HHsearch alignment for GI: 254780151 and conserved domain: pfam00764

>pfam00764 Arginosuc_synth Arginosuccinate synthase. This family contains a PP-loop motif.
Probab=99.29  E-value=2.7e-11  Score=101.41  Aligned_cols=160  Identities=30%  Similarity=0.445  Sum_probs=112.9

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHHHCCC
Q ss_conf             9996098579999999988698499999870478766555577881899999999999809-958981707886632244
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-VSHYVFDYEERFRNAVIV  102 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-I~~~~~d~~~~f~~~V~~  102 (408)
T Consensus         1 VLAySGGLDTSv~l~wL~e~~~eVia~~~d~G----------q--~~ed~~~i~~kA~~~GA~~~~v~D~r~ef~~~~i~   68 (389)
T pfam00764         1 VLAYSGGLDTSVCIPWLKEKYYEVIAVAVDVG----------Q--GEEDLDEAREKALKLGAVKHYVIDAKEEFVEDYIF   68 (389)
T ss_pred             CEEECCCCHHHHHHHHHHHCCCEEEEEEEECC----------C--CHHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH
T ss_conf             96036762899999999970992899999799----------9--77878999999998299789997379999999899


Q ss_pred             CCHHHH--HCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEE---EECCCCCCCCEEEE
Q ss_conf             112678--7088612000015411058888874016876452253110254126787731688---53157878731898
Q gi|254780151|r  103 PFASSY--AAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIM---CRPMDLERDQSYFL  177 (408)
Q Consensus       103 ~~~~~y--~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L---~r~~D~~KDQSYfL  177 (408)
T Consensus        69 p~i~ana~Yeg~Y~L~tslaRpli-a~~~v~~A~~~ga~aiaHG~TG--------kGNDQvRFe~~~~aL~P~-------  132 (389)
T pfam00764        69 PAIKANALYEGRYPLGTALARPLI-AKKLVEAAKKEGADAVAHGCTG--------KGNDQVRFELSIRSLAPD-------  132 (389)
T ss_pred             HHHHCCCCCCCCEEECCCCHHHHH-HHHHHHHHHHCCCEEEEECCCC--------CCCCHHHHHHHHHHHCCC-------
T ss_conf             999668674464785243216699-9999999876397699436667--------997453547889974999-------


Q ss_pred             EEECCHHHCEEECCCCC--CCHHHHHHHHHHCCCCCC-C--HHHCCC
Q ss_conf             63020221003342568--997898999974125435-5--111023
Q gi|254780151|r  178 FATTQQQLCDLRFPLGD--MKKESVRDLAREMGLDIA-D--KSDSQD  219 (408)
Q Consensus       178 ~~l~~~~L~~~~FPlg~--~~K~eVR~~A~~~gl~~a-~--K~eSqg  219 (408)
T Consensus       133 -------l-~iiaP~R~~~~sR~~~i~ya~~~gI~v~~~~~~pyS~D  171 (389)
T pfam00764       133 -------L-KVIAPVRDLNLTREEEIEYAKEKGIPIPVTKKKPYSID  171 (389)
T ss_pred             -------C-EEECCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             -------7-58545245320579999999985998875688873335