999998
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      .+++..+|+| +-+|.--..||+.|+++||+|.=+-.
T Consensus         3 ~p~~~~~vii-vGaGlaGL~AA~eL~kaG~~v~ilEa   38 (450)
T COG1231           3 LPPKTADVII-VGAGLAGLSAAYELKKAGYQVQILEA   38 (450)
T ss_pred             CCCCCCCEEE-ECCCHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             8888886899-89726888999987646818999864


No 363
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain. TST contains 2 copies of the Rhodanese Homology Domain; this is the second repeat. Only the second repeat contains the catalytically active Cys residue.
Probab=25.23  E-value=47  Score=13.76  Aligned_cols=27  Identities=26%  Similarity=0.492  Sum_probs=14.7

Q ss_pred             CHHHHHHHHHHCCCCCCCHHHCCCEEECCCC
Q ss_conf             9789899997412543551110230111277
Q gi|254780151|r  196 KKESVRDLAREMGLDIADKSDSQDICFVQQG  226 (408)
Q Consensus       196 ~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~  226 (408)
                      .+++++++-.+.|+.    +++.=|++...+
T Consensus        62 ~~~~l~~~~~~~gi~----~~~~iV~yC~sG   88 (118)
T cd01449          62 SPEELRALFAALGIT----PDKPVIVYCGSG   88 (118)
T ss_pred             CHHHHHHHHHHHCCC----CCCCEEEECCCC
T ss_conf             999999998760899----888677747998


No 364
>PRK01184 hypothetical protein; Provisional
Probab=25.23  E-value=47  Score=13.76  Aligned_cols=26  Identities=15%  Similarity=0.264  Sum_probs=17.4

Q ss_pred             EEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             9996098579--9999999886984999
Q gi|254780151|r   24 VVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus        24 ~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      +||+.||.-|  |.++-+|++.|+.|+-
T Consensus         3 iIGlTG~iGSGKstva~i~~e~G~~vi~   30 (183)
T PRK01184          3 IIIVTGMPGSGKGEFSKIARELGIPVVV   30 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             9999689988789999999977993998


No 365
>PRK00870 haloalkane dehalogenase; Provisional
Probab=24.87  E-value=48  Score=13.71  Aligned_cols=72  Identities=18%  Similarity=0.231  Sum_probs=44.8

Q ss_pred             CCCCCCEEEEEECCCHHHHH----HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             88633889999609857999----9999988698499999870478766555577881899999999999809958
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSV----VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsv----aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      .-|.+-..+|.+=|-=+|+.    .+-.|.++||.|++.-|+=+...+........+-+.-..+...+.++|||.-
T Consensus        41 ~G~~~GppvvLlHG~p~~~~~Wr~~i~~La~~GyRVIapDlrG~G~SdkP~~~~~Yt~~~~a~~l~~lld~Lgl~~  116 (302)
T PRK00870         41 EGPADGEPVLLLHGEPSWSYLYRKMIPILAAAGHRVIAPDLIGFGRSDKPTRREDYTYARHVEWMRSWFEQLDLTG  116 (302)
T ss_pred             CCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCC
T ss_conf             3789998899989999987899999999986899899936899899999998788799999999999999849985


No 366
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed
Probab=24.57  E-value=48  Score=13.67  Aligned_cols=30  Identities=27%  Similarity=0.378  Sum_probs=15.2

Q ss_pred             CCEEEEEECCCH--------H--HHHHHHHHHHCCCEEEE
Q ss_conf             388999960985--------7--99999999886984999
Q gi|254780151|r   20 DMRVVVAMSGGV--------D--SSVVAALLKRDGYDVIG   49 (408)
Q Consensus        20 ~~kV~va~SGGV--------D--Ssvaa~lL~~~G~~V~g   49 (408)
                      ++||+|.=||..        |  +.-|++-|++.||+++=
T Consensus       553 ~~kvlvlGsGp~rIGqgiEFDY~~v~a~~alk~~G~~~im  592 (1063)
T PRK05294        553 RKKVMILGGGPNRIGQGIEFDYCCVHAALALREAGYETIM  592 (1063)
T ss_pred             CCCEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             8637996577732044423006799999999965981589


No 367
>TIGR00328 flhB flagellar biosynthetic protein FlhB; InterPro: IPR006136   The flhB and flhA genes constitute an operon called flhB operon on the Salmonella typhimurium chromosome. They, together with FliI and FliH, may constitute the export apparatus of flagellin, the component protein of flagellar filament. The flhB gene encodes a highly hydrophobic polypeptide with several potential membrane-spanning segments, suggesting that it may be an integral membrane protein .; GO: 0009306 protein secretion, 0016020 membrane.
Probab=24.56  E-value=48  Score=13.67  Aligned_cols=61  Identities=21%  Similarity=0.281  Sum_probs=41.5

Q ss_pred             HHHHHCCC------CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHH
Q ss_conf             88874016------87645225--31102541267877316885315787873189863020221003342568997898
Q gi|254780151|r  129 LLSVTRQL------GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV  200 (408)
Q Consensus       129 l~~~a~~~------g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eV  200 (408)
                      .++.|++-      .||-|.|=  |||=.-.++......--.+.+|.|.-                          =--|
T Consensus       246 qr~~ar~rMm~~VPkAdVvITNPTHyAVALkY~~~~m~AP~VVAKG~D~~--------------------------AlkI  299 (352)
T TIGR00328       246 QREAARRRMMQEVPKADVVITNPTHYAVALKYDPGKMKAPVVVAKGVDEL--------------------------ALKI  299 (352)
T ss_pred             HHHHHHHHHHHHCCCCCEEEECCCEEEEEEEECCCCCCCCEEEECCCCHH--------------------------HHHH
T ss_conf             99999999987446897896376013455641488898887787788568--------------------------8999


Q ss_pred             HHHHHHCCCCCCCHH
Q ss_conf             999974125435511
Q gi|254780151|r  201 RDLAREMGLDIADKS  215 (408)
Q Consensus       201 R~~A~~~gl~~a~K~  215 (408)
                      |++|+|+|+|+-+.|
T Consensus       300 ~eiA~en~v~~~e~P  314 (352)
T TIGR00328       300 KEIAEENNVPIVENP  314 (352)
T ss_pred             HHHHHHCCCCEECCC
T ss_conf             999988691144087


No 368
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008   Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase .    There are at least two distinct cobalamin biosynthetic pathways in bacteria :  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii.     Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans.   This entry represents CbiT subunit of precorrin-6Y C5,15-methyltransferase (2.1.1.132 from EC) from the anaerobic pathway, a bifunctional enzyme that catalyses two methylations (at C-5 and C-15) in precorrin-6Y, as well as the decarboxylation of the acetate side chain located in ring C, in order to generate precorrin-8X. In the anaerobic pathway, two enzymes are required to produce precorrin-8X: CbiE and CbiT, which can be fused as CbiET (sometimes called CobL) . In the aerobic pathway, the bifunctional enzyme is CobL .; GO: 0008276 protein methyltransferase activity, 0009236 cobalamin biosynthetic process.
Probab=24.56  E-value=40  Score=14.26  Aligned_cols=11  Identities=45%  Similarity=0.558  Sum_probs=4.3

Q ss_pred             CCHHHHHHHHH
Q ss_conf             99789899997
Q gi|254780151|r  195 MKKESVRDLAR  205 (408)
Q Consensus       195 ~~K~eVR~~A~  205 (408)
                      |||.|||.++-
T Consensus         2 ~TK~EvR~l~L   12 (135)
T TIGR02469         2 MTKREVRALTL   12 (135)
T ss_pred             CCHHHHHHHHH
T ss_conf             84788999999


No 369
>COG3100 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.50  E-value=39  Score=14.29  Aligned_cols=25  Identities=16%  Similarity=0.549  Sum_probs=14.5

Q ss_pred             EEEE-CCCCCCCCEEEEEEECCHHHCE
Q ss_conf             8853-1578787318986302022100
Q gi|254780151|r  162 IMCR-PMDLERDQSYFLFATTQQQLCD  187 (408)
Q Consensus       162 ~L~r-~~D~~KDQSYfL~~l~~~~L~~  187 (408)
                      .||. =..++||||| ||--..+.+|+
T Consensus        11 mlCaIYkS~kk~~tY-LYV~krddfsr   36 (103)
T COG3100          11 MLCAIYKSPKKDGTY-LYVEKRDDFSR   36 (103)
T ss_pred             EEEEEEECCCCCCCE-EEEECHHHHHH
T ss_conf             466566067677617-88743655525


No 370
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative; InterPro: IPR011819    This family consists of proteins restricted to and found as paralogous pairs (typically close together) in species of Pyrococcus, a hyperthermophilic archaeal genus. Members are always found close to other genes of threonine biosynthesis and appear to represent the Pyrococcal form of aspartate kinase. Alignment to aspartokinase III from Escherichia coli shows that 300 N-terminal and 20 C-terminal amino acids are homologous, but the form in Pyrococcus lacks ~100 amino acids in between..
Probab=24.41  E-value=42  Score=14.09  Aligned_cols=50  Identities=18%  Similarity=0.293  Sum_probs=33.0

Q ss_pred             EEECC-HHHCEEECCCCCCCHHHHHHHHHHCCC-C-CCCHHHCCCEEECCCCCCHH
Q ss_conf             63020-221003342568997898999974125-4-35511102301112775103
Q gi|254780151|r  178 FATTQ-QQLCDLRFPLGDMKKESVRDLAREMGL-D-IADKSDSQDICFVQQGKYFD  230 (408)
Q Consensus       178 ~~l~~-~~L~~~~FPlg~~~K~eVR~~A~~~gl-~-~a~K~eSqgICFi~~~~~~~  230 (408)
                      ..||+ +.|..-|.-||++.=.++  +|+-+.+ . .+.-=+|.||-+ .+|+|.|
T Consensus        90 ~dlP~keAL~D~I~S~GE~lSA~i--faeGL~~L~i~g~~v~p~d~~~-A~G~FGn  142 (341)
T TIGR02078        90 PDLPPKEALRDYILSLGELLSAVI--FAEGLKLLGINGKVVDPWDLLV-AKGEFGN  142 (341)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHH--HHHHHHHHEECCEEECCHHHEE-EECCCCC
T ss_conf             787811223566777757899999--9701353120322765266627-7436465


No 371
>TIGR02638 lactal_redase lactaldehyde reductase; InterPro: IPR013460    The proteins in this entry form a distinct clade of iron-containing alcohol dehydrogenases. The genes encoding these proteins are generally found in apparent operons for the catabolism of rhamnose or fucose. Catabolism of both of these monosaccharides results in the production of lactaldehydes, which are reduced by these enzymes to 1,2 propanediol . These enzymes are also sometimes called 1,2 propanediol oxidoreductases. They are active under anaerobic conditions in E. coli, while being inactivated by reactive oxygen species under aerobic conditions . Under aerobic conditions the lactaldehyde product of rhamnose and fucose catabolism is believed to be oxidized to lactate by a separate enzyme, lactaldehyde dehydrogenase..
Probab=24.34  E-value=41  Score=14.15  Aligned_cols=26  Identities=31%  Similarity=0.446  Sum_probs=11.6

