Query         gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 408
No_of_seqs    150 out of 2273
Neff          5.8 
Searched_HMMs 23785
Date          Sun May 22 19:08:36 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780151.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 2hma_A Probable tRNA (5-methyl 100.0       0       0  947.8  27.7  362   10-391     2-371 (376)
  2 2der_A TRNA-specific 2-thiouri 100.0       0       0  915.2  23.2  354   17-388    14-377 (380)
  3 2c5s_A THII, probable thiamine  99.9 2.3E-25 9.5E-30  200.6   4.8  171   20-223   187-357 (413)
  4 2dpl_A GMP synthetase, GMP syn  99.9 1.7E-24 7.1E-29  194.3   6.2  227   18-283    18-255 (308)
  5 3k32_A Uncharacterized protein  99.9 6.8E-24 2.9E-28  190.0   6.0  197   17-258     3-202 (203)
  6 1xng_A NH(3)-dependent NAD(+)   99.9 5.8E-23 2.5E-27  183.3   6.0  162   19-222    24-188 (268)
  7 3fiu_A NH(3)-dependent NAD(+)   99.9 3.6E-22 1.5E-26  177.6   6.2  166   19-221    28-197 (249)
  8 3dpi_A NAD+ synthetase; ssgcid  99.8 3.1E-21 1.3E-25  171.0   5.1  166   19-225    45-228 (285)
  9 3p52_A NH(3)-dependent NAD(+)   99.7 1.3E-18 5.5E-23  152.2   6.4  159   19-221    25-188 (249)
 10 1gpm_A GMP synthetase, XMP ami  99.7 2.2E-17 9.4E-22  143.3   9.6  168   14-211   221-395 (525)
 11 2ywb_A GMP synthase [glutamine  99.7 6.8E-17 2.9E-21  139.9  11.9  163   15-210   204-372 (503)
 12 2e18_A NH(3)-dependent NAD(+)   99.7   6E-19 2.5E-23  154.6   0.7  163   12-221    14-184 (257)
 13 1vl2_A Argininosuccinate synth  99.7 2.5E-17   1E-21  143.1   8.7  166   20-219    14-192 (421)
 14 1wxi_A NH(3)-dependent NAD(+)   99.7   8E-17 3.4E-21  139.4   9.2  160   19-220    39-214 (275)
 15 1kqp_A NAD+ synthase;, NH(3)-d  99.7 2.3E-17 9.6E-22  143.3   5.2  160   19-221    37-212 (271)
 16 2vxo_A GMP synthase [glutamine  99.7 2.6E-16 1.1E-20  135.7   9.0  171   16-210   236-433 (697)
 17 3a2k_A TRNA(Ile)-lysidine synt  99.6 3.5E-15 1.5E-19  127.6  12.0  177   17-223    15-198 (464)
 18 1wy5_A TILS, hypothetical UPF0  99.6 8.6E-15 3.6E-19  124.9   8.5  173   19-223    23-200 (317)
 19 1ni5_A Putative cell cycle pro  99.4 6.5E-13 2.7E-17  111.4   8.9  167   19-222    12-186 (433)
 20 1k92_A Argininosuccinate synth  99.4 1.2E-12   5E-17  109.5   7.2  169   15-219     5-193 (455)
 21 1kor_A Argininosuccinate synth  99.4   9E-13 3.8E-17  110.4   6.4  162   21-219     1-175 (400)
 22 2nz2_A Argininosuccinate synth  99.4 2.3E-12 9.6E-17  107.5   8.5  163   20-219     5-183 (413)
 23 2pg3_A Queuosine biosynthesis   99.3 6.6E-12 2.8E-16  104.2   7.1  163   21-209     3-178 (232)
 24 3bl5_A Queuosine biosynthesis   99.2 1.3E-11 5.6E-16  102.0   7.2  170   19-209     2-175 (219)
 25 3n05_A NH(3)-dependent NAD(+)   99.1 1.9E-11 8.2E-16  100.8   3.9  148   16-208   322-473 (590)
 26 3dla_A Glutamine-dependent NAD  99.0   8E-11 3.4E-15   96.4   1.9  152   19-207   360-521 (680)
 27 2d13_A Hypothetical protein PH  98.7 3.9E-08 1.6E-12   77.2   8.3   96   20-146     4-99  (227)
 28 1vbk_A Hypothetical protein PH  98.7 2.9E-08 1.2E-12   78.1   5.7  128   20-209   179-307 (307)
 29 3ilv_A Glutamine-dependent NAD  98.6 1.6E-09 6.6E-14   87.2  -2.3  169    4-208   287-499 (634)
 30 1sur_A PAPS reductase; assimil  98.6 2.7E-07 1.1E-11   71.2   8.8  154   21-211    45-200 (215)
 31 1zun_A Sulfate adenylyltransfe  98.5 4.4E-07 1.8E-11   69.7   7.7  167   21-211    47-224 (325)
 32 2o8v_A Phosphoadenosine phosph  98.5 5.3E-07 2.2E-11   69.1   7.7  196   21-262    46-248 (252)
 33 1q15_A CARA; CMPR, (2S,5S)-5-c  98.4 8.3E-07 3.5E-11   67.7   8.1  110   19-147   237-347 (503)
 34 1jgt_A Beta-lactam synthetase;  98.3   1E-06 4.2E-11   67.1   6.2  110   20-148   241-351 (513)
 35 1ct9_A Asparagine synthetase B  98.1 5.9E-06 2.5E-10   61.6   6.9  113   19-148   225-351 (553)
 36 2goy_A Adenosine phosphosulfat  97.5  0.0011 4.7E-08   45.3  10.2  168   21-223    55-230 (275)
 37 2oq2_A Phosphoadenosine phosph  97.5 0.00011 4.7E-09   52.4   4.8  154   21-210    42-205 (261)
 38 2wsi_A FAD synthetase; transfe  97.4  0.0025   1E-07   42.8  11.2  140   18-211    51-213 (306)
 39 3fwk_A FMN adenylyltransferase  97.4  0.0021 8.7E-08   43.4  10.7  137   19-211    57-216 (308)
 40 3da8_A Probable 5'-phosphoribo  93.1    0.39 1.6E-05   27.1   7.5   58   18-94     10-70  (215)
 41 2bln_A Protein YFBG; transfera  91.1    0.87 3.6E-05   24.6   7.8   60   21-91      1-60  (305)
 42 1q8f_A Pyrimidine nucleoside h  89.5     1.2   5E-05   23.7   7.9   57   20-86      3-60  (313)
 43 1jny_A EF-1-alpha, elongation   88.6     1.1 4.5E-05   24.0   6.1   68   21-117     5-75  (435)
 44 1mvl_A PPC decarboxylase athal  87.8    0.72   3E-05   25.2   4.8   40   10-50      9-51  (209)
 45 1s0u_A EIF-2-gamma, translatio  86.4     1.8 7.5E-05   22.4   9.4   57  328-385   351-408 (408)
 46 2pzm_A Putative nucleotide sug  85.8     1.2 5.1E-05   23.6   5.1   47    4-51      4-51  (330)
 47 3mcu_A Dipicolinate synthase,   85.6     1.1 4.8E-05   23.8   4.9   35   17-51      2-40  (207)
 48 3mmp_A Elongation factor TU 2,  85.4       2 8.3E-05   22.0   7.1   94  285-386   571-676 (678)
 49 3lqk_A Dipicolinate synthase s  85.4    0.98 4.1E-05   24.2   4.5   35   17-51      4-42  (201)
 50 1p3y_1 MRSD protein; flavoprot  84.8     1.1 4.5E-05   24.0   4.4   33   19-51      7-42  (194)
 51 1d2e_A Elongation factor TU (E  84.3     2.2 9.3E-05   21.7   7.2   38  348-390   352-389 (397)
 52 3foj_A Uncharacterized protein  84.3     1.4 5.9E-05   23.1   4.8   34   16-49     52-85  (100)
 53 1gy8_A UDP-galactose 4-epimera  84.1    0.67 2.8E-05   25.4   3.1   31   20-50      2-33  (397)
 54 1kk1_A EIF2gamma; initiation o  83.2     2.4  0.0001   21.4   9.3   50  335-385   360-410 (410)
 55 3lp8_A Phosphoribosylamine-gly  82.7     2.4  0.0001   21.4   5.5  108    7-122     7-115 (442)
 56 3gk5_A Uncharacterized rhodane  81.5     1.6 6.6E-05   22.8   4.2   31   18-48     53-83  (108)
 57 3eme_A Rhodanese-like domain p  81.2       2 8.2E-05   22.1   4.6   33   16-48     52-84  (103)
 58 3kcq_A Phosphoribosylglycinami  80.9     2.9 0.00012   20.8   5.9   59   18-94      6-68  (215)
 59 2yrx_A Phosphoribosylglycinami  80.7       3 0.00013   20.8   7.7   88   10-99     10-98  (451)
 60 2c78_A Elongation factor TU-A;  80.0     3.1 0.00013   20.6   6.3   34  348-386   370-403 (405)
 61 3m6a_A ATP-dependent protease   79.5     3.2 0.00014   20.5   6.5  123   74-210   123-268 (543)
 62 3agp_A Elongation factor TS, e  79.4     3.3 0.00014   20.5   6.6   37  348-389   643-679 (1289)
 63 3fz0_A Nucleoside hydrolase, p  79.2     3.3 0.00014   20.5   8.5   56   19-84      5-61  (360)
 64 2ejb_A Probable aromatic acid   79.0     3.2 0.00013   20.6   5.1   31   21-51      2-35  (189)
 65 2fsx_A RV0390, COG0607: rhodan  78.2     2.1 8.6E-05   21.9   3.9   12  199-210    95-106 (148)
 66 1wv9_A Rhodanese homolog TT165  78.1       3 0.00012   20.8   4.7   30   19-48     52-81  (94)
 67 1sbz_A Probable aromatic acid   78.0     2.8 0.00012   21.0   4.6   30   21-50      1-34  (197)
 68 2c40_A Inosine-uridine preferr  76.8     3.8 0.00016   20.0   7.5   54   22-85      3-57  (312)
 69 2e3j_A Epoxide hydrolase EPHB;  76.3     3.5 0.00015   20.3   4.6   68   19-86     25-96  (356)
 70 2f6r_A COA synthase, bifunctio  76.3     1.9   8E-05   22.2   3.3   47    3-49     49-104 (281)
 71 2mas_A Inosine-uridine nucleos  75.5     4.2 0.00017   19.7   8.9   58   21-88      2-63  (314)
 72 3e8x_A Putative NAD-dependent   75.2     2.8 0.00012   20.9   4.0   37   14-51     15-52  (236)
 73 2ivd_A PPO, PPOX, protoporphyr  73.7     2.6 0.00011   21.2   3.5   35   14-50     11-45  (478)
 74 1sez_A Protoporphyrinogen oxid  73.3     3.8 0.00016   20.0   4.2   37   13-50      6-42  (504)
 75 3h7a_A Short chain dehydrogena  72.8     4.8  0.0002   19.3   4.9   37   14-51      1-38  (252)
 76 3dlo_A Universal stress protei  72.0       5 0.00021   19.2   7.7  101   19-148    23-128 (155)
 77 1ps9_A 2,4-dienoyl-COA reducta  71.2     5.2 0.00022   19.0   5.5   92   32-124   229-341 (671)
 78 3d1p_A Putative thiosulfate su  70.9     4.3 0.00018   19.6   4.0   33   73-115    27-59  (139)
 79 3hwr_A 2-dehydropantoate 2-red  70.6     4.3 0.00018   19.6   4.0   32   18-50     17-48  (318)
 80 2yxb_A Coenzyme B12-dependent   70.6     5.3 0.00022   19.0   8.1   63   12-91     10-76  (161)
 81 2c5a_A GDP-mannose-3', 5'-epim  70.4     5.4 0.00023   18.9   5.1   34   17-51     26-60  (379)
 82 1qtw_A Endonuclease IV; DNA re  70.3     1.5 6.5E-05   22.8   1.7   98   25-143     8-108 (285)
 83 3g5j_A Putative ATP/GTP bindin  69.4     3.6 0.00015   20.2   3.4   25   23-47     93-117 (134)
 84 2x4g_A Nucleoside-diphosphate-  69.2     4.9 0.00021   19.2   4.0   36   15-51      8-44  (342)
 85 3ko8_A NAD-dependent epimerase  69.0     2.7 0.00011   21.0   2.7   30   21-51      1-31  (312)
 86 1uls_A Putative 3-oxoacyl-acyl  68.7     5.8 0.00025   18.7   5.6   58   18-95      3-61  (245)
 87 2k0z_A Uncharacterized protein  68.2     4.3 0.00018   19.6   3.6   31   18-48     54-84  (110)
 88 1rpn_A GDP-mannose 4,6-dehydra  67.7       3 0.00013   20.7   2.7   33   21-54     15-48  (335)
