HHsearch results for GI: 254780151 and protein with PDBid: 3bl5_A

>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis}
Probab=99.24  E-value=1.3e-11  Score=101.98  Aligned_cols=170  Identities=21%  Similarity=0.173  Sum_probs=107.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999980995898170788663
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +++|++|.||||+||+++|++|+++|++|+++|+..+..           +.+....++.+++.+.+.++..........
T Consensus         2 ~k~k~vvl~SGGlDS~~~a~~l~~~g~~v~~l~~~ygq~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   70 (219)
T 3bl5_A            2 KKEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQR-----------HSQEVEVAKSIAEKLGVKNHLLDMSLLNQL   70 (219)
T ss_dssp             -CCEEEEECCSSHHHHHHHHHHHHHCSEEEEEEEESSCT-----------TCHHHHHHHHHHHTTCCCEEEEECGGGGGG
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCC-----------CCHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             977399995881889999999998799699999988864-----------210457789999985200011103344442


Q ss_pred             HCCCC----CHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCE
Q ss_conf             22441----12678708861200001541105888887401687645225311025412678773168853157878731
Q gi|254780151|r   99 AVIVP----FASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQS  174 (408)
Q Consensus        99 ~V~~~----~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQS  174 (408)
                      .....    ..........|...+.+...+.+....-.|...|++.+++|.-..-... ..+..  +...       |..
T Consensus        71 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~-~~~~~--~~f~-------~~~  140 (219)
T 3bl5_A           71 APNALTRNDIEIEVKDGELPSTFVPGRNLVFLSFASILAYQIGARHIITGVCETDFSG-YPDCR--DEFV-------KSC  140 (219)
T ss_dssp             STGGGC--------------CCCCTTHHHHHHHHHHHHHHHHTCSEEECCCCC----C-CGGGS--HHHH-------HHH
T ss_pred             CCCCCCCCCHHHHHHCCCCCCEEEEHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCC-CCCCC--HHHH-------HHH
T ss_conf             0242111203544301455534786103677789999988603441574225666557-89983--7899-------999


Q ss_pred             EEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             89863020221003342568997898999974125
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl  209 (408)
                      .-+..+....--+++.|+..++|.||.+++.++|+
T Consensus       141 ~~~~~~~~~~~~~~~~P~~~~~K~eii~~~~~~~~  175 (219)
T 3bl5_A          141 NVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGA  175 (219)
T ss_dssp             HHHHHHHHTSCCEEECTTTTCCHHHHHHHHHHTTC
T ss_pred             HHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             99997444550389724003729999999998289