HHsearch results for GI: 254780151 and protein with PDBid: 3fiu_A

>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp}
Probab=99.86  E-value=3.6e-22  Score=177.65  Aligned_cols=166  Identities=22%  Similarity=0.285  Sum_probs=117.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999980995898170788663
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +..+|+|||||||||||+|+|++++|.+|.+++|..+           +++.+++++|+.+|+.|||+|+++|+...+..
T Consensus        28 ~~~~vvvglSGGVDSav~A~L~~~a~~~v~~v~m~~~-----------~~~~~~~~dA~~la~~Lgi~~~~i~~~~~~~~   96 (249)
T 3fiu_A           28 PAEGFVIGLSGGIDSAVAASLAVKTGLPTTALILPSD-----------NNQHQDMQDALELIEMLNIEHYTISIQPAYEA   96 (249)
T ss_dssp             TCSEEEEECCSSHHHHHHHHHHHHTTSCEEEEECCCT-----------TSCHHHHHHHHHHHHHHTCEEEECCCHHHHHH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCC-----------CCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             9982999677989999999999982987525236876-----------33068999999999871676300246578999


Q ss_pred             HCCCCCHHHHHCCCCCCCEECCCC--EEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             224411267870886120000154--110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCVDCNR--TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~~CN~--~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                      - ...+-..+..+.++.++..+|-  ++....|+..|...|.-.++|||....                         |+
T Consensus        97 ~-~~~~~~~~~~~~~~~~~~~~N~~ar~r~~~l~~~a~~~~~lv~gt~n~se~-------------------------~~  150 (249)
T 3fiu_A           97 F-LASTQSFTNLQNNRQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEW-------------------------YM  150 (249)
T ss_dssp             H-HHHTGGGC------CHHHHHHHHHHHHHHHHHHHHHHHTEEEBCCCCHHHH-------------------------HH
T ss_pred             H-HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCH-------------------------HC
T ss_conf             9-999754103354056999876789999989999874159840179864310-------------------------12


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             8630202210033425689978989999741254--35511102301
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      .+..........++||++++|.|||++|+.+|+|  +-+|+=|-|++
T Consensus       151 G~~tk~gd~~~di~Pl~~L~K~eVr~la~~lglP~~ii~k~Psa~L~  197 (249)
T 3fiu_A          151 GYFTKFGDGAADILPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLW  197 (249)
T ss_dssp             TCSCTTTTTCCSBCTTTTCCHHHHHHHHHHTTCCHHHHHSCCCCCSS
T ss_pred             CCCCCCCCCCCCHHHCCCEEHHHHHHHHHHCCCCHHHHCCCCCCCCC
T ss_conf             42454578775434226807999999999819999998189995546