 89 1vht_A Dephospho-COA kinase; s  66.9     4.1 0.00017   19.8   3.3   29   21-49      3-33  (218)
 90 1r5b_A Eukaryotic peptide chai  66.6     6.4 0.00027   18.4   4.9   93  283-385   344-464 (467)
 91 3c48_A Predicted glycosyltrans  66.4     6.4 0.00027   18.4   5.3   48    7-54      7-69  (438)
 92 2dwc_A PH0318, 433AA long hypo  66.3     5.6 0.00024   18.8   3.9   76   12-93     11-91  (433)
 93 2bi7_A UDP-galactopyranose mut  65.9     6.6 0.00028   18.3   4.3   31   19-50      2-32  (384)
 94 1qxn_A SUD, sulfide dehydrogen  65.7     5.6 0.00023   18.8   3.7   26  200-234    98-123 (137)
 95 3h2s_A Putative NADH-flavin re  65.5     6.1 0.00026   18.6   3.9   30   21-51      1-31  (224)
 96 2yw2_A Phosphoribosylamine--gl  65.4     6.7 0.00028   18.2   5.4   74   21-97      1-75  (424)
 97 2hhg_A Hypothetical protein RP  65.4     6.7 0.00028   18.2   4.7   10   85-94     38-47  (139)
 98 2pk3_A GDP-6-deoxy-D-LYXO-4-he  65.0     6.8 0.00029   18.2   4.7   41   12-53      4-45  (321)
 99 1xgk_A Nitrogen metabolite rep  64.5     3.8 0.00016   20.0   2.7   60   17-94      2-62  (352)
100 1g63_A Epidermin modifying enz  61.1     5.2 0.00022   19.1   2.9   31   21-51      3-36  (181)
101 2axq_A Saccharopine dehydrogen  60.4     8.2 0.00034   17.6   5.3   55   21-94     24-78  (467)
102 3lls_A 3-ketoacyl-(acyl-carrie  60.2     8.3 0.00035   17.6   7.1   20   21-40     67-86  (475)
103 1vee_A Proline-rich protein fa  60.1       7 0.00029   18.1   3.4   24   22-45     76-99  (134)
104 2ew2_A 2-dehydropantoate 2-red  59.6     8.4 0.00035   17.5   4.1   31   19-50      2-32  (316)
105 3ew7_A LMO0794 protein; Q8Y8U8  59.1     8.6 0.00036   17.5   3.9   30   21-51      1-31  (221)
106 2ph5_A Homospermidine synthase  58.8     5.8 0.00024   18.7   2.8  101   20-145    13-115 (480)
107 2qm3_A Predicted methyltransfe  58.7     8.7 0.00037   17.4   4.7   19   73-91     26-44  (373)
108 3ka7_A Oxidoreductase; structu  58.5     8.8 0.00037   17.4   4.5   29   21-50      1-29  (425)
109 3epw_A IAG-nucleoside hydrolas  58.3     8.9 0.00037   17.4   7.6   61   19-89     12-78  (338)
110 1n7h_A GDP-D-mannose-4,6-dehyd  58.2     5.8 0.00024   18.7   2.7   31   21-52     29-60  (381)
111 2hun_A 336AA long hypothetical  58.1     6.9 0.00029   18.2   3.1   34   19-52      2-37  (336)
112 2fk8_A Methoxy mycolic acid sy  57.9     3.2 0.00013   20.6   1.4   51   19-87     90-140 (318)
113 3i6d_A Protoporphyrinogen oxid  57.4     8.4 0.00035   17.5   3.4   33   17-50      2-40  (470)
114 3i83_A 2-dehydropantoate 2-red  57.3     9.2 0.00039   17.3   4.1   30   20-50      2-31  (320)
115 3dhn_A NAD-dependent epimerase  56.5     7.3 0.00031   18.0   3.0   32   19-51      3-35  (227)
116 1yoe_A Hypothetical protein YB  56.3     9.5  0.0004   17.1   8.6   56   19-84     12-68  (322)
117 2gek_A Phosphatidylinositol ma  56.2     9.6  0.0004   17.1   4.5   46    6-51      6-59  (406)
118 1fmt_A Methionyl-tRNA FMet for  55.0      10 0.00042   17.0   6.5   64   19-91      2-66  (314)
119 3e1y_E Eukaryotic peptide chai  54.8      10 0.00042   17.0   5.5  114  258-386    57-199 (204)
120 3oh8_A Nucleoside-diphosphate   54.7      10 0.00042   17.0   5.4   35   17-52    144-179 (516)
121 1vl0_A DTDP-4-dehydrorhamnose   54.6      10 0.00043   17.0   3.5   38   14-52      6-44  (292)
122 3nbm_A PTS system, lactose-spe  54.6      10 0.00043   17.0   7.6   76   17-94      3-88  (108)
123 2jtq_A Phage shock protein E;   54.0      10 0.00043   16.9   4.1   31   18-48     39-69  (85)
124 3hix_A ALR3790 protein; rhodan  53.6     8.1 0.00034   17.7   2.9   29   18-46     50-78  (106)
125 3hn2_A 2-dehydropantoate 2-red  53.4      11 0.00044   16.8   3.8   30   20-50      2-31  (312)
126 2eg4_A Probable thiosulfate su  53.4      11 0.00044   16.8   4.6   12   75-86     50-61  (230)
127 1npy_A Hypothetical shikimate   53.0      11 0.00045   16.8   4.4   67   18-103     3-73  (271)
128 3ftp_A 3-oxoacyl-[acyl-carrier  53.0      11 0.00045   16.8   6.3   37   14-51     22-59  (270)
129 1t2a_A GDP-mannose 4,6 dehydra  52.3     6.4 0.00027   18.4   2.1   31   22-53     26-57  (375)
130 1kjq_A GART 2, phosphoribosylg  52.2      11 0.00046   16.7   5.3   80   12-94      3-84  (391)
131 1lss_A TRK system potassium up  51.8      11 0.00047   16.7   6.0   57   19-95      3-59  (140)
132 3nrn_A Uncharacterized protein  51.1      11 0.00048   16.6   4.5   29   21-50      1-29  (421)
133 2hpi_A DNA polymerase III alph  51.0      10 0.00043   16.9   3.0   22  127-148   194-217 (1220)
134 3lwb_A D-alanine--D-alanine li  50.9     9.2 0.00039   17.3   2.8   38   14-52      4-50  (373)
135 1zun_B Sulfate adenylate trans  50.4      12 0.00049   16.5   6.7   22   23-44     25-49  (434)
136 3o1l_A Formyltetrahydrofolate   50.1      12  0.0005   16.5   5.8   62   28-95     32-105 (302)
137 2r6j_A Eugenol synthase 1; phe  49.2      12 0.00051   16.4   4.2   58   21-95     12-70  (318)
138 1qzu_A Hypothetical protein MD  49.1      11 0.00045   16.8   2.9   33   19-51     18-54  (206)
139 1z7e_A Protein aRNA; rossmann   48.5      12 0.00052   16.3   3.6   59   21-91      1-60  (660)
140 2ywr_A Phosphoribosylglycinami  48.2      13 0.00053   16.3   5.4   56   21-94      2-61  (216)
141 1jjv_A Dephospho-COA kinase; P  47.9      11 0.00045   16.8   2.8   29   21-49      1-31  (206)
142 3i2v_A Adenylyltransferase and  47.8     5.7 0.00024   18.7   1.3   22   84-115    15-36  (127)
143 3mca_A HBS1, elongation factor  47.2      13 0.00055   16.2   9.1   71  307-385   501-590 (592)
144 3l3b_A ES1 family protein; ssg  46.7      13 0.00056   16.1   5.0   33   19-51     22-62  (242)
145 3mjf_A Phosphoribosylamine--gl  46.2      13 0.00053   16.3   2.9   84   19-104     2-87  (431)
146 3fdf_A FR253; structural genom  45.5      14 0.00058   16.0   4.4   34   17-50      3-37  (195)
147 3c7a_A Octopine dehydrogenase;  44.2      11 0.00046   16.7   2.3   32   20-51      2-33  (404)
148 2p0y_A Hypothetical protein LP  43.5      15 0.00062   15.8   4.6   35   22-57     11-45  (341)
149 2bw0_A 10-FTHFDH, 10-formyltet  43.2      15 0.00063   15.8   8.7   61   16-91     18-79  (329)
150 2k4m_A TR8_protein, UPF0146 pr  43.0      15 0.00063   15.7   3.7   91   35-144    25-121 (153)
151 3edm_A Short chain dehydrogena  42.6      15 0.00064   15.7   5.2   39   12-52      1-40  (259)
152 3nyw_A Putative oxidoreductase  42.6      15 0.00064   15.7   4.3   27   24-51     12-38  (250)
153 2x7v_A Probable endonuclease 4  42.5      11 0.00046   16.7   2.1  103   25-145     8-110 (287)
154 3loq_A Universal stress protei  42.0      16 0.00065   15.6   5.2   34   20-53     22-59  (294)
155 1ks9_A KPA reductase;, 2-dehyd  41.3      16 0.00067   15.6   4.1   29   21-50      1-29  (291)
156 3ius_A Uncharacterized conserv  40.9      16 0.00068   15.5   3.6   53   21-94      6-58  (286)
157 2gb4_A Thiopurine S-methyltran  40.8      10 0.00043   16.9   1.8   16  219-234   161-176 (252)
158 3d1l_A Putative NADP oxidoredu  40.5      16 0.00069   15.5   6.1   56   13-87      3-58  (266)
159 1rsg_A FMS1 protein; FAD bindi  40.4      16 0.00069   15.5   3.8   32   17-49      5-37  (516)
160 3ics_A Coenzyme A-disulfide re  40.4      16 0.00069   15.5   4.5   25  359-385   408-432 (588)
161 3enk_A UDP-glucose 4-epimerase  40.3      16 0.00069   15.5   2.8   29   21-50      6-35  (341)
162 2o2z_A Hypothetical protein; N  40.1      17  0.0007   15.4   4.3   37   21-58      4-40  (323)
163 2ppv_A Uncharacterized protein  40.1      17  0.0007   15.4   3.1   37   19-57      3-39  (332)
164 3fro_A GLGA glycogen synthase;  39.7      17 0.00071   15.4   5.3   33   19-51      1-42  (439)
165 3ghy_A Ketopantoate reductase   38.9      17 0.00073   15.3   3.4   29   21-50      4-32  (335)
166 2h9a_B CO dehydrogenase/acetyl  38.3      18 0.00074   15.2   6.9  106   31-144    73-180 (310)
167 1bxb_A Xylose isomerase; xylos  38.2      12 0.00051   16.4   1.8   99   31-141    33-133 (387)
168 1snn_A DHBP synthase, 3,4-dihy  37.9      18 0.00075   15.2   5.6   66  136-212   138-211 (227)
169 2nmm_A 14 kDa phosphohistidine  37.6      13 0.00054   16.2   1.8   11  376-386    82-92  (135)
170 3crm_A TRNA delta(2)-isopenten  37.5      18 0.00076   15.2   3.2   88   24-123    10-106 (323)
171 2yut_A Putative short-chain ox  37.3      18 0.00077   15.1   3.1   53   21-95      1-54  (207)
172 2if2_A Dephospho-COA kinase; a  37.3      18 0.00075   15.2   2.5   60  172-234   125-184 (204)
173 3cf4_A Acetyl-COA decarbonylas  37.1      13 0.00055   16.2   1.8   96   20-145   240-344 (807)
174 1ccw_A Protein (glutamate muta  36.6      19 0.00079   15.1  10.9   73   19-108     2-78  (137)
175 2hw4_A 14 kDa phosphohistidine  36.2      14 0.00059   16.0   1.8   11  376-386    91-101 (144)
176 3d3w_A L-xylulose reductase; u  36.1      19  0.0008   15.0   5.4   37   14-51      1-38  (244)
177 1h5q_A NADP-dependent mannitol  35.9      19 0.00081   15.0   4.3   37   14-51      8-45  (265)
178 1jkx_A GART;, phosphoribosylgl  35.7      19 0.00081   15.0   6.3   55   21-93      1-59  (212)
