HHsearch results for GI: 254780151 and protein with PDBid: 2wsi_A

>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae}
Probab=97.44  E-value=0.0025  Score=42.84  Aligned_cols=140  Identities=11%  Similarity=-0.014  Sum_probs=77.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCC----------------------EEEEEEEECCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             6338899996098579999999988698----------------------499999870478766555577881899999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGY----------------------DVIGVTLQLYNSRKASKRKGSCCAGQDVYD   75 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~----------------------~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~   75 (408)
                      |....|++++|||.||+|.+.|+.++..                      .+..+|+..   .        ....+-.+-
T Consensus        51 p~~~ei~~SFSGGKDStVlL~L~~~a~~~~~~~~~~~~~~~~~~~~~~~~~i~~~yidt---~--------~~FpE~~~f  119 (306)
T 2wsi_A           51 PLNGEISFSYNGGKDCQVLLLLYLSCLWEYFFIKAQNSQFDFEFQSFPMQRLPTVFIDQ---E--------ETFPTLENF  119 (306)
T ss_dssp             SSSSSEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHC--------CCCCCEEEEECCC---T--------TCCHHHHHH
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECC---C--------CCCHHHHHH
T ss_conf             54574899815833799999999998531344212455556543445578875799479---9--------998789999


Q ss_pred             HHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC-CCCEECCCCCCCEEEECC
Q ss_conf             9999998099589817078866322441126787088612000015411058888874016-876452253110254126
Q gi|254780151|r   76 ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL-GADVLATGHYIRSRLYVG  154 (408)
Q Consensus        76 a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~-g~~~iATGHYar~~~~~~  154 (408)
                      ....++.+|+++.+......                     +-.+    +...+-++.+.. +.+.+.+|    ++..  
T Consensus       120 v~~~~~~~~l~~~~~~~~~~---------------------~~~~----~~~~~~~~lk~~p~~~aii~G----~R~~--  168 (306)
T 2wsi_A          120 VLETSERYCLSLYESQRQSG---------------------ASVN----MADAFRDFIKIYPETEAIVIG----IRHT--  168 (306)
T ss_dssp             HHHHHHHTTEEEEECCC--------------------------CC----HHHHHHHHHHHCTTCCEEECC----CCCC--
T ss_pred             HHHHHHHCCCEEEEEECCCC---------------------HHHH----HHHHHHHHHHHCCCCCEEEEC----CCCC--
T ss_conf             99999972945999837843---------------------7777----568889999849998689962----4046--


Q ss_pred             CCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             787731688531578787318986302022100334256899789899997412543
Q gi|254780151|r  155 DDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       155 ~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                       ++..+.           ++.|-..-+..-----++||-+++-.+|=..-++.++|.
T Consensus       169 -Es~~R~-----------~~~~~~~d~~~p~~~rv~PI~dWt~~DVW~yi~~~~lpy  213 (306)
T 2wsi_A          169 -DPFGEA-----------LKPIQRTDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPI  213 (306)
T ss_dssp             -SSSCCC-----------CCSEEECCTTSCSCEEECTTTTCCHHHHHHHHHHHCCCB
T ss_pred             -CCCHHC-----------CCCCCCCCCCCCCEEEECCHHHCCHHHHHHHHHHCCCCC
T ss_conf             -754001-----------585002059988638982236399999999999729998