Q ss_pred             CCCCCCEECCCCEEEHHHHHHHHCCCCCCEE
Q ss_conf             8861200001541105888887401687645
Q gi|254780151|r  111 GETPLPCVDCNRTVKFSDLLSVTRQLGADVL  141 (408)
Q Consensus       111 G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~i  141 (408)
                      +.+|||-+.-   ||=|  ++.=++-|||||
T Consensus        65 ~v~pNPT~~~---Vk~G--~a~~~~sgaDy~   90 (380)
T TIGR02638        65 EVKPNPTITV---VKAG--VAAFKASGADYL   90 (380)
T ss_pred             CCCCCCCHHH---HHHH--HHHHHHCCCCEE
T ss_conf             7788975899---9989--999860589779


No 372
>COG0299 PurN Folate-dependent phosphoribosylglycinamide formyltransferase PurN [Nucleotide transport and metabolism]
Probab=24.21  E-value=49  Score=13.63  Aligned_cols=54  Identities=19%  Similarity=0.226  Sum_probs=32.2

Q ss_pred             CEEEEEECCCHHHHHHHHH-HHHCC---CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             8899996098579999999-98869---849999987047876655557788189999999999980995898170
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAAL-LKRDG---YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~l-L~~~G---~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      +||+|..||.= |-+-|.+ ..+.|   .+|.+++-   |..              -..+...|+..|||...++-
T Consensus         1 ~ki~VlaSG~G-SNlqaiida~~~~~~~a~i~~Vis---d~~--------------~A~~lerA~~~gIpt~~~~~   58 (200)
T COG0299           1 KKIAVLASGNG-SNLQAIIDAIKGGKLDAEIVAVIS---DKA--------------DAYALERAAKAGIPTVVLDR   58 (200)
T ss_pred             CEEEEEEECCC-CCHHHHHHHHHCCCCCCEEEEEEE---CCC--------------CCHHHHHHHHCCCCEEEECC
T ss_conf             94999994796-559999998764898817999995---797--------------77899999984998897444


No 373
>TIGR02929 anfG_nitrog Fe-only nitrogenase, delta subunit; InterPro: IPR014278   Nitrogenase, also called dinitrogenase, is the enzyme which catalyses the conversion of molecular nitrogen to ammonia (biological nitrogen fixation). The most widespread and most efficient nitrogenase contains a molybdenum cofactor. This entry, also known as the AnfG family, represents the delta subunit of the iron-only alternative nitrogenase. It is homologous to VnfG, the delta subunit of the vanadium-containing V nitrogenase..
Probab=24.20  E-value=43  Score=14.03  Aligned_cols=30  Identities=30%  Similarity=0.594  Sum_probs=21.6

Q ss_pred             EEECCHHHC---EEECC-CCCCCHHHHHHHHHHC
Q ss_conf             630202210---03342-5689978989999741
Q gi|254780151|r  178 FATTQQQLC---DLRFP-LGDMKKESVRDLAREM  207 (408)
Q Consensus       178 ~~l~~~~L~---~~~FP-lg~~~K~eVR~~A~~~  207 (408)
                      |-+.--.|+   |..|| |-+|+|+||+.+..-+
T Consensus        55 YWvdAv~La~AyK~rfPWL~~MtKdeIk~lm~aL   88 (110)
T TIGR02929        55 YWVDAVILADAYKARFPWLKDMTKDEIKALMKAL   88 (110)
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             5799999877763027643357875689999987


No 374
>PRK03892 ribonuclease P protein component 3; Provisional
Probab=24.19  E-value=49  Score=13.62  Aligned_cols=20  Identities=30%  Similarity=0.609  Sum_probs=13.5

Q ss_pred             CCCCCCCHHHHHHHHHHCCC
Q ss_conf             42568997898999974125
Q gi|254780151|r  190 FPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       190 FPlg~~~K~eVR~~A~~~gl  209 (408)
                      ||++.+.|+++|++-+++|.
T Consensus        35 ~~~~~~~ke~l~e~~~~ygk   54 (210)
T PRK03892         35 LVLDSLDKEELKELKKEYGK   54 (210)
T ss_pred             CCCCCCCHHHHHHHHHHHCE
T ss_conf             28886589999999987480


No 375
>PRK09028 cystathionine beta-lyase; Provisional
Probab=24.11  E-value=49  Score=13.61  Aligned_cols=98  Identities=11%  Similarity=0.050  Sum_probs=55.8

Q ss_pred             EEEEECCCHHHHHHH-HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             999960985799999-9998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSVVA-ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsvaa-~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      -++++|.|.--..++ .-|.++|-+|+... ..+              .-...-.+++...+||....+|..+.      
T Consensus        78 ~a~~~~SGmaAi~~~ll~ll~~Gdhiv~~~-~~Y--------------ggT~~l~~~~l~~~Gi~v~~vd~~~~------  136 (394)
T PRK09028         78 GTALYPSGAAAISNALLSFLKAGDHLLMVD-SCY--------------EPTRDLCDKILAGFGIETTYYDPMIG------  136 (394)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCEEECCC-CCC--------------CCHHHHHHHHHHHCCEEEEEECCCCH------
T ss_conf             779845999999999999847998787069-986--------------27799999888656747999579998------


Q ss_pred             CCCHHHHHCCCCCCCEE-CC----CCEEE---HHHHHHHHCCCCCCEECCCC
Q ss_conf             41126787088612000-01----54110---58888874016876452253
Q gi|254780151|r  102 VPFASSYAAGETPLPCV-DC----NRTVK---FSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~-~C----N~~iK---F~~l~~~a~~~g~~~iATGH  145 (408)
                          +++++-.+||-.+ .|    |+.++   ..++.+.|++.|+-.|+--.
T Consensus       137 ----~~~~~~i~~~Tklv~~EtpsNP~l~v~Di~~ia~iA~~~g~~~vVDNT  184 (394)
T PRK09028        137 ----EGIRELIRPNTKVLFLESPGSITMEVQDVPTLSRIAHEHDIVVMLDNT  184 (394)
T ss_pred             ----HHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEECCC
T ss_conf             ----999853687726999955899875236899999999983987996376


No 376
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase. Members of this family are the methionine salvage enzyme MnxX, a member of the HAD-superfamily hydrolases, subfamily IB (see TIGR01488). Members are found in Bacillus subtilis and related species, paired with MtnW (TIGR03332). In most species that recycle methionine from methylthioadenosine, the single protein MtnC replaces the MtnW/MtnX pair. In B. subtilis, mtnX was first known as ykrX.
Probab=24.06  E-value=49  Score=13.61  Aligned_cols=44  Identities=14%  Similarity=0.183  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCE
Q ss_conf             999999999809958981707886632244112678708861200001541
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRT  123 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~  123 (408)
                      ..+--.-|++-|||+.++.       .=++++++....+..++.-+.||+.
T Consensus        75 F~eF~~~~~~~~ip~~IvS-------~G~d~~I~~lL~~~~~~~~i~an~~  118 (214)
T TIGR03333        75 FREFVAFINEHGIPFYVIS-------GGMDFFVYPLLEGIVEKDRIYCNEA  118 (214)
T ss_pred             HHHHHHHHHHCCCCEEEEC-------CCCHHHHHHHHHHHCCCCCEEEEEE
T ss_conf             9999999998599789986-------9933899999996378766797046


No 377
>COG0469 PykF Pyruvate kinase [Carbohydrate transport and metabolism]
Probab=24.06  E-value=49  Score=13.61  Aligned_cols=64  Identities=11%  Similarity=0.295  Sum_probs=48.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEC-C
Q ss_conf             338899996098579999999988698499999870478766555577881899999999999809958981-7
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVF-D   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~-d   91 (408)
                      ++.||+.-++=-.+|-=...-|-++|-+|..+.+   ++++..+.      .+-++.+|++++.||.|.-++ |
T Consensus         5 ~kTKIVaTiGPas~s~e~l~~li~aG~nV~RlNf---SHG~~e~h------~~~i~~vR~~~~~~~~~vaIl~D   69 (477)
T COG0469           5 RKTKIVATLGPATESEEMLEKLIEAGMNVVRLNF---SHGDHEEH------KKRIDNVREAAEKLGRPVAILLD   69 (477)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHCCCCEEEEEC---CCCCHHHH------HHHHHHHHHHHHHHCCCEEEEEC
T ss_conf             6634999978987998999999970586898856---88986899------99999999999983991699975


No 378
>cd04925 ACT_ACR_2 ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the second ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=23.99  E-value=29  Score=15.28  Aligned_cols=32  Identities=34%  Similarity=0.541  Sum_probs=19.7

Q ss_pred             EEEEECCCCCCCEEEEEEEECCCCCCCHHHHHHHHHH
Q ss_conf             8999738886658887689714555303477888762
Q gi|254780151|r  364 ACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVI  400 (408)
Q Consensus       364 ~~VfY~~D~~~~~vLGGGiI~~t~~~~~~~~~~~~~~  400 (408)
                      .+|||-.|     .+.|+-|+...|-..++.....++
T Consensus        41 a~v~yvtD-----~~tG~~I~d~~Rla~I~~~L~~vl   72 (74)
T cd04925          41 ACVIYVRD-----EETGAPIDDPIRLASIEDRLDNVL   72 (74)
T ss_pred             EEEEEEEE-----CCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             99999972-----678996789899999999999975


No 379
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated
Probab=23.98  E-value=49  Score=13.60  Aligned_cols=38  Identities=32%  Similarity=0.529  Sum_probs=26.5

Q ss_pred             CCCCCCCCCCCCCEE-EEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             443467888633889-9996098579999999988698499999
Q gi|254780151|r    9 LNSLDLDKNPKDMRV-VVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus         9 ~~~~~~~~~~k~~kV-~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      ||+|++    +++++ +.|=|+|+-.++|..|+ ++|++|+.+-
T Consensus         1 m~~~~l----~gK~alITG~s~GIG~aia~~la-~~Ga~V~~~~   39 (253)
T PRK08220          1 MNSMDF----SGKTVWVTGAAQGIGYAVALAFV-EAGAKVIGFD   39 (253)
T ss_pred             CCCCCC----CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             998899----99989995885689999999999-8799999997


No 380
>COG2185 Sbm Methylmalonyl-CoA mutase, C-terminal domain/subunit (cobalamin-binding) [Lipid metabolism]
Probab=23.92  E-value=49  Score=13.59  Aligned_cols=34  Identities=38%  Similarity=0.570  Sum_probs=27.5

Q ss_pred             CCCCEEEEEECCCHHH-----HHHHHHHHHCCCEEEEEEE
Q ss_conf             6338899996098579-----9999999886984999998
Q gi|254780151|r   18 PKDMRVVVAMSGGVDS-----SVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        18 ~k~~kV~va~SGGVDS-----svaa~lL~~~G~~V~g~~m   52 (408)
                      .++.||++|-.| .|+     .+.+.+|+..|+||+-.-+
T Consensus        10 g~rprvlvak~G-lDgHd~gakvia~~l~d~GfeVi~~g~   48 (143)
T COG2185          10 GARPRVLVAKLG-LDGHDRGAKVIARALADAGFEVINLGL   48 (143)
T ss_pred             CCCCEEEEECCC-CCCCCCCHHHHHHHHHHCCCEEEECCC
T ss_conf             898669995367-654431319999999857937981587


No 381
>pfam02702 KdpD Osmosensitive K+ channel His kinase sensor domain. This is a family of KdpD sensor kinase proteins that regulate the kdpFABC operon responsible for potassium transport. The aligned region corresponds to the N-terminal cytoplasmic part of the protein which may be the sensor domain responsible for sensing turgor pressure.
Probab=23.82  E-value=50  Score=13.58  Aligned_cols=38  Identities=16%  Similarity=0.218  Sum_probs=30.6