179 3grp_A 3-oxoacyl-(acyl carrier  35.2      20 0.00082   14.9   6.0   57   19-95     26-85  (266)
180 3gjz_A Microcin immunity prote  35.0      20 0.00083   14.9   4.0   39   10-48      2-48  (336)
181 2hh8_A Hypothetical protein YD  34.8      20 0.00084   14.9   5.2   87  125-251    24-115 (149)
182 3n7t_A Macrophage binding prot  34.1      20 0.00086   14.8   5.2   39   14-52      3-56  (247)
183 3h9n_A Ribosome maturation fac  34.0      20 0.00086   14.8   3.2   56  243-298   103-171 (177)
184 2qk4_A Trifunctional purine bi  33.9      20 0.00086   14.8   4.7   84   18-103    22-107 (452)
185 3dtt_A NADP oxidoreductase; YP  33.7      21 0.00087   14.7   4.2   32   18-50     17-48  (245)
186 1vhq_A Enhancing lycopene bios  33.6      21 0.00087   14.7   4.7   32   21-52      7-46  (232)
187 1y1p_A ARII, aldehyde reductas  33.0      21 0.00089   14.7   5.7   40   11-51      2-42  (342)
188 1xxl_A YCGJ protein; structura  32.6      21  0.0009   14.6   4.2   57   17-94     20-80  (239)
189 1wg1_A KIAA1579 protein, homol  32.5      16 0.00067   15.6   1.6   32  194-225    16-47  (88)
190 2grj_A Dephospho-COA kinase; T  32.2      22 0.00092   14.6   3.3   29   21-49     11-42  (192)
191 2c2x_A Methylenetetrahydrofola  32.1     9.5  0.0004   17.2   0.4  116   73-227    50-168 (281)
192 2ocg_A Valacyclovir hydrolase;  31.7      22 0.00093   14.5   4.6   67   19-85     21-93  (254)
193 1db3_A GDP-mannose 4,6-dehydra  31.7      22 0.00093   14.5   2.7   30   22-52      3-33  (372)
194 3mc3_A DSRE/DSRF-like family p  31.6      22 0.00094   14.5   5.1   41   14-55      9-56  (134)
195 3g5l_A Putative S-adenosylmeth  31.0      23 0.00096   14.4   2.6   57   18-94     43-101 (253)
196 1zem_A Xylitol dehydrogenase;   30.9      23 0.00096   14.4   6.2   63   16-95      3-68  (262)
197 2dkn_A 3-alpha-hydroxysteroid   30.7      23 0.00097   14.4   2.6   30   21-51      1-32  (255)
198 1hdo_A Biliverdin IX beta redu  30.1      24 0.00099   14.3   4.2   32   20-52      3-35  (206)
199 2jjm_A Glycosyl transferase, g  29.6      24   0.001   14.3   4.1   32   20-51     15-51  (394)
200 3gpi_A NAD-dependent epimerase  29.5      24   0.001   14.3   3.6   30   21-51      4-33  (286)
201 3ggd_A SAM-dependent methyltra  28.8      25   0.001   14.2   2.2   56   20-95     57-113 (245)
202 3ndn_A O-succinylhomoserine su  28.6      25   0.001   14.2   7.4   98   22-145    97-204 (414)
203 2o7s_A DHQ-SDH, bifunctional 3  28.6      25   0.001   14.2   3.5   35   21-55      5-41  (523)
204 3g17_A Similar to 2-dehydropan  28.4      25  0.0011   14.1   2.4   30   20-50      2-31  (294)
205 2p8j_A S-adenosylmethionine-de  28.2      25  0.0011   14.1   6.0   59   17-94     21-82  (209)
206 3nrb_A Formyltetrahydrofolate   27.8      26  0.0011   14.1   4.9   70   19-95      4-88  (287)
207 3hn7_A UDP-N-acetylmuramate-L-  27.8      26  0.0011   14.1   4.5   34   16-50     15-49  (524)
208 2ekp_A 2-deoxy-D-gluconate 3-d  27.5      26  0.0011   14.0   4.0   29   22-51      4-33  (239)
209 1b0a_A Protein (fold bifunctio  27.3      12 0.00051   16.4   0.3  116   73-227    51-169 (288)
210 2rir_A Dipicolinate synthase,   27.2      26  0.0011   14.0   4.4   31   19-50      6-36  (300)
211 2hig_A 6-phospho-1-fructokinas  27.1      26  0.0011   14.0   6.0   74   17-90     94-195 (487)
212 1sau_A Sulfite reductase, desu  27.1     8.9 0.00037   17.4  -0.4   44   69-115    25-69  (115)
213 2qyt_A 2-dehydropantoate 2-red  27.0      26  0.0011   14.0   3.3   36   14-50      2-43  (317)
214 3eph_A TRNA isopentenyltransfe  27.0      26  0.0011   14.0   3.2   90   23-124     6-104 (409)
215 2ppw_A Conserved domain protei  26.9      27  0.0011   14.0   4.3   34   19-52      2-41  (216)
216 3imf_A Short chain dehydrogena  26.5      27  0.0011   13.9   5.2   34   17-51      3-37  (257)
217 3nvq_A Semaphorin-7A; beta-pro  26.1      27  0.0012   13.9   2.7   21  276-296   419-439 (590)
218 1jay_A Coenzyme F420H2:NADP+ o  26.1      27  0.0012   13.9   3.1   28   21-49      1-29  (212)
219 1qyd_A Pinoresinol-lariciresin  25.8      28  0.0012   13.8   5.7   64   19-95      3-67  (313)
220 3bwx_A Alpha/beta hydrolase; Y  25.6      28  0.0012   13.8   3.8   66   20-86     28-97  (285)
221 2zvr_A Uncharacterized protein  25.6      28  0.0012   13.8   4.6  113   11-144    11-133 (290)
222 2g0w_A LMO2234 protein; putati  25.3      28  0.0012   13.8   2.4   86   36-145    41-126 (296)
223 2bll_A Protein YFBG; decarboxy  25.2      28  0.0012   13.8   3.8   32   21-52      1-33  (345)
224 1f60_A Elongation factor EEF1A  25.1      29  0.0012   13.7   8.8   24   21-44      6-32  (458)
225 1bwv_A Rubisco, protein (ribul  25.1      29  0.0012   13.7   2.8   36    8-43     30-70  (493)
226 2raf_A Putative dinucleotide-b  25.0      29  0.0012   13.7   4.1   32   18-50     17-48  (209)
227 1muw_A Xylose isomerase; atomi  25.0      20 0.00083   14.9   1.0  100   31-142    33-134 (386)
228 3btn_A Antizyme inhibitor 1; T  24.9      29  0.0012   13.7   3.8   51   80-140    80-130 (448)
229 2qn6_A Translation initiation   24.2      30  0.0012   13.6   8.6   51  333-384   361-413 (414)
230 1q77_A Hypothetical protein AQ  24.1      30  0.0013   13.6   7.1  105   21-148     5-120 (138)
231 2rfv_A Methionine gamma-lyase;  23.9      30  0.0013   13.6   7.7  100   22-146    80-188 (398)
232 2ag5_A DHRS6, dehydrogenase/re  23.9      30  0.0013   13.6   1.9   32   19-51      5-37  (246)
233 1ryi_A Glycine oxidase; flavop  23.6      30  0.0013   13.5   3.8   26   23-50     21-46  (382)
234 2ew8_A (S)-1-phenylethanol deh  23.4      31  0.0013   13.5   5.0   35   16-51      3-38  (249)
235 3ego_A Probable 2-dehydropanto  23.4      31  0.0013   13.5   4.1   29   20-50      2-30  (307)
236 1qo0_D AMIR; binding protein,   23.4      31  0.0013   13.5   2.9   36   15-50      7-42  (196)
237 1uf9_A TT1252 protein; P-loop,  23.4      31  0.0013   13.5   2.6   27   22-49      8-37  (203)
238 3l6d_A Putative oxidoreductase  23.2      31  0.0013   13.5   4.2   37   12-49      1-37  (306)
239 3i6i_A Putative leucoanthocyan  23.2      31  0.0013   13.5   6.5   61   21-95     11-72  (346)
240 3d33_A Domain of unknown funct  23.1      31  0.0013   13.5   3.4   31  330-360    22-52  (108)
241 2vou_A 2,6-dihydroxypyridine h  22.7      32  0.0013   13.4   5.4   62   16-87      1-65  (397)
242 2l2q_A PTS system, cellobiose-  22.6      32  0.0013   13.4   4.4   75   18-94      2-86  (109)
243 3gvc_A Oxidoreductase, probabl  22.6      32  0.0013   13.4   5.7   32   19-51     28-60  (277)
244 3c5y_A Ribose/galactose isomer  22.5      32  0.0013   13.4   4.2   34   19-52     18-57  (231)
245 2q1w_A Putative nucleotide sug  22.5      32  0.0013   13.4   4.7   42    9-51      9-52  (333)
246 3o2q_B RNA polymerase II subun  22.4      32  0.0013   13.4   4.6   35   16-50     21-56  (214)
247 2w5e_A Putative serine proteas  22.4      25  0.0011   14.2   1.1   16  243-258   129-144 (163)
248 3a8t_A Adenylate isopentenyltr  22.3      32  0.0014   13.4   3.2   96   17-124    36-143 (339)
249 3l07_A Bifunctional protein fo  21.8      19 0.00082   14.9   0.5  117   73-228    52-172 (285)
250 2hfv_A Hypothetical protein RP  21.7      33  0.0014   13.3   1.8   65   19-89     21-93  (97)
251 1tks_A 3,4-dihydroxy-2-butanon  21.6      33  0.0014   13.3   7.1  122   78-213    65-194 (204)
252 1xkq_A Short-chain reductase f  21.4      33  0.0014   13.2   4.6   32   19-51      5-37  (280)
253 1h4r_A Merlin; FERM, neurofibr  21.1      34  0.0014   13.2   3.4   58   26-86      1-58  (314)
254 2nm0_A Probable 3-oxacyl-(acyl  21.0      34  0.0014   13.2   6.0   64   20-84     21-86  (253)
255 2cqp_A RNA-binding protein 12;  21.0      34  0.0014   13.2   2.0   33  194-226    26-65  (98)
256 1sbo_A Putative anti-sigma fac  20.9      34  0.0014   13.2   4.7   83    9-98      1-90  (110)
257 3o8q_A Shikimate 5-dehydrogena  20.9      34  0.0014   13.2   3.2   10   79-88     30-39  (281)
258 2qmo_A Dethiobiotin synthetase  20.9      34  0.0014   13.2   4.7   23   28-50     10-36  (220)
259 1fjh_A 3alpha-hydroxysteroid d  20.8      34  0.0014   13.2   2.8   31   21-52      1-33  (257)
260 3e9m_A Oxidoreductase, GFO/IDH  20.8      34  0.0014   13.2   4.3   58   19-94      4-61  (330)
261 3cg0_A Response regulator rece  20.7      35  0.0015   13.2   5.6   62   12-92      1-62  (140)
262 1sny_A Sniffer CG10964-PA; alp  20.5      35  0.0015   13.1   1.7   44    8-51      8-55  (267)
263 3foz_A TRNA delta(2)-isopenten  20.5      35  0.0015   13.1   3.0   58   25-94     16-74  (316)
264 1qyc_A Phenylcoumaran benzylic  20.4      35  0.0015   13.1   3.7   30   21-51      5-35  (308)
265 3ij5_A 3-deoxy-D-manno-octulos  20.4      35  0.0015   13.1   4.1   27  193-225   121-148 (211)
266 2qjw_A Uncharacterized protein  20.3      35  0.0015   13.1   2.4   60   22-83      6-70  (176)
267 1e6u_A GDP-fucose synthetase;   20.2      26  0.0011   14.1   0.8   29   21-50      4-33  (321)
268 2e1m_A L-glutamate oxidase; L-  20.2      35  0.0015   13.1   4.6   31   19-50     43-73  (376)
269 2d1y_A Hypothetical protein TT  20.1      35  0.0015   13.1   3.8   56   19-95      5-61  (256)

