HHsearch results for GI: 254780151 and protein with PDBid: 1wy5_A

>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A*
Probab=99.56  E-value=8.6e-15  Score=124.85  Aligned_cols=173  Identities=21%  Similarity=0.251  Sum_probs=115.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-----CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             3388999960985799999999886-----98499999870478766555577881899999999999809958981707
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-----GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-----G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      .+.||+||+|||+||++.+.+|.+.     ..+|..+|+. +...        ..+..|.+.++++|+.+|||+++.+..
T Consensus        23 ~~~kvlva~SGG~DS~~Ll~~l~~l~~~~~~~~i~~~hv~-h~~r--------~~s~~~~~~v~~~~~~~~i~~~~~~~~   93 (317)
T 1wy5_A           23 GERRVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALAHFN-HMLR--------ESAERDEEFCKEFAKERNMKIFVGKED   93 (317)
T ss_dssp             SCCEEEEECCSSHHHHHHHHHHHHSTTTTTCSEEEEEEEE-CCSS--------THHHHHHHHHHHHHHHHTCCEEEEECC
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEEEE-CCCC--------CCHHHHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             9785999981829999999999999987799809999961-8999--------755999999999999606242211023


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             88663224411267870886120000154110588888740168764522531102541267877316885315787873
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      ..           ...... +.+|-.|-|.+++..|.+.|++.|+++|||||.+.=..    + +--..+.||.     .
T Consensus        94 ~~-----------~~~~~~-~~~~e~~aR~~Ry~~l~~~~~~~~~~~i~~gHh~dD~~----E-T~l~~l~rG~-----~  151 (317)
T 1wy5_A           94 VR-----------AFAKEN-RMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLL----E-TSLLFFTRGT-----G  151 (317)
T ss_dssp             HH-----------HHHHHT-TCCHHHHHHHHHHHHHHHHHHHTTCSEEECCCCHHHHH----H-HHHHHHHHCC-----C
T ss_pred             EE-----------EECCCC-CCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHH----H-HHHHHHHCCC-----C
T ss_conf             44-----------311479-98878999999998855323431266467613012288----8-9998874287-----7


Q ss_pred             EEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC
Q ss_conf             18986302022100334256899789899997412543551110230111
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV  223 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi  223 (408)
                      ...|+.+.+.. ..++=||-.++|+|+++.|++.+++..+-+-..+..|.
T Consensus       152 ~~gl~~~~~~~-~~i~RPLl~~~k~ei~~y~~~~~i~~~~D~sN~~~~~~  200 (317)
T 1wy5_A          152 LDGLIGFLPKE-EVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIP  200 (317)
T ss_dssp             HHHHHCSCSEE-TTEECTTTTCCHHHHHHHHHHTTCCCCCCGGGGTCCHH
T ss_pred             CCCCCCCCCCC-CCCCCHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCH
T ss_conf             67887766543-32166044177999999999759997889989986330