Q ss_pred             CCCEEEEEECCCHHHHHHHH----HHHHCCCEEEEEEEECCC
Q ss_conf             33889999609857999999----998869849999987047
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAA----LLKRDGYDVIGVTLQLYN   56 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~----lL~~~G~~V~g~~m~~~~   56 (408)
                      ...||..|++-||--+.+.+    .|+++|.||+--++..+.
T Consensus         4 G~LkIylG~apGVGKTy~ML~eA~~l~~~G~DVViG~vEthg   45 (211)
T pfam02702         4 GKLKIFLGAAPGVGKTYAMLSEAHELLERGVDVVIGYVETHG   45 (211)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEECCCC
T ss_conf             616898535998778999999999999789956999953799


No 382
>KOG2731 consensus
Probab=23.58  E-value=50  Score=13.54  Aligned_cols=80  Identities=13%  Similarity=0.094  Sum_probs=45.8

Q ss_pred             CCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC---CCHHHCC
Q ss_conf             2253110254126787731688531578787318986302022100334256899789899997412543---5511102
Q gi|254780151|r  142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI---ADKSDSQ  218 (408)
Q Consensus       142 ATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~---a~K~eSq  218 (408)
                      -+||.+.-.....+++...+.++ -.+..+--.++++..+.+.+.+     ++++|-+.+.++.++-..|   -.-..|.
T Consensus       106 s~~~~v~qe~e~~~~~a~~~c~l-~~~~sd~t~~~~~s~ss~~~~~-----~e~~sv~~~r~~~KlRw~T~G~~~dw~s~  179 (378)
T KOG2731         106 SGGHFVIQEPENKKSGAPNYCLL-VNRMSDVTLQDLESVSSESDQN-----VELKSVRNHRLLPKLRWVTLGNQYDWSSK  179 (378)
T ss_pred             CCCEEEEECCCCCCCCCCCCCCC-CCCCCCCCCCCCCCCCHHHHCC-----CCCEECCCHHHHHHHCCCCCCCCCCCCCC
T ss_conf             45603554455664457532454-1323300113322323233202-----32101130020233135664644688633


Q ss_pred             CEE-ECCCCC
Q ss_conf             301-112775
Q gi|254780151|r  219 DIC-FVQQGK  227 (408)
Q Consensus       219 gIC-Fi~~~~  227 (408)
                      ++| |++..+
T Consensus       180 ~~~~~~s~k~  189 (378)
T KOG2731         180 DIFIFLSKKH  189 (378)
T ss_pred             CCCCCCCCCC
T ss_conf             4440115557


No 383
>PRK11207 tellurite resistance protein TehB; Provisional
Probab=23.55  E-value=50  Score=13.54  Aligned_cols=54  Identities=22%  Similarity=0.325  Sum_probs=36.4

Q ss_pred             CEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC---EEECCHHH
Q ss_conf             8899-99609857999999998869849999987047876655557788189999999999980995---89817078
Q gi|254780151|r   21 MRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS---HYVFDYEE   94 (408)
Q Consensus        21 ~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~---~~~~d~~~   94 (408)
                      -|++ +|-.-|-+|    .-|.++|++|+++=+                +...++.++.+|..-|++   ....|+.+
T Consensus        32 g~~LDlgcG~Grna----~~La~~G~~VtavD~----------------s~~al~~~~~~a~~~~l~~v~~~~~Dl~~   89 (198)
T PRK11207         32 GRTLDLGCGNGRNS----LYLAANGYDVTAWDK----------------NPMSIANLERIKAAENLDNLHTRVVDLNN   89 (198)
T ss_pred             CCEEEECCCCCHHH----HHHHHCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCEEEEEEECCCC
T ss_conf             74777247887869----999868985999979----------------99999999999987599824656203123


No 384
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated
Probab=23.51  E-value=50  Score=13.53  Aligned_cols=95  Identities=11%  Similarity=0.115  Sum_probs=54.2

Q ss_pred             EEEEECCCHHHHH-HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             9999609857999-999998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSV-VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsv-aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      -.+++|.|.--.. +..-|.++|-+|+...- .+     .      +   ...-...+..++||....+|..+.      
T Consensus        81 ~a~~~sSGmaAis~~ll~ll~~Gdhiv~~~~-~Y-----g------g---T~~l~~~~l~~~Gi~v~~vD~~d~------  139 (431)
T PRK08248         81 GALAVSSGQAAVTYSILNIASAGDEIVSSSS-LY-----G------G---TYNLFAHTLPKLGITVKFVDPSDP------  139 (431)
T ss_pred             CEEEECCHHHHHHHHHHHHHCCCCEEEECCC-CC-----C------C---HHHHHHHHHHCCCEEEEEECCCCH------
T ss_conf             4899546999999999997377998997278-64-----8------8---899987423238879999899775------


Q ss_pred             CCCHHHHHCCCCCCCEEC-C----CCEEE---HHHHHHHHCCCCCCEEC
Q ss_conf             411267870886120000-1----54110---58888874016876452
Q gi|254780151|r  102 VPFASSYAAGETPLPCVD-C----NRTVK---FSDLLSVTRQLGADVLA  142 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~-C----N~~iK---F~~l~~~a~~~g~~~iA  142 (408)
                          ++..+-.+||..+. |    |+.++   ..++.+.|++.|+-.+.
T Consensus       140 ----~~~~~~i~~~Tkli~~EsPsNP~l~v~Di~~ia~iA~~~g~~~vV  184 (431)
T PRK08248        140 ----ENFEAAITDKTKALFAETIGNPKGDVLDIEAVADIAHRHHIPLIV  184 (431)
T ss_pred             ----HHHHHHCCCCCEEEEEECCCCCCCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             ----779975377745999604899987422789999999776985998


No 385
>pfam10989 DUF2808 Protein of unknown function (DUF2808). This family of proteins with unknown function appears to be restricted to Cyanobacteria.
Probab=23.23  E-value=51  Score=13.50  Aligned_cols=33  Identities=15%  Similarity=0.330  Sum_probs=20.6

Q ss_pred             CCCCCEEEEE--EECCEEEEEECCCCCCCCCCEEEEEE
Q ss_conf             7887008999--82997999975972000696389997
Q gi|254780151|r  333 SQDPVPVFVQ--RNDDGVYVDFEKSEVGVASGQACVFY  368 (408)
Q Consensus       333 ~~~pvp~~i~--~~~~~~~V~f~eP~~aiAPGQ~~VfY  368 (408)
                      ..+.+|+.++  .+.+.++|.|++|   |.|||...+-
T Consensus        70 ~~~~ip~~v~~~~~~~~i~I~f~~P---V~pg~tvtv~  104 (142)
T pfam10989        70 MGEEIPAEVEVDEDGRSIEIFFAEP---VPPGTTVTVV  104 (142)
T ss_pred             CCCCCCEEEEECCCCCEEEEEECCC---CCCCCEEEEE
T ss_conf             6876360799868898899981899---8989989999


No 386
>pfam08022 FAD_binding_8 FAD-binding domain.
Probab=23.23  E-value=51  Score=13.50  Aligned_cols=21  Identities=19%  Similarity=0.120  Sum_probs=7.4

Q ss_pred             EEEEECCCC--CCCCCCEEEEEE
Q ss_conf             999975972--000696389997
Q gi|254780151|r  348 VYVDFEKSE--VGVASGQACVFY  368 (408)
Q Consensus       348 ~~V~f~eP~--~aiAPGQ~~VfY  368 (408)
                      ++|++..|.  +...|||.+-+|
T Consensus        17 ~~l~i~rp~~~~~~~pGq~vyl~   39 (103)
T pfam08022        17 VELIVSKPKKPFKYKPGQYIFIN   39 (103)
T ss_pred             EEEEEECCCCCCCCCCCCEEEEE
T ss_conf             99999889997889998399999


No 387
>pfam02784 Orn_Arg_deC_N Pyridoxal-dependent decarboxylase, pyridoxal binding domain. These pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates This domain has a TIM barrel fold.
Probab=23.18  E-value=51  Score=13.49  Aligned_cols=53  Identities=21%  Similarity=0.124  Sum_probs=27.4

Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCC
Q ss_conf             999998099589817078866322441126787088612000015411058888874016876
Q gi|254780151|r   77 RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD  139 (408)
Q Consensus        77 ~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~  139 (408)
                      -++..++|.-+.+...-|-..         ..+.|..|+..+.++ -.|=..-++.|.+.|..
T Consensus        35 l~~l~~~G~g~dv~S~~El~~---------al~~g~~~~~I~~~g-~~k~~~~i~~a~~~gv~   87 (245)
T pfam02784        35 LRLLAELGLGFDCASKGELER---------VLAAGVPPERIIFAN-PCKSRSELRYALEHGVV   87 (245)
T ss_pred             HHHHHHCCCCEEEECHHHHHH---------HHHCCCCHHHEEEEC-CCCCHHHHHHHHHHCCC
T ss_conf             999998299299989999999---------998698957889814-43546899999982776


No 388
>COG0205 PfkA 6-phosphofructokinase [Carbohydrate transport and metabolism]
Probab=23.16  E-value=51  Score=13.49  Aligned_cols=32  Identities=22%  Similarity=0.452  Sum_probs=21.8

Q ss_pred             CCEEEEEECCCHHHHH----HHHH--HHHCCCEEEEEE
Q ss_conf             3889999609857999----9999--988698499999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSV----VAAL--LKRDGYDVIGVT   51 (408)
Q Consensus        20 ~~kV~va~SGGVDSsv----aa~l--L~~~G~~V~g~~   51 (408)
                      .+||+|..|||-=.-+    .+..  +...|.+|.|+.
T Consensus         2 ~kkIaIlTSGGdaPGmNa~Iravvr~a~~~g~eV~Gi~   39 (347)
T COG0205           2 MKKIAILTSGGDAPGMNAVIRAVVRTAIKEGLEVFGIY   39 (347)
T ss_pred             CCEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             83699984688983076999999999997697899994


No 389
>PRK11508 sulfurtransferase TusE; Provisional
Probab=22.38  E-value=53  Score=13.38  Aligned_cols=34  Identities=15%  Similarity=0.200  Sum_probs=24.1

Q ss_pred             HHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC-CCCCC
Q ss_conf             99999980995898170788663224411267870-88612
Q gi|254780151|r   76 ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA-GETPL  115 (408)
Q Consensus        76 a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~-G~TPN  115 (408)
                      |+.+|+..||.     +.++-|+ |+...-+-|.+ |..|+
T Consensus        28 A~~lA~~egI~-----Lt~~HW~-VI~~lR~~Y~~~~~~P~   62 (109)
T PRK11508         28 AVVIAENEGIS-----LSPEHWE-VVRFVRDFYLEFNTSPA   62 (109)
T ss_pred             HHHHHHHCCCC-----CCHHHHH-HHHHHHHHHHHHCCCCC
T ss_conf             99999884986-----6899999-99999999999789972


No 390
>KOG3032 consensus
Probab=22.19  E-value=48  Score=13.70  Aligned_cols=32  Identities=25%  Similarity=0.405  Sum_probs=21.2

Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHH
Q ss_conf             3224411267870886120000154110588888
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS  131 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~  131 (408)
                      ..++++++..|..--. --|+.||--|| ..|.+
T Consensus        20 ~~ri~splakyn~sgq-l~C~vCn~piK-p~lW~   51 (264)
T KOG3032          20 DTRIDSPLAKYNESGQ-LVCRVCNVPIK-PSLWD   51 (264)
T ss_pred             CCCCCCHHHCCCCCCC-EEEEEECCCCC-HHHHH
T ss_conf             3111637550387898-35887467452-78899