No 1  
>2hma_A Probable tRNA (5-methylaminomethyl-2- thiouridylate)-methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae}
Probab=100.00  E-value=0  Score=947.83  Aligned_cols=362  Identities=36%  Similarity=0.595  Sum_probs=336.9

Q ss_pred             CCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             43467888633889999609857999999998869849999987047876655557788189999999999980995898
Q gi|254780151|r   10 NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        10 ~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      |+|+.+   +++||+|||||||||||||+||++|||||+|+||++|+..+   ..+.||+++|++||++||++|||||++
T Consensus         2 ~~m~~~---~k~rV~v~mSGGVDSsvaA~LL~~~G~~V~gv~m~~~~~~~---~~~~c~~~~d~~da~~va~~LgIp~~~   75 (376)
T 2hma_A            2 NAMSDN---SKTRVVVGMSGGVDSSVTALLLKEQGYDVIGIFMKNWDDTD---ENGVCTATEDYKDVVAVADQIGIPYYS   75 (376)
T ss_dssp             ---CCG---GGSEEEEECCSSHHHHHHHHHHHHTTCEEEEEEEECCCCCC-------CHHHHHHHHHHHHHHHHTCCEEE
T ss_pred             CCCCCC---CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC---CCCCCCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             857778---76889999268799999999999779957999997877877---778778378899999999985998899


