HHsearch results for GI: 254780151 and protein with PDBid: 3dla_A

>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis}
Probab=98.99  E-value=8e-11  Score=96.43  Aligned_cols=152  Identities=18%  Similarity=0.233  Sum_probs=93.6

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-C------CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             3388999960985799999999886-9------84999998704787665555778818999999999998099589817
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-G------YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G------~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      .-+++++|+|||+||+++|++..++ |      -+|++++|-..           -.+++...+|+.+|+.|||.|+.++
T Consensus       360 g~~~~vlglSGGiDSal~a~la~~a~~~~~~~~~~v~~~~mps~-----------~ss~~s~~~A~~la~~lg~~~~~i~  428 (680)
T 3dla_A          360 DYPKVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGF-----------ATGEHTKNNAIKLARALGVTFSEID  428 (680)
T ss_dssp             TSCEEEEECCSSHHHHHHHHHHHHHHHHTTCCGGGEEEEECCC----------------CTHHHHHHHHHHHTCEEEECC
T ss_pred             CCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC-----------CCCHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             98725522335753178899999976320477544489832644-----------4650339999988875498644455


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCCCEECC-C--CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCC
Q ss_conf             07886632244112678708861200001-5--41105888887401687645225311025412678773168853157
Q gi|254780151|r   92 YEERFRNAVIVPFASSYAAGETPLPCVDC-N--RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMD  168 (408)
Q Consensus        92 ~~~~f~~~V~~~~~~~y~~G~TPNPc~~C-N--~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D  168 (408)
                      +.+.+... ...+...+..|. +..++.= |  .++.--.|+..|...|.=.+.||.-.-              +..|--
T Consensus       429 I~~~~~~~-~~~~~~~~~~~~-~~~~~~~eN~qaR~R~~~l~~~an~~~~lvl~t~N~sE--------------~~~Gy~  492 (680)
T 3dla_A          429 IGDTARLM-LHTIGHPYSVGE-KVYDVTFENVQAGLRTDYLFRIANQRGGIVLGTGDLSE--------------LALGWS  492 (680)
T ss_dssp             CHHHHHHH-HHHTTC----------CCHHHHHHHHHHHHHHHHHHHHHTEEEEECCCHHH--------------HHHTCS
T ss_pred             HHHHHHHH-HHHHHHHHCCCC-CCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCH--------------HHHCCE
T ss_conf             79999999-998643421787-54414665110478899999864127818977896103--------------653531


Q ss_pred             CCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHC
Q ss_conf             878731898630202210033425689978989999741
Q gi|254780151|r  169 LERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREM  207 (408)
Q Consensus       169 ~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~  207 (408)
                      .          +.--....-+=|+|++.|.+|+++|+.+
T Consensus       493 T----------l~yGD~~~~~~pi~~l~Kt~v~~l~~~~  521 (680)
T 3dla_A          493 T----------YGVGDQMSHYNVNAGVPKTLIQHLIRWV  521 (680)
T ss_dssp             C----------CSSSTTCCSEESSTTSCHHHHHHHHHHH
T ss_pred             E----------CCCCCCCCCCCEECCCCHHHHHHHHHHH
T ss_conf             0----------0458867574611795599999999999