No 391
>COG2731 EbgC Beta-galactosidase, beta subunit [Carbohydrate transport and metabolism]
Probab=22.03  E-value=52  Score=13.43  Aligned_cols=27  Identities=19%  Similarity=0.391  Sum_probs=20.1

Q ss_pred             CCCCCCCCCEEEEEECCCCCCCEEEEE
Q ss_conf             972000696389997388866588876
Q gi|254780151|r  354 KSEVGVASGQACVFYTSDSNEARVLGG  380 (408)
Q Consensus       354 eP~~aiAPGQ~~VfY~~D~~~~~vLGG  380 (408)
                      +..--+.||++|+||-+|.+.-.|-+|
T Consensus       111 e~~v~L~~G~faiFfP~e~H~P~c~~~  137 (154)
T COG2731         111 ESTVELNPGMFAIFFPGEPHRPGCNVG  137 (154)
T ss_pred             CEEEEECCCCEEEECCCCCCCCCCCCC
T ss_conf             127995799889988997656562468


No 392
>COG1377 FlhB Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=22.02  E-value=54  Score=13.33  Aligned_cols=51  Identities=27%  Similarity=0.438  Sum_probs=27.7

Q ss_pred             CCCEECCC--CCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             87645225--311025412678773168853157878731898630202210033425689978989999741254355
Q gi|254780151|r  137 GADVLATG--HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIAD  213 (408)
Q Consensus       137 g~~~iATG--HYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~  213 (408)
                      ++|.|.|-  |||=.-.++..+...-..+.+|.|..                          ---||++|+++|+|+-+
T Consensus       262 ~AdvVItNPTH~AVAlkY~~~~~~AP~VvAKG~d~~--------------------------AlkIreiA~e~~Ipi~e  314 (363)
T COG1377         262 KADVVITNPTHYAVALKYDPEKMPAPVVVAKGVDLV--------------------------ALKIREIAKEHGIPIIE  314 (363)
T ss_pred             CCCEEEECCCCEEEEEEECCCCCCCCEEEEECCCHH--------------------------HHHHHHHHHHCCCCEEC
T ss_conf             988897276611345466555589998998178699--------------------------99999999984995641


No 393
>KOG0558 consensus
Probab=21.95  E-value=54  Score=13.32  Aligned_cols=79  Identities=18%  Similarity=0.183  Sum_probs=42.6

Q ss_pred             HHHHHHHHCCCCCC---EECCCCCCCEEEE------------CCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHC-EEE
Q ss_conf             58888874016876---4522531102541------------2678773168853157878731898630202210-033
Q gi|254780151|r  126 FSDLLSVTRQLGAD---VLATGHYIRSRLY------------VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC-DLR  189 (408)
Q Consensus       126 F~~l~~~a~~~g~~---~iATGHYar~~~~------------~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~-~~~  189 (408)
                      -.+....|++.|+|   -.+||.--|+-..            ..+... .-+...+.+..++-+|       ..|. ...
T Consensus       174 TPaVRrlA~e~~idla~v~gtGKdGRvLKeDvL~fl~q~pg~~~~~~~-~~~a~~~~~~ps~~a~-------~~~~~Dkt  245 (474)
T KOG0558         174 TPAVRRLAKENGIDLAEVTGTGKDGRVLKEDVLRFLGQVPGFVTDPSP-SEHAVIPGPSPSTKAS-------SNLEADKT  245 (474)
T ss_pred             CHHHHHHHHHHCCCEEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCC-CEEECCCCCCCCCCCC-------CCCCCCCE
T ss_conf             788999999709765861036878734378899874448987569997-6022179999765556-------76643451


Q ss_pred             CCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             42568997898999974125435
Q gi|254780151|r  190 FPLGDMKKESVRDLAREMGLDIA  212 (408)
Q Consensus       190 FPlg~~~K~eVR~~A~~~gl~~a  212 (408)
                      -||..++|.-|+.+-+.+.+|-.
T Consensus       246 ~plrGf~rAMvKtMt~alkiPHF  268 (474)
T KOG0558         246 VPLRGFSRAMVKTMTEALKIPHF  268 (474)
T ss_pred             EECHHHHHHHHHHHHHHHCCCCC
T ss_conf             21234789999998887458854


No 394
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892    Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by IPR003136 from INTERPRO.; GO: 0004127 cytidylate kinase activity, 0005524 ATP binding, 0006139 nucleobase nucleoside nucleotide and nucleic acid metabolic process.
Probab=21.90  E-value=39  Score=14.34  Aligned_cols=34  Identities=15%  Similarity=0.321  Sum_probs=16.1

Q ss_pred             CCEECCCCEEEHHHHHHHHCCCC--------CCEECC--CCCCCEEE
Q ss_conf             20000154110588888740168--------764522--53110254
Q gi|254780151|r  115 LPCVDCNRTVKFSDLLSVTRQLG--------ADVLAT--GHYIRSRL  151 (408)
Q Consensus       115 NPc~~CN~~iKF~~l~~~a~~~g--------~~~iAT--GHYar~~~  151 (408)
                      ||+|.  +.| =..+.|.|.+.+        +-|++.  |.||-+..
T Consensus        54 ~~eID--k~i-D~~~~E~A~~~~nvvlEsrlagW~~~~nG~yaD~~i   97 (173)
T TIGR02173        54 NPEID--KKI-DRRIREIAEKEKNVVLESRLAGWILKKNGEYADVKI   97 (173)
T ss_pred             CCCCC--HHH-HHHHHHHHCCCCCEEEEEHHHHHHCCCCCCCCCEEE
T ss_conf             86311--675-378855430489668852054331157889675678


No 395
>COG4122 Predicted O-methyltransferase [General function prediction only]
Probab=21.71  E-value=34  Score=14.77  Aligned_cols=36  Identities=17%  Similarity=0.303  Sum_probs=27.6

Q ss_pred             HHHCCCEEEC--CCCCCHHHHHHCCCCCCCCCCEECCCC
Q ss_conf             1110230111--277510345530766434671103774
Q gi|254780151|r  214 KSDSQDICFV--QQGKYFDVVKRINAGIALEGDIVHLNG  250 (408)
Q Consensus       214 K~eSqgICFi--~~~~~~~Fl~~~~~~~~~~G~ivd~~G  250 (408)
                      ..+|.|++||  .+.+|.+|+..+++- .+||-++-.|.
T Consensus       129 ~~~~fDliFIDadK~~yp~~le~~~~l-Lr~GGliv~DN  166 (219)
T COG4122         129 LDGSFDLVFIDADKADYPEYLERALPL-LRPGGLIVADN  166 (219)
T ss_pred             CCCCCCEEEEECCHHHCHHHHHHHHHH-HCCCCEEEEEE
T ss_conf             478856899837843599999999997-37896899830


No 396
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=21.68  E-value=54  Score=13.29  Aligned_cols=28  Identities=36%  Similarity=0.531  Sum_probs=24.0

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             9996098579999999988698499999
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +|-+=||.-..+||++|.++|++|.-+=
T Consensus         6 vvVIGaG~~GL~aAa~LA~~G~~V~VlE   33 (487)
T COG1233           6 VVVIGAGLNGLAAAALLARAGLKVTVLE   33 (487)
T ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             9998988789999999996899799996


No 397
>TIGR01125 TIGR01125 MiaB-like tRNA modifying enzyme YliG, TIGR01125; InterPro: IPR005840   This is a family of mainly hypothetical proteins of unknown function. .
Probab=21.64  E-value=55  Score=13.28  Aligned_cols=20  Identities=40%  Similarity=0.561  Sum_probs=18.1

Q ss_pred             CHHHHHHHHHHHHCCCEEEE
Q ss_conf             85799999999886984999
Q gi|254780151|r   30 GVDSSVVAALLKRDGYDVIG   49 (408)
Q Consensus        30 GVDSsvaa~lL~~~G~~V~g   49 (408)
                      =|||=+-+-.|+++||||+.
T Consensus        13 lvDSE~~Lg~L~~~Gye~~~   32 (475)
T TIGR01125        13 LVDSEVLLGKLREAGYEVTP   32 (475)
T ss_pred             HHHHHHHHHHHHHCCEEEEC
T ss_conf             56699999888545844306


No 398
>KOG3467 consensus
Probab=21.57  E-value=38  Score=14.37  Aligned_cols=40  Identities=18%  Similarity=0.334  Sum_probs=28.2

Q ss_pred             CCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCC-CCCHHHHHHCC
Q ss_conf             5689978989999741254355111023011127-75103455307
Q gi|254780151|r  192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQ-GKYFDVVKRIN  236 (408)
Q Consensus       192 lg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~-~~~~~Fl~~~~  236 (408)
                      +-.+||+.||.+|+.-|..     .--|.||-+- +-++.||++-+
T Consensus        27 IqgitKpaIRRlARr~GVk-----Ri~G~~yeE~~~~~k~fl~n~i   67 (103)
T KOG3467          27 IQGITKPAIRRLARRGGVK-----RISGLIYEETRGVLKVFLENVI   67 (103)
T ss_pred             CCCCCHHHHHHHHHHCCCH-----HHCCHHHHHHHHHHHHHHHHHH
T ss_conf             0354318999999852801-----2210558999899999999999


No 399
>COG1565 Uncharacterized conserved protein [Function unknown]
Probab=21.56  E-value=10  Score=18.53  Aligned_cols=20  Identities=10%  Similarity=0.248  Sum_probs=8.0

Q ss_pred             CHHHHHHHHCCCCCHHHHHC
Q ss_conf             70788663224411267870
Q gi|254780151|r   91 DYEERFRNAVIVPFASSYAA  110 (408)
Q Consensus        91 d~~~~f~~~V~~~~~~~y~~  110 (408)
                      .++..|-+-|-..|++.+.+
T Consensus        53 els~lFGella~~~~~~wq~   72 (370)
T COG1565          53 ELSQLFGELLAEQFLQLWQE   72 (370)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
T ss_conf             26889999999999999998


No 400
>pfam03180 Lipoprotein_9 NLPA lipoprotein. This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence. Their precise function is unknown. However they are probably distantly related to pfam00497 which are solute binding proteins.
Probab=21.39  E-value=55  Score=13.25  Aligned_cols=62  Identities=15%  Similarity=0.211  Sum_probs=42.9

Q ss_pred             CCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCC-----EECCCCEEEHHHHHHHHCCCCCCEEC
Q ss_conf             8189999999999980995898170788663224411267870886120-----00015411058888874016876452
Q gi|254780151|r   68 CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLP-----CVDCNRTVKFSDLLSVTRQLGADVLA  142 (408)
Q Consensus        68 ~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNP-----c~~CN~~iKF~~l~~~a~~~g~~~iA  142 (408)
                      +..+-|+.++..+++-||.+.++.|++-                .+||.     ++..|-+=--..|-.+.++.|.+.++
T Consensus         9 p~~~i~~~v~~~~~~~Gi~veiv~F~Dy----------------~~pN~AL~~GeIDaN~fQH~~yl~~~n~~~g~~L~~   72 (236)
T pfam03180         9 PHAEVLEVAKPLAKKKGLDLEIVEFTDY----------------VQPNTALADGEIDANAFQHLPYLDQFNKEGGLDLVA   72 (236)
T ss_pred             CHHHHHHHHHHHHHHCCCEEEEEEECCC----------------CCHHHHHHCCCCCHHHHCCHHHHHHHHHHCCCCEEE
T ss_conf             7699999999999964987999981686----------------455079778995524443899999999977996799