Q ss_pred             CCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCC
Q ss_conf             17078866322441126787088612000015411058888874016876452253110254126787731688531578
Q gi|254780151|r   90 FDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDL  169 (408)
Q Consensus        90 ~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~  169 (408)
                      +|++++||++||+||+++|++|+|||||++||++|||++|+++|+++|+||||||||||+...    ..+.+.|+||.|.
T Consensus        76 ~d~~~~f~~~V~~~f~~~y~~G~TPNPcv~CN~~IKF~~l~~~a~~~g~d~iATGHYAri~~~----~~g~~~L~r~~D~  151 (376)
T 2hma_A           76 VNFEKEYWDRVFEYFLAEYRAGRTPNPDVMCNKEIKFKAFLDYAITLGADYVATGHYARVARD----EDGTVHMLRGVDN  151 (376)
T ss_dssp             EECHHHHHHHTHHHHHHHHHTTCCCCHHHHHHHHTTTTHHHHHHHTTTCSEEECCCSEEEEEC----SSSCEEEEECSST
T ss_pred             ECHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCHHHHHHHHHHHHHHHCCCCCCCCCEEEEEEC----CCCCEEEEECCCC
T ss_conf             650899999998989999860379994421123466999999998615662146734213677----9986898851677


Q ss_pred             CCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCC
Q ss_conf             78731898630202210033425689978989999741254355111023011127751034553076643467110377
Q gi|254780151|r  170 ERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN  249 (408)
Q Consensus       170 ~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~  249 (408)
                      +||||||||+|+|++|++++||||+|+|+|||++|+++||++|+||||||||||++++|++||++|++  ++||+|+|.+
T Consensus       152 ~KDQSYfL~~l~~~~L~~~iFPLG~~~K~eVR~iA~~~gl~~a~K~dSq~ICFi~~~~~~~fl~~~~~--~~~G~ivd~~  229 (376)
T 2hma_A          152 GKDQTYFLSQLSQEQLQKTMFPLGHLEKPEVRRLAEEAGLSTAKKKDSTGICFIGEKNFKNFLSNYLP--AQPGRMMTVD  229 (376)
T ss_dssp             TTCCGGGGTTCCHHHHTTEECTTTTCCHHHHHHHHHHTTCTTTTCCCCCSCTTTTTSCHHHHHHTTSC--CCCEEEEETT
T ss_pred             CCCCCEEEEEECHHHHHCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCC--CCCEEEEECC
T ss_conf             77742244432587883666888999778999999875953267645545300379988999886179--9970599589


Q ss_pred             CCEEEEECCCEEEEECCCCCCCCCC-----CCCCEEEECCCCCCEEEEEC---CCCCCCCCEEECCCEECCCCCCCCCCC
Q ss_conf             4322335783153102334335657-----78613763175531256523---555422211200223037765554456
Q gi|254780151|r  250 GQILGRHNGIINYTIGQRRGLGVAM-----GEPLFVVYLDKNSSRVIVGP---RESLEVHRIYLREINWLGDGLFEDAVV  321 (408)
Q Consensus       250 G~viG~H~G~~~yTIGQRkGL~i~~-----~eP~YVv~id~~~N~ViVg~---~~~L~~~~i~l~d~nWi~~~~~~~~~~  321 (408)
                      |++||+|+|+|+|||||||||++++     ++||||++||+++|+|+||+   ++.|+.+.+.+.++||+++.+.    .
T Consensus       230 G~~lG~H~G~~~yTiGQRkGlgi~~~~~~~~~p~yV~~~d~~~N~v~V~~~~~~~~l~~~~~~~~~~~wi~~~~~----~  305 (376)
T 2hma_A          230 GRDMGEHAGLMYYTIGQRGGLGIGGQHGGDNAPWFVVGKDLSKNILYVGQGFYHDSLMSTSLEASQVHFTREMPE----E  305 (376)
T ss_dssp             CCEEEEESCGGGCCTTCBSCTTTTC----CCSCEEEEEEEGGGTEEEEEESTTCGGGEEEEEEEEEEEESSCCCS----S
T ss_pred             CCEEEEECCEEEECCCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEECCCCCHHHHHHCCCEEEEEEECCCCCC----C
T ss_conf             968778689667634654654434666777873699861278878998767312334430241001267477887----8


Q ss_pred             CCEEEEEEEECCCCCCEEEEEEECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCCCCH
Q ss_conf             8718999980178870089998299799997597200069638999738886658887689714555303
Q gi|254780151|r  322 DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDA  391 (408)
Q Consensus       322 ~~~~~~vkiR~~~~pvp~~i~~~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~~~~  391 (408)
                      .+++|.||+||+++++||+++..++.+.|+|++|++||||||+||||++|    +|||||||+++.|+..
T Consensus       306 ~~~~~~vkiRyr~~~~~~~v~~~~~~~~V~f~eP~~avaPGQsaVfYdgd----~vlGGGiI~~~~~~~~  371 (376)
T 2hma_A          306 FTLECTAKFRYRQPDSKVTVHVKGEKTEVIFAEPQRAITPGQAVVFYDGE----ECLGGGLIDNAYRDGQ  371 (376)
T ss_dssp             EEEEEEEESSTTSCCEEEEEEECSSCEEEEEEEEEECCCTTSEEEEEETT----EEEEEEEEEEEESSSS
T ss_pred             CCEEEEEEEEECCCCCCEEEEEECCEEEEEECCCCCCCCCCCEEEEEECC----EEEEEEEECHHCCCCC
T ss_conf             87599999904899855799997998999979999870823469999599----9999999904422586


No 2  
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A*
Probab=100.00  E-value=0  Score=915.19  Aligned_cols=354  Identities=34%  Similarity=0.643  Sum_probs=327.5

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             86338899996098579999999988698499999870478766555577881899999999999809958981707886
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      +.+++||+|||||||||||||+||++|||+|+|+||++|+.++   .+..||+++|++||++||++|||||+++|++++|
T Consensus        14 ~~~~kkV~V~mSGGVDSsvaa~lL~~qG~~V~gv~m~~~~~~~---~~~~c~~~~d~~~a~~va~~LgIp~~~~d~~~~f   90 (380)
T 2der_A           14 SETAKKVIVGMSGGVDSSVSAWLLQQQGYQVEGLFMKNWEEDD---GEEYCTAAADLADAQAVCDKLGIELHTVNFAAEY   90 (380)
T ss_dssp             ---CCEEEEECCSCSTTHHHHHHHHTTCCEEEEEEEECCCCCS---HHHHHHHHHHHHHHHHHHHHHTCCEEEEECHHHH
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECCCCCC---CCCCCCCHHHHHHHHHHHHHCCCCEEEECHHHHH
T ss_conf             7668879998778699999999999779968999998876887---6678884678999999999849977994508976


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHH-CCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             6322441126787088612000015411058888874-016876452253110254126787731688531578787318
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT-RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a-~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      |+.|++||+++|++|+|||||+.||++|||++|+++| +++|+||||||||||+...     ..++.|.||.|.+|||||
T Consensus        91 ~~~V~~~f~~~y~~G~TPNPcv~CN~~iKf~~ll~~a~~~~g~d~iATGHYAr~~~~-----~~~~~L~r~~D~~KDQSY  165 (380)
T 2der_A           91 WDNVFELFLAEYKAGRTPNPDILCNKEIKFKAFLEFAAEDLGADYIATGHYVRRADV-----DGKSRLLRGLDSNKDQSY  165 (380)
T ss_dssp             HHHTHHHHHHHHHTTCCCCHHHHHHHHTTTTHHHHHHHHTTCCSEEECCCSCEEEEE-----TTEEEEECCSSTTTCCGG
T ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCCCCEEHHHHHHHHHHHCCCCEEECCEEEEEECC-----CCCEEEEECCCCCCCCEE
T ss_conf             222457779998758999854011333228999999998669985600037999758-----995778852777778446


Q ss_pred             EEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCCEEEE
Q ss_conf             98630202210033425689978989999741254355111023011127751034553076643467110377432233
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR  255 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~viG~  255 (408)
                      |||+|+|++|++++||||+|+|+|||++|+++||++|+|+||||||||++++|.+||++|++  .+||+|+|.+|++||+
T Consensus       166 fL~~l~~~~L~~~~FPLG~~~K~eVR~iA~~~gl~~a~K~dSq~ICFi~~~~~~~fl~~~~~--~~~G~ivd~~G~~lG~  243 (380)
T 2der_A          166 FLYTLSHEQIAQSLFPVGELEKPQVRKIAEDLGLVTAKKKDSTGICFIGERKFREFLGRYLP--AQPGKIITVDGDEIGE  243 (380)
T ss_dssp             GGSSCCHHHHHHEECCGGGSCHHHHHHHHHHTTCC----------------CHHHHHHTTSC--CCCCEEEETTCCEEEE
T ss_pred             EEEEECHHHHCCEEECCCCCCHHHHHHHHHHCCCCCCCCCCCCCCEECCCCCHHHHHHHHCC--CCCCCEEECCCCEEEE
T ss_conf             76543576505547689788557899999986997567556667454378988999986287--8898789789989758


