HHsearch alignment for GI: 254780151 and conserved domain: pfam00733

>pfam00733 Asn_synthase Asparagine synthase. This family is always found associated with pfam00310. Members of this family catalyse the conversion of aspartate to asparagine.
Probab=98.42  E-value=1.2e-06  Score=68.23  Aligned_cols=110  Identities=25%  Similarity=0.263  Sum_probs=70.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             3388999960985799999999886-984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
T Consensus        16 sdvpig~~LSGGlDSs~ia~l~~~~~~~~i~~~s~~~~~~~-----------~~E~~~a~~~a~~~~~~~~~v~~~~~~~   84 (195)
T pfam00733        16 ADVPVGVLLSGGLDSSLIAALAARQSSPPLKTFSVGFEGSD-----------YDEAPYAELVADHLGTDHHEIIVTEEEL   84 (195)
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHCCCCCEEEECCCCCCC-----------CCHHHHHHHHHHHHCCCCEEEEECHHHH
T ss_conf             69836753067468999999999853899538955788899-----------7589999999965133517877255999


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC
Q ss_conf             3224411267870886120000154110588888740168764522531
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY  146 (408)
T Consensus        85 ~~~~~~~i~~~---~~P~~--~~~~~~-~~~l~k~~~~-~~kV~lsG~G  126 (195)
T pfam00733        85 LDALPEVIYHL---EEPFG--DSSAIP-LYLLSRLARK-GVKVVLSGEG  126 (195)
T ss_pred             HHHHHHHHHHH---CCCCC--CCCHHH-HHHHHHHHHC-CCEEEEEEEC
T ss_conf             99988889986---29877--751789-9999999868-9849997156