Q ss_pred             CCC
Q ss_conf             253
Q gi|254780151|r  143 TGH  145 (408)
Q Consensus       143 TGH  145 (408)
                      -|.
T Consensus        73 v~~   75 (236)
T pfam03180        73 VGN   75 (236)
T ss_pred             EEE
T ss_conf             630


No 401
>PRK06483 short chain dehydrogenase; Provisional
Probab=21.36  E-value=55  Score=13.24  Aligned_cols=30  Identities=17%  Similarity=0.203  Sum_probs=22.7

Q ss_pred             CEEE-EEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899-996098579999999988698499999
Q gi|254780151|r   21 MRVV-VAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +.|+ .|=|+|+-.++|-.|+ ++|++|+...
T Consensus         3 ktVlVTGas~GIG~aiA~~la-~~Ga~Vvi~~   33 (236)
T PRK06483          3 APILITGAGQRIGLALAKHLL-AQGQPVIVSY   33 (236)
T ss_pred             CEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             879997899889999999999-8899899995


No 402
>pfam10288 DUF2392 Protein of unknown function (DUF2392). This is a family of proteins conserved from plants to humans. The function is not known. It carries a characteristic GRG sequence motif.
Probab=21.29  E-value=50  Score=13.53  Aligned_cols=25  Identities=16%  Similarity=0.183  Sum_probs=21.9

Q ss_pred             EEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             0334256899789899997412543
Q gi|254780151|r  187 DLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       187 ~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      ++++||.++.+.||...+.-.++..
T Consensus        32 ~~~~PLRD~l~~Ei~~Y~~~~~l~~   56 (104)
T pfam10288        32 KILRPLRDLLLKEIEAYCSLKNLPP   56 (104)
T ss_pred             EEEEEHHHHHHHHHHHHHHHHCCCH
T ss_conf             4773758856999999999808740


No 403
>pfam05579 Peptidase_S32 Equine arteritis virus serine endopeptidase S32. Serine peptidases involved in processing nidovirus polyprotein.
Probab=21.28  E-value=50  Score=13.55  Aligned_cols=29  Identities=24%  Similarity=0.437  Sum_probs=17.6

Q ss_pred             CEECCCCCEEEEECCC-----EEEEECCCCCCCC
Q ss_conf             1103774322335783-----1531023343356
Q gi|254780151|r  244 DIVHLNGQILGRHNGI-----INYTIGQRRGLGV  272 (408)
Q Consensus       244 ~ivd~~G~viG~H~G~-----~~yTIGQRkGL~i  272 (408)
                      ++|+++|+++|-|.|.     -.+|--..+-+++
T Consensus        99 pVi~e~g~lvGVHTGSnk~Gsg~vTTp~G~t~~~  132 (426)
T pfam05579        99 PVITEDGNLVGVHTGSNKRGSGMVTTPSGKTLGM  132 (426)
T ss_pred             CCCCCCCCEEEEECCCCCCCCEEEECCCCCCCCC
T ss_conf             5377899789886268876743688899836166


No 404
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed
Probab=21.28  E-value=55  Score=13.23  Aligned_cols=41  Identities=20%  Similarity=0.344  Sum_probs=31.4

Q ss_pred             CCCEECCCCCEEEEECCCEEEEECCCCCCCCCCCCCCEEEE
Q ss_conf             67110377432233578315310233433565778613763
Q gi|254780151|r  242 EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVY  282 (408)
Q Consensus       242 ~G~ivd~~G~viG~H~G~~~yTIGQRkGL~i~~~eP~YVv~  282 (408)
                      +|.|+++--.-+....|..-|.---.+|..+.+..-.||..
T Consensus       186 ~~~iiNiH~s~lp~f~G~~~~~~a~~~gvk~~G~T~H~v~~  226 (285)
T PRK06027        186 PGRIINIHHSFLPAFKGAKPYHQAYERGVKLIGATAHYVTE  226 (285)
T ss_pred             CCCEEEECHHHCCCCCCCCHHHHHHHCCCCEECCCEEEECC
T ss_conf             17647845112257999877999998499573674588057


No 405
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases. Phosphatidylinositol glycan-class A (PIG-A), an X-linked gene in humans, is necessary for the synthesis of N-acetylglucosaminyl-phosphatidylinositol, a very early intermediate in glycosyl phosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is an important cellular structure that facilitates the attachment of many proteins to cell surfaces. Somatic mutations in PIG-A have been associated with Paroxysmal Nocturnal Hemoglobinuria (PNH), an acquired hematological disorder.
Probab=21.19  E-value=56  Score=13.22  Aligned_cols=24  Identities=29%  Similarity=0.498  Sum_probs=19.3

Q ss_pred             CCHHHHHHHH--HHHHCCCEEEEEEE
Q ss_conf             9857999999--99886984999998
Q gi|254780151|r   29 GGVDSSVVAA--LLKRDGYDVIGVTL   52 (408)
Q Consensus        29 GGVDSsvaa~--lL~~~G~~V~g~~m   52 (408)
                      ||+-+.+...  -|.+.||+|+-++.
T Consensus        14 GG~e~~v~~La~~L~~~Gh~V~Vit~   39 (398)
T cd03796          14 GGVETHIYQLSQCLIKRGHKVVVITH   39 (398)
T ss_pred             CCHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             97799999999999976998999968


No 406
>pfam04355 SmpA_OmlA SmpA / OmlA family. Lipoprotein Bacterial outer membrane lipoprotein, possibly involved in in maintaining the structural integrity of the cell envelope. Lipid attachment site is a conserved N terminal cysteine residue. Sometimes found adjacent to the OmpA domain (pfam00691).
Probab=21.18  E-value=51  Score=13.48  Aligned_cols=22  Identities=45%  Similarity=0.573  Sum_probs=13.4

Q ss_pred             ECCHHHCEEECCCCCCCHHHHHHHH
Q ss_conf             0202210033425689978989999
Q gi|254780151|r  180 TTQQQLCDLRFPLGDMKKESVRDLA  204 (408)
Q Consensus       180 l~~~~L~~~~FPlg~~~K~eVR~~A  204 (408)
                      ++++.|+++-  .| |+|++|+.+.
T Consensus         4 ~~~~~l~~l~--~G-mtk~QV~~lL   25 (71)
T pfam04355         4 VTQEDVDQLK--PG-MTKEQVRYLL   25 (71)
T ss_pred             CCHHHHHHCC--CC-CCHHHHHHHC
T ss_conf             8999997517--99-9999999870


No 407
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional
Probab=21.13  E-value=56  Score=13.21  Aligned_cols=12  Identities=8%  Similarity=0.326  Sum_probs=6.3

Q ss_pred             HHHHHHHHCCCC
Q ss_conf             989999741254
Q gi|254780151|r  199 SVRDLAREMGLD  210 (408)
Q Consensus       199 eVR~~A~~~gl~  210 (408)
                      .+-+.+++.|+.
T Consensus        86 NLLeV~eraGI~   97 (297)
T PTZ00305         86 NLLEVLEREGIR   97 (297)
T ss_pred             CHHHHHHHCCCC
T ss_conf             099999985997


No 408
>cd07062 Peptidase_S66_mccF_like Microcin C7 self-immunity protein determines resistance to exogenous microcin C7. Microcin C7 self-immunity protein (mccF): MccF, a homolog of the LD-carboxypeptidase family, mediates resistance against exogenously added microcin C7 (MccC7), a ribosomally-encoded peptide antibiotic that contains a phosphoramidate linkage to adenosine monophosphate at its C-terminus. The plasmid-encoded mccF gene is transcribed in the opposite direction to the other five genes (mccA-E) and is required for the full expression of immunity but not for production. The catalytic triad residues (Ser, His, Glu) of LD-carboxypeptidase are also conserved in MccF, strongly suggesting that MccF shares the hydrolytic activity with LD-carboxypeptidases. Substrates of MccF have not been deduced, but could likely be microcin C7 precursors. The possible role of MccF is to defend producer cells against exogenous microcin from re-entering after having been exported.  It is suggested that M
Probab=21.12  E-value=56  Score=13.21  Aligned_cols=27  Identities=26%  Similarity=0.427  Sum_probs=19.9

Q ss_pred             EEEEECCCHHHH------HHHHHHHHCCCEEEE
Q ss_conf             999960985799------999999886984999
Q gi|254780151|r   23 VVVAMSGGVDSS------VVAALLKRDGYDVIG   49 (408)
Q Consensus        23 V~va~SGGVDSs------vaa~lL~~~G~~V~g   49 (408)
                      -+||-|+|++-.      .+...|++.||+|+-
T Consensus         4 ~ivAPSs~~~~~~~~~~~~~~~~L~~~G~~v~~   36 (308)
T cd07062           4 AVVSPSSGIPGELPHRLERAKKRLENLGFEVVE   36 (308)
T ss_pred             EEEECCCCCCCCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             999689877642599999999999969998987


No 409
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor. N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs).
Probab=21.10  E-value=56  Score=13.21  Aligned_cols=108  Identities=15%  Similarity=0.110  Sum_probs=58.8

Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             6555444346788863388999960985799999999886-984999998704787665555778818999999999998
Q gi|254780151|r    4 SEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT   82 (408)
Q Consensus         4 ~~~~~~~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~   82 (408)
                      ++|-|++...+....-..---|-.----||--+...+.++ .--|.++|=              ..+.....-++.+|+.
T Consensus        14 ~~aFr~a~~~~~~~~~~L~~~v~~v~~~DSF~~s~~~C~ll~~GV~AIfG--------------pss~~s~~~vqSicd~   79 (370)
T cd06389          14 YSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFG--------------FYDKKSVNTITSFCGT   79 (370)
T ss_pred             HHHHHHHHHHCCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEC--------------CCCHHHHHHHHHHHCC
T ss_conf             99999999861368867875678848999289999999988519589999--------------8987899999987188


Q ss_pred             CCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEEC
Q ss_conf             099589817078866322441126787088612000015411058888874016876452
Q gi|254780151|r   83 INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA  142 (408)
Q Consensus        83 LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iA  142 (408)
                      ++|||....+..+..        ..|  -..+.|++.       .++.+..+.++...++
T Consensus        80 ~~IPhI~~~~~~~~~--------~~~--~i~l~P~l~-------~A~~dlv~~~~W~~f~  122 (370)
T cd06389          80 LHVSFITPSFPTDGT--------HPF--VIQMRPDLK-------GALLSLIEYYQWDKFA  122 (370)
T ss_pred             CCCCCEECCCCCCCC--------CCC--EEECCCCHH-------HHHHHHHHHCCCCEEE
T ss_conf             889844213677888--------761--586477689-------9999999967987899


No 410
>TIGR01283 nifE nitrogenase MoFe cofactor biosynthesis protein NifE; InterPro: IPR005973    The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges. All known Mo-nitrogenases consist of two components, component I (also called dinitrogenase, or Fe-Mo protein), an alpha2beta2 tetramer encoded by the nifD and nifK genes, and component II (dinitrogenase reductase, or Fe protein) a homodimer encoded by the nifH gene. Two operons, nifDK and nifEN, encode a tetrameric (alpha2beta2 and N2E2) enzymatic complex. Nitrogenase contains two unusual rare metal clusters; one of them is the iron molybdenum cofactor (FeMo-co), which is considered to be the site of dinitrogen reduction and whose biosynthesis requires the products of nifNE and of some other nif genes. It has been proposed that NifNE might serve as a scaffold upon which FeMo-co is built and then inserted into component I. ; GO: 0005515 protein binding, 0006461 protein complex assembly, 0009399 nitrogen fixation.
Probab=21.07  E-value=56  Score=13.20  Aligned_cols=26  Identities=12%  Similarity=0.323  Sum_probs=16.4