Q ss_pred             ECCCEEEEECCCCCCCCC-----CCCCCEEEECCCCCCEEEEEC---CCCCCCCCEEECCCEECCCCCCCCCCCCCEEEE
Q ss_conf             578315310233433565-----778613763175531256523---555422211200223037765554456871899
Q gi|254780151|r  256 HNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGP---RESLEVHRIYLREINWLGDGLFEDAVVDGFKCF  327 (408)
Q Consensus       256 H~G~~~yTIGQRkGL~i~-----~~eP~YVv~id~~~N~ViVg~---~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~  327 (408)
                      |+|+|+|||||||||+++     .++||||++||+++|+|+|++   ++.|+++.+.+.++||++..+    ...+++|.
T Consensus       244 H~G~~~yTiGQRkGLgi~~~~~~~~~p~yVv~~d~~~N~V~V~~~~~~~~L~~~~~~~~~~nwi~~~~----~~~~~~~~  319 (380)
T 2der_A          244 HQGLMYHTLGQRKGLGIGGTKEGTEEPWYVVDKDVENNILVVAQGHEHPRLMSVGLIAQQLHWVDREP----FTGTMRCT  319 (380)
T ss_dssp             CSCSTTCCTTCCTTSCCCCCSSSTTCCEEEEEEETTTTEEEEEESTTCTTTCEEEEEEEEEEETTCCC----CCSEEEEE
T ss_pred             ECCEEEEECCCCCCCCCCCCCCCCCCCEEEEEECCCCCEEEEECCCCCCCCCCEEEEEEEEEECCCCC----CCCCEEEE
T ss_conf             77968887567763344677877766339998727764899965877742021058966326547867----79987899


Q ss_pred             EEEECCCCCCEEEEEE-ECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCC
Q ss_conf             9980178870089998-299799997597200069638999738886658887689714555
Q gi|254780151|r  328 VKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKR  388 (408)
Q Consensus       328 vkiR~~~~pvp~~i~~-~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~  388 (408)
                      ||+||+++++||+++. +++.++|+|++||+||||||+||||++|    +|||||||+.+.+
T Consensus       320 vkiRyr~~~~p~~v~~~~~~~~~V~f~eP~~avaPGQ~aVfY~gd----~vLGGGiI~~~~p  377 (380)
T 2der_A          320 VKTRYRQTDIPCTVKALDDDRIEVIFDEPVAAVTPGQSAVFYNGE----VCLGGGIIEQRLP  377 (380)
T ss_dssp             EESSTTCCCEEEEEECCSSSCEEEEEEEEESCCCTTSEEEEEETT----EEEEEEEEEEEEE
T ss_pred             EEECCCCCCCCEEEEEECCCEEEEEECCCCCCCCCCCEEEEEECC----EEEEEEEECCCCC
T ss_conf             998979889886999942998999979999873834379999799----9998899986568


No 3  
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1
Probab=99.91  E-value=2.3e-25  Score=200.57  Aligned_cols=171  Identities=16%  Similarity=0.131  Sum_probs=134.4

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      +-||+|+||||+||+|||++++++|++|+++|+.++          .+.++++.+.|+++|+.|+++++.+++...++..
T Consensus       187 ~gKvlvllSGGiDS~Vaa~ll~k~G~~v~~v~~~~~----------~~~~~~~~e~v~~la~~l~~~~~~i~~~~~~~~~  256 (413)
T 2c5s_A          187 GGKVMVLLSGGIDSPVAAYLTMKRGVSVEAVHFHSP----------PFTSERAKQKVIDLAQELTKYCKRVTLHLVPFTE  256 (413)
T ss_dssp             TEEEEEECCSSSHHHHHHHHHHHBTEEEEEEEEECT----------TTSCHHHHHHHHHHHHHHGGGSSCEEEEEEECHH
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHCCCCCEEEEEEEEHHHH
T ss_conf             783899996696089999999982886368997569----------9899789999999999818972112446622778


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEE
Q ss_conf             24411267870886120000154110588888740168764522531102541267877316885315787873189863
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA  179 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~  179 (408)
                      +...+   +.....+++|+.|++ +++..+.+.|.+.|+++|+|||++.                   |...+....|+.
T Consensus       257 ~~~~~---~~~~~~~~~~~~~rr-~~~~~a~~~A~~~g~~~I~tG~~~~-------------------d~~sq~l~nl~~  313 (413)
T 2c5s_A          257 VQKTI---NKEIPSSYSMTVMRR-MMMRITERIAEERNALAITTGESLG-------------------QVASQTLDSMHT  313 (413)
T ss_dssp             HHHHH---HHHSCGGGHHHHHHH-HHHHHHHHHHHHTTCCEEECCCCSS-------------------STTSCCHHHHHH
T ss_pred             HHHHH---HHHCCCCCCCHHHHH-HHHHHHHHHHHHCCCCEEEECCCCC-------------------CCCHHHHHHHHH
T ss_conf             88877---754468883226899-9999999999855788999877268-------------------660267888765


Q ss_pred             ECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC
Q ss_conf             02022100334256899789899997412543551110230111
Q gi|254780151|r  180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV  223 (408)
Q Consensus       180 l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi  223 (408)
                      ++......++.||.+++|+||+++|+++|++....+.+++.|++
T Consensus       314 ~~~~~~~~iiRPL~~~dK~EI~~~Ak~iGl~~is~~p~~~c~~~  357 (413)
T 2c5s_A          314 INEVTNYPVIRPLITMDKLEIIKIAEEIGTYDISIRPYEDCCTV  357 (413)
T ss_dssp             HGGGCCSCEECTTTTCCHHHHHHHHHHTTCHHHHTSCC------
T ss_pred             CCCCCCCCCCCCCCCCCHHHHHHHHHHCCCCCHHHCCCCCCCEE
T ss_conf             14222676414001699999999999849912322897444356


No 4  
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii OT3} PDB: 2z0c_A 3a4i_A
Probab=99.90  E-value=1.7e-24  Score=194.31  Aligned_cols=227  Identities=21%  Similarity=0.208  Sum_probs=149.9

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             63388999960985799999999886-98499999870478766555577881899999999999809958981707886
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .++.||+|||||||||||+|+|++++ |.+|+|++|.+          +..+..++.+.++..++++||+++++|+.+.|
T Consensus        18 vg~~kVvvalSGGVDSsV~A~L~~kAlGd~v~aV~~d~----------g~~r~~E~~~~~~~~~~~~gi~~~~vd~~~~~   87 (308)
T 2dpl_A           18 VGDSKAIIALSGGVDSSTAAVLAHKAIGDRLHAVFVNT----------GFLRKGEPEFVVKTFRDEFGMNLHYVDAQDRF   87 (308)
T ss_dssp             HTTSCEEEECCSSHHHHHHHHHHHHHHGGGEEEEEEEC----------SCCCTTHHHHHHHHHTTTTCCEEEEEECHHHH
T ss_pred             HCCCCEEEEECCCHHHHHHHHHHHHHHCCCEEEEEECC----------CCCCCCHHHHHHHHHHHCCCCCCEEEECHHHH
T ss_conf             48998999904889999999999997388689999478----------87881279999986640258650799678987


Q ss_pred             HHHCCCCCHHHHHCCCCCCC---EECCCCEEEHHHHHHHHCCCCCCEECCCCC-CCEEEECCCCCCCEEEEEECCCCCCC
Q ss_conf             63224411267870886120---000154110588888740168764522531-10254126787731688531578787
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLP---CVDCNRTVKFSDLLSVTRQLGADVLATGHY-IRSRLYVGDDGKRRRIMCRPMDLERD  172 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNP---c~~CN~~iKF~~l~~~a~~~g~~~iATGHY-ar~~~~~~~~~~~~~~L~r~~D~~KD  172 (408)
                      ...         .+|. .||   |..|.+ +.+..|.+.|+++|++++||||. .....+       +..+.....    
T Consensus        88 ~~~---------l~gv-~~pe~k~~~~~~-~~~~~l~~~A~~~g~~~l~~Gt~~~D~~E~-------~~gikt~~~----  145 (308)
T 2dpl_A           88 FSA---------LKGV-TDPEEKRKIIGR-VFIEVFEEVAKKIGAEYLIQGTIAPDWIES-------QGKIKSHHN----  145 (308)
T ss_dssp             HHH---------TTTC-CCHHHHHHHHHH-HHHHHHHHHHHHHTCSEEECCCCCC-------------------------
T ss_pred             HHH---------HCCC-CCHHHHHHHHHH-HHHHHHHHHHHHCCCCEECCCCCCCCHHHH-------CCCEEEEEC----
T ss_conf             776---------5288-995897627608-999999999998399585134020425541-------353267615----


Q ss_pred             CEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEECCCCCCHHHHH-HCCCCCCCCCC-EECC
Q ss_conf             31898630202210033425689978989999741254--35511102301112775103455-30766434671-1037
Q gi|254780151|r  173 QSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICFVQQGKYFDVVK-RINAGIALEGD-IVHL  248 (408)
Q Consensus       173 QSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICFi~~~~~~~Fl~-~~~~~~~~~G~-ivd~  248 (408)
                          ...+++....+++.||++++|+|||++|+++|||  +.+|+-|-|...-  -.+...+. +.+.. .+..+ |+..
T Consensus       146 ----~Ggl~~~~~~~~iePL~~L~K~EVR~la~~LGlP~~i~~K~P~pgpgl~--i~~~~~it~e~l~~-v~~a~~i~~~  218 (308)
T 2dpl_A          146 ----VGGLPEKLNLKLIEPLRDLYKDEVRELAKFLGLPEKIYNRMPFPGPGLA--VRVIGEVTPEKIRI-VREANAIVEE  218 (308)
T ss_dssp             -----------CCCEEECTTTTCCHHHHHHHHHHTTCCHHHHTCCCCCTTGGG--GGBSSSCCHHHHHH-HHHHHHHHHH
T ss_pred             ----CCCCCHHHCCCHHHHHHHHCHHHHHHHHHHHCCCHHHHCCCCCCCCCCC--CCCCCCCCHHHHHH-HHHHHHHHHH
T ss_conf             ----7886265354412378874569999999980999899288999850124--54586333888874-7999999999


Q ss_pred             CCCEEEEECCCEEEEECCCCCCCCCCCCCCE--EEEC
Q ss_conf             7432233578315310233433565778613--7631
Q gi|254780151|r  249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLF--VVYL  283 (408)
Q Consensus       249 ~G~viG~H~G~~~yTIGQRkGL~i~~~eP~Y--Vv~i  283 (408)
                      .-+.-|.+..-.+.++.+.|..|+-+..+-|  |+.+
T Consensus       219 ~~~~~~~~~~q~~~~l~~~~~vgv~gd~r~y~~~~~~  255 (308)
T 2dpl_A          219 EVERAGLRPWQAFAVLLGVKTVGVQGDIRAYKETIAV  255 (308)
T ss_dssp             HHHHTTCCCSEEEEEECCCCEEEESSSSEEEEEEEEE
T ss_pred             HHHHCCCCCCEEEEEEECCCCCEECCCCCCCCCEEEE
T ss_conf             9998188731004899676162158995554864899


No 5  
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii}
Probab=99.89  E-value=6.8e-24  Score=189.97  Aligned_cols=197  Identities=19%  Similarity=0.200  Sum_probs=135.2

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             86338899996098579999999988698499999870478766555577881899999999999809958981707886
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      ..|.|||+|++|||+||+++|++|++.|++|+++|+.....             ++.+.|+++|++|||||+++++.++|
T Consensus         3 ~~k~~kv~V~~SGG~DS~~la~ll~~~g~~v~~v~~~~~~~-------------~~~~~a~~~a~~lgi~~~~~~~~~~~   69 (203)
T 3k32_A            3 AMKLMDVHVLFSGGKDSSLSAVILKKLGYNPHLITINFGVI-------------PSYKLAEETAKILGFKHKVITLDRKI   69 (203)
T ss_dssp             ---CEEEEEECCCSHHHHHHHHHHHHTTEEEEEEEEECSSS-------------CTTHHHHHHHHHHTCEEEEEECCTHH
T ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCCCEEEEEEECCCC-------------HHHHHHHHHHHHHCCCEEEEECCHHH
T ss_conf             55337089995587899999999997199769999879951-------------47899999999969971898578999


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             63224411267870886120000154110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                      .+.+++.+    .++.+|+||+.   .+++.++...|  .|+++|||||++.-..    ..- ...+.++.         
T Consensus        70 ~~~~~~~~----~~~~~~~~~~~---~~~~~~~~~~a--~~~~~i~tGh~~dD~~----e~~-~~~~~~~~---------  126 (203)
T 3k32_A           70 VEKAADMI----IEHKYPGPAIQ---YVHKTVLEILA--DEYSILADGTRRDDRV----PKL-SYSEIQSL---------  126 (203)
T ss_dssp             HHHHHHHH----HHHSSSHHHHH---HHHHHHHHHHT--TTCSEEECCCCTTCCS----SCC-CHHHHHHH---------
T ss_pred             HHHHHHHH----HHCCCHHHHHH---HHHHHHHHHHH--CCCCEEEECCCCHHHH----CCC-HHHHHCCC---------
T ss_conf             98899999----84698249999---99999999996--6999999728807775----412-08771452---------


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCC-CCCCEE--CCCCCEE
Q ss_conf             8630202210033425689978989999741254355111023011127751034553076643-467110--3774322
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA-LEGDIV--HLNGQIL  253 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~-~~G~iv--d~~G~vi  253 (408)
                          .+......++||+.++|.||+++|+++ +.+..++++.    ++..+|+..++.++.... .+-.+.  ...+.++
T Consensus       127 ----~~~~~~~~~rPL~~~~k~ei~~~a~~~-~~~~~~~s~~----~~~~~y~~~ir~~l~~~~~~~~~~fp~h~~s~v~  197 (203)
T 3k32_A          127 ----EMRKNIQYITPLMGFGYKTLRHLASEF-FILEEIKSGT----KLSSDYEAEIRHILKERGESPEKYFPEHKQTRVV  197 (203)
T ss_dssp             ----HHHHTCEEECGGGGCCHHHHHHHHHHH-EEEEEECC----------CTHHHHHHHHHHHTCCGGGTSCC-CEEEEE
T ss_pred             ----CHHHHHHCCCCCCCCCHHHHHHHHHHC-CCCCCCCCCC----CCCCHHHHHHHHHHHHHCCCHHHCCCCCCCCEEE
T ss_conf             ----022100002533598999999999970-8856688445----7640078999999997078976609765426675


Q ss_pred             EEECC
Q ss_conf             33578
Q gi|254780151|r  254 GRHNG  258 (408)
Q Consensus       254 G~H~G  258 (408)
                      |.++.
T Consensus       198 ~~~~~  202 (203)
T 3k32_A          198 GLKKE  202 (203)
T ss_dssp             EESSC
T ss_pred             EEECC
T ss_conf             44537


No 6  
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A
Probab=99.87  E-value=5.8e-23  Score=183.30  Aligned_cols=162  Identities=20%  Similarity=0.263  Sum_probs=120.5

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCC-EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             338899996098579999999988698-4999998704787665555778818999999999998099589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGY-DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      ..++|+|||||||||||+|+|++++|. +|+|++|..           .++++++..+|+.+|+.|||++..++....+ 
T Consensus        24 g~k~vvvglSGGVDSav~A~La~~a~~~~v~~v~mp~-----------~~~~~~~~~~A~~~a~~Lgi~~~~i~~~~~~-   91 (268)
T 1xng_A           24 GFKKVVYGLSGGLDSAVVGVLCQKVFKENAHALLMPS-----------SVSMPENKTDALNLCEKFSIPYTEYSIAPYD-   91 (268)
T ss_dssp             TCCCEEEECCSSHHHHHHHHHHHHHHGGGEEEEECCC-----------SSSCHHHHHHHHHHHHHHTCCEEECCCHHHH-
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHCCEEEECCC-----------HHCCHHHHHHHHHHHHHHHHCCCCCCHHHHH-
T ss_conf             9981999786889999999999985032267871350-----------1057155799999999833023013279999-


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEE
Q ss_conf             32244112678708861200001541105888887401687645225311025412678773168853157878731898
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL  177 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL  177 (408)
                       .++..++.........|-+    .++++..++..|.+.|...++||++                         +++++.
T Consensus        92 -~~~~~~~~~~~~~~~~n~~----aR~r~~~ly~~a~~~~~~v~gt~n~-------------------------~e~~~g  141 (268)
T 1xng_A           92 -AIFSSHFKDASLTRKGNFC----ARLRMAFLYDYSLKSDSLVIGTSNK-------------------------SERMLG  141 (268)
T ss_dssp             -HHHHHHCTTCCHHHHHHHH----HHHHHHHHHHHHHHHTCEEBCCCCH-------------------------HHHHHT
T ss_pred             -HHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHCCCCCCCCCC-------------------------CCEEEC
T ss_conf             -8888750124567877889----9987888888899709824688775-------------------------431035


Q ss_pred             EEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEE
Q ss_conf             630202210033425689978989999741254--355111023011
Q gi|254780151|r  178 FATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICF  222 (408)
Q Consensus       178 ~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICF  222 (408)
                      +......+...++||++++|+|||++|+.+|+|  +.+|+.|.|+.-
T Consensus       142 ~~t~~gd~~~~~~Pl~~L~K~eVr~LAr~lglP~~ii~k~Ps~~l~~  188 (268)
T 1xng_A          142 YGTLFGDLACAINPIGELFKTEVYELARRLNIPKKILNKPPSADLFV  188 (268)
T ss_dssp             CSCTTTTTCCSEETTTTSCHHHHHHHHHHTTCCHHHHTSCCCCCSST
T ss_pred             CCCCHHHHCCCCCCCCCCCHHHHHHHHHHCCCCHHHCCCCCCCCCCC
T ss_conf             67655542668411469709999999998099699807999989788


No 7  
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp}
Probab=99.86  E-value=3.6e-22  Score=177.65  Aligned_cols=166  Identities=22%  Similarity=0.285  Sum_probs=117.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999980995898170788663
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +..+|+|||||||||||+|+|++++|.+|.+++|..+           +++.+++++|+.+|+.|||+|+++|+...+..
T Consensus        28 ~~~~vvvglSGGVDSav~A~L~~~a~~~v~~v~m~~~-----------~~~~~~~~dA~~la~~Lgi~~~~i~~~~~~~~   96 (249)
T 3fiu_A           28 PAEGFVIGLSGGIDSAVAASLAVKTGLPTTALILPSD-----------NNQHQDMQDALELIEMLNIEHYTISIQPAYEA   96 (249)
T ss_dssp             TCSEEEEECCSSHHHHHHHHHHHHTTSCEEEEECCCT-----------TSCHHHHHHHHHHHHHHTCEEEECCCHHHHHH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEECCCC-----------CCCHHHHHHHHHHHHHCCCCCCHHHHHHHHHH
T ss_conf             9982999677989999999999982987525236876-----------33068999999999871676300246578999