Q ss_pred             CCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             88189999999999980995898170
Q gi|254780151|r   67 CCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        67 c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      .||..-+..|+++-++.|||+...+|
T Consensus       262 ~CSks~~nlA~~m~~~YGIPyf~~SF  287 (470)
T TIGR01283       262 QCSKSMINLARKMEEKYGIPYFEVSF  287 (470)
T ss_pred             ECCHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             75236788999999646897587214


No 411
>KOG0337 consensus
Probab=21.07  E-value=56  Score=13.20  Aligned_cols=98  Identities=22%  Similarity=0.246  Sum_probs=53.5

Q ss_pred             EEEEE----CCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCC
Q ss_conf             68853----15787873189863020221003342568997898999974125435511102301112775103455307
Q gi|254780151|r  161 RIMCR----PMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRIN  236 (408)
Q Consensus       161 ~~L~r----~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~  236 (408)
                      +.|.|    ..=...+|..|++.=+.+..+.++-=|++.-|                  +-|+|-|++.+...++++..+
T Consensus       220 p~lVRldvetkise~lk~~f~~~~~a~K~aaLl~il~~~~~------------------~~~t~vf~~tk~hve~~~~ll  281 (529)
T KOG0337         220 PVLVRLDVETKISELLKVRFFRVRKAEKEAALLSILGGRIK------------------DKQTIVFVATKHHVEYVRGLL  281 (529)
T ss_pred             CCEEEEEHHHHCCHHHHHHEEEECCHHHHHHHHHHHHCCCC------------------CCCEEEEECCCCHHHHHHHHH
T ss_conf             71687401421054545142230617889999999851256------------------665069831530478988789


Q ss_pred             CCCCCCCCEE----CCCCCE------EEEECCCEEEEECCCCCCCCCCCC
Q ss_conf             6643467110----377432------233578315310233433565778
Q gi|254780151|r  237 AGIALEGDIV----HLNGQI------LGRHNGIINYTIGQRRGLGVAMGE  276 (408)
Q Consensus       237 ~~~~~~G~iv----d~~G~v------iG~H~G~~~yTIGQRkGL~i~~~e  276 (408)
                      -..--.+..+    |.++..      =+.-.++.-.|=+--+|++||+.+
T Consensus       282 ~~~g~~~s~iysslD~~aRk~~~~~F~~~k~~~lvvTdvaaRG~diplld  331 (529)
T KOG0337         282 RDFGGEGSDIYSSLDQEARKINGRDFRGRKTSILVVTDVAARGLDIPLLD  331 (529)
T ss_pred             HHCCCCCCCCCCCCCHHHHHHCCCCCCCCCCCEEEEEHHHHCCCCCCCCC
T ss_conf             86398744111445867665042034677552599842333358876544


No 412
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=21.05  E-value=42  Score=14.13  Aligned_cols=12  Identities=8%  Similarity=0.147  Sum_probs=4.0

Q ss_pred             HHHHHHHHHHCC
Q ss_conf             999999999809
Q gi|254780151|r   73 VYDARRVCDTIN   84 (408)
Q Consensus        73 ~~~a~~va~~Lg   84 (408)
                      ++.+++-++++|
T Consensus        78 ~~~~~~N~~kfg   89 (198)
T PRK00377         78 VELTKKNAEKFG   89 (198)
T ss_pred             HHHHHHHHHHCC
T ss_conf             999999999809


No 413
>pfam05023 Phytochelatin Phytochelatin synthase. Phytochelatin synthase is the enzyme responsible for the synthesis of heavy-metal-binding peptides (phytochelatins) from glutathione and related thiols. The crystal structure of a member of this family shows it to possess a papain fold. The enzyme catalyses the deglycination of a GSH donor molecule. The enzyme contains a catalytic triad of cysteine, histidine and aspartate residues.
Probab=21.01  E-value=53  Score=13.35  Aligned_cols=84  Identities=14%  Similarity=0.107  Sum_probs=47.9

Q ss_pred             CCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCC
Q ss_conf             73189863020221003342568997898999974125435511102301112775103455307664346711037743
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ  251 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~  251 (408)
                      +|+-+++-.+.+...+     ..+|=+|+-.+|+-.|+.+-...-++    ..-..|++.+++-+.. +..--||+-+.+
T Consensus        75 te~~l~~~~~~e~v~~-----~GiTL~e~~~la~~~g~~~~~~~~~~----~s~~~FR~~v~~~~~~-~~~~vivny~R~  144 (208)
T pfam05023        75 TQDNLDCCIPLEKVKK-----QGITLDELSCLAKCNGAVVKTFHASD----LSLDEFRKHLIRCLND-DGRFVIVNYDRK  144 (208)
T ss_pred             CHHHHCCCCCHHHHHH-----CCCCHHHHHHHHHHCCCEEEEEECCC----CCHHHHHHHHHHHHCC-CCCEEEEECCCH
T ss_conf             5446413677999987-----29579999999985798269997786----9899999999998389-997899977514


Q ss_pred             EEEEECCCEEEEEC
Q ss_conf             22335783153102
Q gi|254780151|r  252 ILGRHNGIINYTIG  265 (408)
Q Consensus       252 viG~H~G~~~yTIG  265 (408)
                      .+|+.-|-|+--||
T Consensus       145 ~lgQtG~GHfSPIg  158 (208)
T pfam05023       145 AIGQTGGGHFSPIG  158 (208)
T ss_pred             HHCCCCCCCCCCCC
T ss_conf             31777887526310


No 414
>TIGR02025 BchH magnesium chelatase, H subunit; InterPro: IPR011771    This entry represents the H subunit of the magnesium chelatase complex responsible for magnesium insertion into the protoporphyrin IX ring in the biosynthesis of both chlorophyll and bacteriochlorophyll. In chlorophyll-utilizing species, this gene is known as ChlH, while in bacteriochlorophyll-utilizing spoecies it is called BchH. Subunit H is the largest (~140kDa) of the three subunits (the others being BchD/ChlD and BchI/ChlI), and is known to bind protoporphyrin IX. Subunit H is homologous to the CobN subunit of cobaltochelatase and by anology with that enzyme, subunit H is believed to also bind the magnesium ion which is inserted into the ring. In conjunction with the hydrolysis of ATP by subunits I and D, a conformation change is believed to happen in subunit H causing the magnesium ion insertion into the distorted protoporphyrin ring .; GO: 0016851 magnesium chelatase activity, 0015995 chlorophyll biosynthetic process.
Probab=20.98  E-value=50  Score=13.59  Aligned_cols=69  Identities=22%  Similarity=0.214  Sum_probs=37.7

Q ss_pred             CCCEEEEEECCCHHHHHHHH--HHHH------C----CCE-------EEEEEEECCCCCCCCCCCCCCCCH-HHHHHHHH
Q ss_conf             33889999609857999999--9988------6----984-------999998704787665555778818-99999999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAA--LLKR------D----GYD-------VIGVTLQLYNSRKASKRKGSCCAG-QDVYDARR   78 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~--lL~~------~----G~~-------V~g~~m~~~~~~~~~~~~~~c~~~-~d~~~a~~   78 (408)
                      +...|+.++|+|||+.++.-  +.++      |    |-+       |-+|.=-+..  ...-.+..-..+ ...+.|.+
T Consensus       295 ~Gl~v~p~f~~Gld~~~~v~~ff~~~yefqqrqiGni~~~~~~~~~~vDavvs~~GF--sLVGGPA~~~~~G~~~E~A~~  372 (1384)
T TIGR02025       295 KGLQVVPAFAGGLDFRKAVEDFFMKDYEFQQRQIGNISTESLEEAEKVDAVVSLTGF--SLVGGPAGSDAAGRAVEAAVE  372 (1384)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCHHCEEEECCCC--CCCCCCCCCCCHHHHHHHHHH
T ss_conf             699278888657366323454023135554432023467653410020444631135--777898888721358999999


Q ss_pred             HHHHCCCCEEE
Q ss_conf             99980995898
Q gi|254780151|r   79 VCDTINVSHYV   89 (408)
Q Consensus        79 va~~LgI~~~~   89 (408)
                      |=+.|++|+..
T Consensus       373 iL~~ldVPY~~  383 (1384)
T TIGR02025       373 ILKKLDVPYIV  383 (1384)
T ss_pred             HHHHCCCCEEE
T ss_conf             87415883032


No 415
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084   Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast). The allophanate hydrolase domain of the yeast enzyme is not included in this entry and is represented by an adjacent gene in Oleomonas sagaranensis. The fusion of urea carboxylase and allophanate hydrolase is designated urea amidolyase. The enzyme from O. sagaranensis was shown to be highly active on acetamide and formamide as well as urea..
Probab=20.95  E-value=36  Score=14.54  Aligned_cols=56  Identities=30%  Similarity=0.481  Sum_probs=35.1

Q ss_pred             CCCCCEECCCCEEEHHHHHHHHCCCCC--CEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCE
Q ss_conf             861200001541105888887401687--6452253110254126787731688531578787318986302022100
Q gi|254780151|r  112 ETPLPCVDCNRTVKFSDLLSVTRQLGA--DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD  187 (408)
Q Consensus       112 ~TPNPc~~CN~~iKF~~l~~~a~~~g~--~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~  187 (408)
                      +||.|..-=.-+   ..|++.|.+||.  .|-.-|.   +++           +   -|..+|+=|||=-=++-|-++
T Consensus       239 ETPAP~LP~~~R---~~L~~AA~~Lg~~V~YrSAGT---VEF-----------i---YD~~~d~FYFLEVNTRLQVEH  296 (1226)
T TIGR02712       239 ETPAPNLPEETR---AALLAAAEKLGEAVNYRSAGT---VEF-----------I---YDEARDEFYFLEVNTRLQVEH  296 (1226)
T ss_pred             ECCCCCCCHHHH---HHHHHHHHHHHHHHCCCCCCE---EEE-----------E---ECCCCCCEEEEEECCCCCCCC
T ss_conf             277468648999---999999999999718763760---477-----------4---022108712113234111335


No 416
>TIGR03342 dsrC_tusE_dsvC sulfur relay protein, TusE/DsrC/DsvC family. Members of this protein family may be described as TusE, a partner to TusBCD in a sulfur relay system for 2-thiouridine biosynthesis, a tRNA base modification process. Other members are DsrC, a functionally similar protein in species where the sulfur relay system exists primarily for sulfur metabolism rather than tRNA base modification. Some members of this family are known explicitly as the gamma subunit of sulfite reductases.
Probab=20.94  E-value=56  Score=13.18  Aligned_cols=35  Identities=20%  Similarity=0.236  Sum_probs=24.0

Q ss_pred             HHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC-CCCCC
Q ss_conf             999999980995898170788663224411267870-88612
Q gi|254780151|r   75 DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA-GETPL  115 (408)
Q Consensus        75 ~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~-G~TPN  115 (408)
                      -|+.+|+..||.     +.++-|+ |+..+-+-|.. |.+|+
T Consensus        26 vA~~lA~~egI~-----Lt~~HW~-vI~~lR~~y~~~~~~P~   61 (108)
T TIGR03342        26 VAEALAEEEGIE-----LTEEHWE-VINFLRDFYAEYNISPA   61 (108)
T ss_pred             HHHHHHHHCCCC-----CCHHHHH-HHHHHHHHHHHHCCCCC
T ss_conf             999999883986-----6899999-99999999999789983


No 417
>pfam01301 Glyco_hydro_35 Glycosyl hydrolases family 35.
Probab=20.90  E-value=56  Score=13.18  Aligned_cols=50  Identities=10%  Similarity=0.076  Sum_probs=30.7

Q ss_pred             HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             999886984999998704787665555778818999999999998099589
Q gi|254780151|r   38 ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHY   88 (408)
Q Consensus        38 ~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~   88 (408)
                      .-+|..|++++..++ .|+..+..+..=--....|+...-++|++.|+-..
T Consensus        31 ~K~KA~GlN~V~tYv-~Wn~HE~~~G~~dF~G~~Dl~~Fl~la~~~GL~Vi   80 (317)
T pfam01301        31 QKAKALGLNTIETYV-FWNLHEPEPGQYDFSGILDLVKFIKLAQEAGLYVI   80 (317)
T ss_pred             HHHHHCCCCEEEEEC-CCCCCCCCCCEECCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             999973997899855-76345897884012356789999999998698799


No 418
>TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase; InterPro: IPR010210   This entry represents a clade of primarily archaeal sequences related to fructose-bisphosphate aldolase. The members appear to be phospho-2-dehydro-3-deoxyheptonate aldolases. This enzyme is the first step of the chorismate biosynthesis pathway. Evidence for this assignment is based on gene clustering and phylogenetic profiling. A group of species lack members of the three other types of phospho-2-dehydro-3-deoxyheptonate aldolase (represented by IPR006219 from INTERPRO, IPR002480 from INTERPRO and IPR006268 from INTERPRO), and also apparently lack the well-known forms of step 2 (3-dehydroquinate synthase), but contain all other steps of the pathway: Aquifex, Archaeoglobus, Halobacterium, Methanococcus, Methanopyrus and Methanobacterium. In Aquifex, Archaeoglobus, Halobacterium, Methanopyrus and Methanosarcina the genes are clustered with other genes from the chorismate, phenylalanine, tyrosine and tryptophan biosynthesis pathways. In addition, these genes in Archaeoglobus, Halobacterium, and Methanosarcina are adjacent to 3-dehydroquinate synthase (IPR002812 from INTERPRO) which also has the property of having members only in those species which lack steps 1 and 2. Together these two genes appear to perform the synthesis of 3-dehydroquinate. It is presumed that the substrates and the chemical transformations involved are identical, but this has not yet been proven experimentally..
Probab=20.82  E-value=57  Score=13.17  Aligned_cols=104  Identities=20%  Similarity=0.283  Sum_probs=60.9

Q ss_pred             CCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             44434678886338899996098579999999988698499999870478766555577881899999999999809958
Q gi|254780151|r    8 RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus         8 ~~~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      -||.+..-.|..++|.+++   -|.-++      +.|=|-+.+|+-..++.+..       .-+++-+.-.+|+.+|||+
T Consensus        76 HLsAST~L~P~p~~K~~~~---tVE~Ai------~~GADAVS~HvNvGs~~e~d-------~~~~lg~vA~~ad~~GvPl  139 (259)
T TIGR01949        76 HLSASTSLSPDPNDKRIVT---TVEDAI------RLGADAVSIHVNVGSDTEAD-------QIEDLGDVAEIADDWGVPL  139 (259)
T ss_pred             ECCCCCCCCCCCCCCEEEE---CHHHHH------HCCCCEEEEEEECCCCCCHH-------HHHHHHHHHHHHHHCCCCH
T ss_conf             6045432588887875785---148997------32898679988648987389-------9999989999886548842


Q ss_pred             EECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             981707886632244112678708861200001541105888887401687645225311
Q gi|254780151|r   88 YVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        88 ~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      .-.                .|.||.-=.--  -.... ...-...+.|+|||-|=|- |.
T Consensus       140 LAM----------------mYaRG~~i~~e--~d~~~-v~HAaRlg~ElGADvvK~~-Y~  179 (259)
T TIGR01949       140 LAM----------------MYARGPRIDDE--VDPEV-VAHAARLGEELGADVVKVP-YT  179 (259)
T ss_pred             HEC----------------CCCCCCCCCCC--CCHHH-HHHHHHHHHHHCCCEEEEC-CC
T ss_conf             011----------------27886887664--47678-8888765353457766514-31


No 419
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase; InterPro: IPR011283   This entry represent acetoacetyl-CoA reductase, a member of the family short-chain-alcohol dehydrogenases. Note that, despite the precision implied by the enzyme name, the reaction of 1.1.1.36 from EC is defined more generally as (R)-3-hydroxyacyl-CoA + NADP+ = 3-oxoacyl-CoA + NADPH. Members of this family may act in the biosynthesis of poly-beta-hydroxybutyrate (e.g. Rhizobium meliloti) and related poly-beta-hydroxyalkanoates. Note that the member of this family from Azospirillum brasilense, designated NodG, appears to lack acetoacetyl-CoA reductase activity and to act instead in the production of nodulation factor. ; GO: 0018454 acetoacetyl-CoA reductase activity, 0042619 poly-hydroxybutyrate biosynthetic process, 0005737 cytoplasm.
Probab=20.81  E-value=57  Score=13.17  Aligned_cols=95  Identities=16%  Similarity=0.102  Sum_probs=52.3

Q ss_pred             EECCCHHHHHHHHHHHHCCCEEEEEEEE-CCCCCCCCCCC-------------CCCCCHHHHHHHHHHHHHCCCCEEEC-
Q ss_conf             9609857999999998869849999987-04787665555-------------77881899999999999809958981-
Q gi|254780151|r   26 AMSGGVDSSVVAALLKRDGYDVIGVTLQ-LYNSRKASKRK-------------GSCCAGQDVYDARRVCDTINVSHYVF-   90 (408)
Q Consensus        26 a~SGGVDSsvaa~lL~~~G~~V~g~~m~-~~~~~~~~~~~-------------~~c~~~~d~~~a~~va~~LgI~~~~~-   90 (408)
                      |=+||+-|+.+-.|. ++||.|++=+.= +......+..+             .--.+++--..+++|-+.|| |..++ 
T Consensus         7 Gg~GGIGtAIC~rL~-~dG~~V~An~~p~N~~~a~~W~~~~~~~g~~~~~~~~DV~~~e~c~~~v~~v~a~lG-pvDvLV   84 (244)
T TIGR01829         7 GGTGGIGTAICTRLA-KDGYRVAANYVPSNEERAEAWLQEQGAQGFDFAVVEGDVSSFEDCKAAVAKVEAELG-PVDVLV   84 (244)
T ss_pred             CCCCCHHHHHHHHHH-HCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEEECCCCCHHHHHHHHHHHHHCCC-CEEEEE
T ss_conf             787744689999998-759889881789825899999986269851478987276777899999999997119-536898


Q ss_pred             ------------CHHHHHHHHCCCCCHHHHHCCCCCCCEECCCC
Q ss_conf             ------------70788663224411267870886120000154
Q gi|254780151|r   91 ------------DYEERFRNAVIVPFASSYAAGETPLPCVDCNR  122 (408)
Q Consensus        91 ------------d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~  122 (408)
                                  -+..+=|+.||+-=|++--.=.-|-=+-||.|
T Consensus        85 NNAGITRD~~F~KM~~~qW~~VI~TNL~SvFNVT~pV~~gM~eR  128 (244)
T TIGR01829        85 NNAGITRDKTFKKMTYEQWSEVIDTNLNSVFNVTRPVIEGMRER  128 (244)
T ss_pred             ECCCCCCCHHHCCCCHHHHHHHHHHCCCCCCCCCHHHHHHHHHC
T ss_conf             68864403031249984688898631324415540014766216


No 420
>COG0065 LeuC 3-isopropylmalate dehydratase large subunit [Amino acid transport and metabolism]
Probab=20.78  E-value=57  Score=13.16  Aligned_cols=66  Identities=14%  Similarity=0.166  Sum_probs=35.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEE--EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE-EECC
Q ss_conf             9999609857999999998869849999--9870478766555577881899999999999809958-9817
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDVIGV--TLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH-YVFD   91 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V~g~--~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~-~~~d   91 (408)
                      |=..|---|-|-.|.--|++.|-.|.--  ++-..|+.-.....   -..+.....++.|+..||+. +-+.
T Consensus        29 iD~~l~HdvTsP~a~~~lr~~g~kV~~p~k~~~~~DH~vPt~~~---~~a~~~~~lr~~~ke~Gi~~~~~~g   97 (423)
T COG0065          29 IDLHLVHDVTSPQAFEGLREAGRKVRDPEKTVATFDHNVPTPDI---KAAEQQKELRENAKEFGIVNFYDVG   97 (423)
T ss_pred             EEEEEEECCCCHHHHHHHHHHCCCCCCCCCEEEEECCCCCCCCH---HHHHHHHHHHHHHHHHCCEEEECCC
T ss_conf             40254533654899999998398124735169970477998557---7899999999999984990450378


No 421
>KOG1356 consensus
Probab=20.53  E-value=57  Score=13.13  Aligned_cols=26  Identities=12%  Similarity=0.120  Sum_probs=16.7

Q ss_pred             ECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             60985799999999886984999998
Q gi|254780151|r   27 MSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        27 ~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      -+++.|.-++-++|...|-++..+.+
T Consensus       179 ~~~~~~~e~~k~il~~~gd~~c~~~~  204 (889)
T KOG1356         179 SDSRLDTETAKYILANLGDQFCQLVR  204 (889)
T ss_pred             CCCCCCHHHHHHHHHHCCCHHHHHHH
T ss_conf             53445347778776512413555653


No 422
>PRK10693 response regulator of RpoS; Provisional
Probab=20.47  E-value=58  Score=13.12  Aligned_cols=59  Identities=12%  Similarity=0.112  Sum_probs=41.8

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             7888633889999609857999999998869849999987047876655557788189999999999980995898170
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      |.++...+||+|.=.-=+-..+...+|.+.||+|+.+.                    +-++|...++.....+.+.|+
T Consensus         1 m~~pl~gkkILIVDDd~~~r~~l~~~L~~~G~~V~~A~--------------------nG~eAl~~l~~~~pDLIi~Dl   59 (337)
T PRK10693          1 MTQPLVGKQILIVEDEPVFRSLLDSWFSSLGATTVLAA--------------------DGVDALELLGGFTPDLMICDI   59 (337)
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEEEEC--------------------CHHHHHHHHHCCCCCEEEEEC
T ss_conf             99888899899994999999999999997899999989--------------------999999998658999999968


No 423
>pfam04358 DsrC DsrC like protein. A family member from Desulfovibrio vulgaris has been observed to co-purify with Desulfovibrio vulgaris dissimilatory sulfite reductase, and many members of this family are annotated as the third (gamma) subunit of dissimilatory sulphite reductase. However, this protein appears to be only loosely associated to the sulfite reductase, which suggests that DsrC may not be an integral part of the dissimilatory sulphite reductase. Members of this family are found in organisms such as E. coli and H. influenzae which do not contain dissimilatory sulphite reductases but can synthesize assimilatory sirohaem sulphite and nitrite reductases. It is speculated that DsrC may be involved in the assembly, folding or stabilisation of sirohaem proteins. The strictly conserved cysteine in the C terminus suggests that DsrC may have a catalytic function in the metabolism of sulphur compounds.
Probab=20.46  E-value=58  Score=13.12  Aligned_cols=34  Identities=24%  Similarity=0.304  Sum_probs=23.7

Q ss_pred             HHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC-CCCCC
Q ss_conf             99999980995898170788663224411267870-88612
Q gi|254780151|r   76 ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA-GETPL  115 (408)
Q Consensus        76 a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~-G~TPN  115 (408)
                      |+.+|+..||.     +.++-|+ |+..+-+-|.+ |..|+
T Consensus        28 A~~lA~~egI~-----Lt~~HW~-vI~~lR~~Y~~~~~~P~   62 (109)
T pfam04358        28 AEALAAEEGIE-----LTEEHWE-VIRFLRDYYAEFGIAPA   62 (109)
T ss_pred             HHHHHHHCCCC-----CCHHHHH-HHHHHHHHHHHHCCCCC
T ss_conf             99999884986-----6799999-99999999999689971


No 424
>cd04735 OYE_like_4_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 4.  Each monomer of OYE contains FMN as a non-covalently bound cofactor, uses NADPH as a reducing agent with oxygens, quinones, and alpha,beta-unsaturated aldehydes and ketones, and can act as electron acceptors in the catalytic reaction.  Other members of OYE family include trimethylamine dehydrogenase, 2,4-dienoyl-CoA reductase, enoate reductase, pentaerythriol tetranitrate reductase, xenobiotic reductase, and morphinone reductase.
Probab=20.40  E-value=58  Score=13.11  Aligned_cols=10  Identities=20%  Similarity=0.142  Sum_probs=4.2

Q ss_pred             HHCCCCCCEE
Q ss_conf             7401687645
Q gi|254780151|r  132 VTRQLGADVL  141 (408)
Q Consensus       132 ~a~~~g~~~i  141 (408)
                      .|++-|+|.|
T Consensus       152 rA~~AGfDgV  161 (353)
T cd04735         152 RAIEAGFDGV  161 (353)
T ss_pred             HHHHCCCCEE
T ss_conf             9998399989


No 425
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed
Probab=20.40  E-value=58  Score=13.11  Aligned_cols=98  Identities=15%  Similarity=0.175  Sum_probs=54.4

Q ss_pred             EEEEECCCHHHHHHH-HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             999960985799999-9998869849999987047876655557788189999999999980995898170788663224
Q gi|254780151|r   23 VVVAMSGGVDSSVVA-ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        23 V~va~SGGVDSsvaa-~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      -++++|.|.--..++ .-+.+.|-+|+.-.      +         +..-...-.+.+..++||....+|..+       
T Consensus        82 ~a~~~~SGmaAi~~~lla~l~~Gdhiv~~~------~---------~Yg~t~~l~~~~l~~~Gi~~~~vd~~d-------  139 (397)
T PRK07504         82 DARATASGMAAVTAAILCQLKAGDHVVAAR------A---------LFGSCRYVVETLLPRYGIESTLVDGLD-------  139 (397)
T ss_pred             EEEEECCHHHHHHHHHHHHCCCCCEEEECC------C---------CCHHHHHHHHHHHHCCCEEEEEECCCC-------
T ss_conf             598734499999999998558999898558------8---------755699999999860785899878988-------


Q ss_pred             CCCHHHHHCCCCCCCEEC-C----CCEEE---HHHHHHHHCCCCCCEECCCC
Q ss_conf             411267870886120000-1----54110---58888874016876452253
Q gi|254780151|r  102 VPFASSYAAGETPLPCVD-C----NRTVK---FSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~-C----N~~iK---F~~l~~~a~~~g~~~iATGH  145 (408)
                         ++++++..+||..+. |    |+.++   ..++.+.|++.|+-.|.-..
T Consensus       140 ---~~~~~~ai~~~Tklv~~EspsNP~l~v~Di~~ia~iA~~~g~~~vVDNT  188 (397)
T PRK07504        140 ---LDNWEKAVRPNTKVFFLESPTNPTLEVIDIAAVAEIANQAGAKLVVDNV  188 (397)
T ss_pred             ---HHHHHHHCCCCCEEEEEECCCCCCCEECCCHHHHHHHHHCCCEEEEECC
T ss_conf             ---5889974587753999854899974513719999999982995997366


No 426
>PRK10279 hypothetical protein; Provisional
Probab=20.37  E-value=55  Score=13.25  Aligned_cols=32  Identities=19%  Similarity=0.319  Sum_probs=22.2

Q ss_pred             CCCEEEEEECCCHHHHHHH----HHHHHCCCEEEEE
Q ss_conf             3388999960985799999----9998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVA----ALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa----~lL~~~G~~V~g~   50 (408)
                      |.+||.++||||-==..|-    .-|.|.|..+..+
T Consensus         2 ~~~kigLvLsGGgarG~AHiGvl~aLee~gI~id~I   37 (300)
T PRK10279          2 RKIKIGLALGSGAARGWSHIGVINALKKVGIEIDIV   37 (300)
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             997299995867999999999999999869997789


No 427
>KOG3360 consensus
Probab=20.33  E-value=58  Score=13.10  Aligned_cols=19  Identities=11%  Similarity=0.246  Sum_probs=10.6

Q ss_pred             HHHHHHHCCCCEEECCHHH
Q ss_conf             9999998099589817078
Q gi|254780151|r   76 ARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        76 a~~va~~LgI~~~~~d~~~   94 (408)
                      +..-|++|||.=-+.|-++
T Consensus        27 t~~~a~~lGlrGWv~Nt~~   45 (98)
T KOG3360          27 TLDEAKKLGLRGWVMNTSE   45 (98)
T ss_pred             HHHHHHHHCCEEEEEECCC
T ss_conf             8998886161278882578


No 428
>pfam08901 DUF1847 Protein of unknown function (DUF1847). This family of proteins are functionally uncharacterized. THey contain 4 N-terminal cysteines that may form a zinc binding domain.
Probab=20.30  E-value=58  Score=13.09  Aligned_cols=43  Identities=21%  Similarity=0.460  Sum_probs=28.2

Q ss_pred             CCCCCCCCCCEEEEEECCCH--HHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             46788863388999960985--79999999988698499999870
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGV--DSSVVAALLKRDGYDVIGVTLQL   54 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGV--DSsvaa~lL~~~G~~V~g~~m~~   54 (408)
                      +.|-+...-+||=+|+.-|.  .+-+-+.+|+.+||+|..|-=+.
T Consensus        47 i~FAk~mgykkiGiAfCiGL~~Ea~~~~~il~~~gFev~sV~CKv   91 (157)
T pfam08901        47 IEFAKRMGYKKIGIAFCIGLLNEARILAKILKAKGFEVYSVCCKV   91 (157)
T ss_pred             HHHHHHCCCCEEEEHHHHHHHHHHHHHHHHHHHCCCEEEEEEECC
T ss_conf             999998599755302237389999999999997898898888506


No 429
>PRK00402 3-isopropylmalate dehydratase large subunit; Reviewed
Probab=20.23  E-value=58  Score=13.08  Aligned_cols=14  Identities=0%  Similarity=0.057  Sum_probs=7.0

Q ss_pred             CCHHHCCCEEECCC
Q ss_conf             55111023011127
Q gi|254780151|r  212 ADKSDSQDICFVQQ  225 (408)
Q Consensus       212 a~K~eSqgICFi~~  225 (408)
                      -..||+.+|=|.|+
T Consensus       155 ~~vPe~v~v~l~G~  168 (419)
T PRK00402        155 FRVPETIKVVLNGK  168 (419)
T ss_pred             ECCCCEEEEEEECC
T ss_conf             70785789999474


No 430
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain. The UDP-glucose/GDP-mannose dehydrogenaseses are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate.
Probab=20.20  E-value=58  Score=13.08  Aligned_cols=30  Identities=37%  Similarity=0.447  Sum_probs=22.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899996098579999999988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||.|-=-|=|-..+|+. |.+.||+|+|+-
T Consensus         1 MkI~ViGlGyVGl~~a~~-la~~G~~V~g~D   30 (185)
T pfam03721         1 MRIAVIGLGYVGLPTAVC-LAEIGHDVVGVD   30 (185)
T ss_pred             CEEEEECCCHHHHHHHHH-HHHCCCEEEEEE
T ss_conf             979998978748999999-994899399997


No 431
>TIGR00676 fadh2 5,10-methylenetetrahydrofolate reductase; InterPro: IPR004620 The enzyme activities methylenetetrahydrofolate reductase (1.5.1.20 from EC) and 5,10-methylenetetrahydrofolate reductase (FADH) (1.7.99.5 from EC) differ in that the former (assigned in many eukaryotes) is defined to use NADP+ as an acceptor, while the latter (assigned in many bacteria) is flexible with respect to the acceptor. Both convert 5-methyltetrahydrofolate to 5,10-methylenetetrahydrofolate. From a larger set of proteins assigned as one or the other, this family describes the subset of proteins found in bacteria, and currently designated 5,10-methylenetetrahydrofolate reductase. This protein is an FAD-containing flavoprotein.; GO: 0009086 methionine biosynthetic process.
Probab=20.20  E-value=29  Score=15.20  Aligned_cols=22  Identities=5%  Similarity=0.185  Sum_probs=13.5

Q ss_pred             CHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             1899999999999809958981
Q gi|254780151|r   69 AGQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        69 ~~~d~~~a~~va~~LgI~~~~~   90 (408)
                      +.++++++-+-.+.+||.+.+.
T Consensus        86 t~~e~~~~L~~y~~~Gi~~ilA  107 (302)
T TIGR00676        86 TREEIEEILREYRELGIRNILA  107 (302)
T ss_pred             CHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9899999999998748867987


No 432
>TIGR00486 TIGR00486 conserved hypothetical protein TIGR00486; InterPro: IPR002678   This family contains several NIF3 (NGG1p interacting factor 3) protein homologues. NIF3 interacts with the yeast transcriptional coactivator NGG1p which is part of the ADA complex, the exact function of this interaction is unknown ..
Probab=20.17  E-value=42  Score=14.12  Aligned_cols=68  Identities=22%  Similarity=0.100  Sum_probs=30.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHH-HHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEC----CHH
Q ss_conf             3388999960985799999999-88698499999870478766555577881899999999999809958981----707
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALL-KRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVF----DYE   93 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL-~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~----d~~   93 (408)
                      +-+||+++    ||-|.+.+.= .++|-|++=+|-=     ........+....--....+++=+-+|+++-+    |..
T Consensus        46 ~~~kv~~~----vD~s~~~~~~A~~~~~d~i~~HHp-----~~~~~~~~~~~~~~~~~~~k~Ll~~~i~lY~~HtnlD~~  116 (325)
T TIGR00486        46 EVKKVLVA----VDASESVAKEAKEKNADLIITHHP-----LIFKPLKRLIRGIKPKRLLKILLENDISLYSAHTNLDAH  116 (325)
T ss_pred             HHHHHHHH----HHHHHHHHHHHHHCCCCEEEEECC-----CCCCCCCCCCCCCCCHHHHHHHHHCCCCEEECCCCCHHH
T ss_conf             24455667----778999999998537979998078-----642872223666410367889886796134104600233


Q ss_pred             HH
Q ss_conf             88
Q gi|254780151|r   94 ER   95 (408)
Q Consensus        94 ~~   95 (408)
                      ++
T Consensus       117 ~~  118 (325)
T TIGR00486       117 RG  118 (325)
T ss_pred             CC
T ss_conf             04


Done!