Q ss_pred             HCCCCCHHHHHCCCCCCCEECCCC--EEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEE
Q ss_conf             224411267870886120000154--110588888740168764522531102541267877316885315787873189
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCVDCNR--TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYF  176 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~~CN~--~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYf  176 (408)
                      - ...+-..+..+.++.++..+|-  ++....|+..|...|.-.++|||....                         |+
T Consensus        97 ~-~~~~~~~~~~~~~~~~~~~~N~~ar~r~~~l~~~a~~~~~lv~gt~n~se~-------------------------~~  150 (249)
T 3fiu_A           97 F-LASTQSFTNLQNNRQLVIKGNAQARLRMMYLYAYAQQYNRIVIGTDNACEW-------------------------YM  150 (249)
T ss_dssp             H-HHHTGGGC------CHHHHHHHHHHHHHHHHHHHHHHHTEEEBCCCCHHHH-------------------------HH
T ss_pred             H-HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCH-------------------------HC
T ss_conf             9-999754103354056999876789999989999874159840179864310-------------------------12


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             8630202210033425689978989999741254--35511102301
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      .+..........++||++++|.|||++|+.+|+|  +-+|+=|-|++
T Consensus       151 G~~tk~gd~~~di~Pl~~L~K~eVr~la~~lglP~~ii~k~Psa~L~  197 (249)
T 3fiu_A          151 GYFTKFGDGAADILPLVNLKKSQVFELGKYLDVPKNILDKAPSAGLW  197 (249)
T ss_dssp             TCSCTTTTTCCSBCTTTTCCHHHHHHHHHHTTCCHHHHHSCCCCCSS
T ss_pred             CCCCCCCCCCCCHHHCCCEEHHHHHHHHHHCCCCHHHHCCCCCCCCC
T ss_conf             42454578775434226807999999999819999998189995546


No 8  
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei 1710B}
Probab=99.83  E-value=3.1e-21  Score=170.98  Aligned_cols=166  Identities=27%  Similarity=0.271  Sum_probs=120.8

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHH-------HCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHH-HHHHCCCCEEEC
Q ss_conf             33889999609857999999998-------8698499999870478766555577881899999999-999809958981
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLK-------RDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR-VCDTINVSHYVF   90 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~-------~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~-va~~LgI~~~~~   90 (408)
                      ..++|+|||||||||||+|+|++       ..|+++.++.|.+.           ++++.+..||++ +|+.+|++++++
T Consensus        45 g~k~vVvGlSGGVDSaV~A~L~~~a~g~~~~~g~~~~~v~~~~~-----------~~~~~~~~da~~~~a~~lgi~~~~i  113 (285)
T 3dpi_A           45 GLRACVLGISGGIDSSTAGRLAQLAVERLRASGYDARFVAMRLP-----------YGAQHDEADARRALAFVRADETLTV  113 (285)
T ss_dssp             TCCEEEEECCSSHHHHHHHHHHHHHHHHHHHTTCCCEEEEEECC-----------SCC---CHHHHHHHHHHCCSEEEEC
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEECC-----------CCCCCCHHHHHHHHHHHCCCCCEEE
T ss_conf             99969997888899999999999998873467766379998478-----------7886559999999998538753055


Q ss_pred             CHHHHHHHHCCCCCHHHHHCCCCCCCE------ECCCCE--EEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEE
Q ss_conf             707886632244112678708861200------001541--105888887401687645225311025412678773168
Q gi|254780151|r   91 DYEERFRNAVIVPFASSYAAGETPLPC------VDCNRT--VKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRI  162 (408)
Q Consensus        91 d~~~~f~~~V~~~~~~~y~~G~TPNPc------~~CN~~--iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~  162 (408)
                      |+.+.|     +.++..+..+.++++|      +.||-.  ++...++..|...|.-.++|||+.....  |      + 
T Consensus       114 ~i~~~~-----~~~~~~l~~~~~~~~~~~~~~~~~~Ni~aR~R~~~ly~~A~~~~~lVlgTgNksE~~~--G------y-  179 (285)
T 3dpi_A          114 DVKPAA-----DAMLAALAAGGLAYLDHAQQDFVLGNIKARERMIAQYAVAGARNGVVIGTDHAAESVM--G------F-  179 (285)
T ss_dssp             CCHHHH-----HHHHHHHHHTTCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHTTEEEBCCCCHHHHHH--H------H-
T ss_pred             ECCHHH-----HHHHHHHHHCCCCCCCCCHHHHHHCCHHHHHHHHHHHHHHHHCCCEEEECCCCCCEEE--E------E-
T ss_conf             120588-----8889998751565788412257861579988878899998754988983798761036--5------3-


Q ss_pred             EEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEEECCC
Q ss_conf             853157878731898630202210033425689978989999741254--355111023011127
Q gi|254780151|r  163 MCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDICFVQQ  225 (408)
Q Consensus       163 L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgICFi~~  225 (408)
                      ..+.-|...                -++|||+++|.|||++|+.+|+|  +-+|+-|-|++.+.+
T Consensus       180 ~tk~gD~~~----------------di~PLgdL~K~eVr~lAr~lglP~~Ii~k~Psa~L~~~~~  228 (285)
T 3dpi_A          180 FTKFGDGGA----------------DVLPLAGLTKRRVRALARMLGADEPLVLKTPTADLETLRP  228 (285)
T ss_dssp             HHCCCCCCC----------------SBCTTTTCCHHHHHHHHHHTTCCHHHHTCCCHHHHGGGSC
T ss_pred             EEECCCCHH----------------HHHHHHCCCHHHHHHHHHHHCCCHHHCCCCCCCCCCCCCC
T ss_conf             465176164----------------7988627899999999998489763327998978777899


No 9  
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni}
Probab=99.75  E-value=1.3e-18  Score=152.15  Aligned_cols=159  Identities=21%  Similarity=0.273  Sum_probs=116.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             3388999960985799999999886-984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      +.++|+|||||||||||+|+|++++ |.+|.|++|...           -.++++.++|+++|+.|||+++++++.+.+.
T Consensus        25 g~~~vvlglSGGVDSsv~a~La~~al~~~v~~v~~~~~-----------~~~~~~~~~a~~la~~lgi~~~~~~~~~~~~   93 (249)
T 3p52_A           25 QSQGVVLGLSGGIDSALVATLCKRALKENVFALLMPTQ-----------ISNKANLEDALRLCADLNLEYKIIEIQSILD   93 (249)
T ss_dssp             SCSEEEEECCSSHHHHHHHHHHHHHHTTSEEEEECCSC-----------CSSCHHHHHHHHHHHHHTCEEEECCCHHHHH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCC-----------CCCHHHHHHHHHHHHHHCCCCCEEHHHHHHH
T ss_conf             99829997889889999999999844871799857841-----------1000689999999998177600000146888


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCC--CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEE
Q ss_conf             322441126787088612000015--411058888874016876452253110254126787731688531578787318
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCN--RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSY  175 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN--~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSY  175 (408)
                      ..+...+.        .++-..||  .++++..|+..|...|...+.||+....  ..|      + ...          
T Consensus        94 ~~~~~~~~--------~~~~~~~n~~ar~r~~~l~~~a~~~~~~v~~t~nkse~--~~G------~-~tk----------  146 (249)
T 3p52_A           94 AFIKQSEN--------TTLVSLGNFAARIRMSLLYDYSALKNSLVIGTSNKSEL--LLG------Y-GTI----------  146 (249)
T ss_dssp             HHHTTCSC--------CCHHHHHHHHHHHHHHHHHHHHHHTTEEEBCCCCHHHH--HHT------C-SCT----------
T ss_pred             HHHHCCCC--------CCHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCHHHH--HCC------C-HHH----------
T ss_conf             87510010--------00467889999887899987663528557678855545--257------3-223----------


Q ss_pred             EEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             98630202210033425689978989999741254--35511102301
Q gi|254780151|r  176 FLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       176 fL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                            .......+.||++++|+|||++|+.+|+|  +.+|+-|-|+.
T Consensus       147 ------~gd~~~~~~Pl~~L~K~eVr~La~~lg~p~~ii~k~psa~L~  188 (249)
T 3p52_A          147 ------YGDLACAFNPIGSLYKSEIYALAKYLNLHENFIKKAPSADLW  188 (249)
T ss_dssp             ------TTTTCCSEETTTTSCHHHHHHHHHHTTCCHHHHHC-------
T ss_pred             ------HHHCCCCCCCCCCCCHHHHHHHHHHHCCHHHHCCCCCCCCCC
T ss_conf             ------531565200157978999999999969819870799996767


No 10 
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphatase, transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli K12} SCOP: c.23.16.1 c.26.2.1 d.52.2.1
Probab=99.72  E-value=2.2e-17  Score=143.34  Aligned_cols=168  Identities=23%  Similarity=0.248  Sum_probs=110.0

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH-HHHCCCCEEECC
Q ss_conf             788863388999960985799999999886-984999998704787665555778818999999999-998099589817
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV-CDTINVSHYVFD   91 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~v-a~~LgI~~~~~d   91 (408)
                      +++...+.||++|+||||||||||+||.++ |-+++++|+.+.-   ...        .+.+.+.+. .+++|+++..+|
T Consensus       221 Ir~~Vg~~kVi~~lSGGVDSsV~A~Ll~kAig~~l~cvfvD~Gl---lRk--------~E~~~v~~~~~~~~~~~~~~vd  289 (525)
T 1gpm_A          221 IREQVGDDKVILGLSGGVDSSVTAMLLHRAIGKNLTCVFVDNGL---LRL--------NEAEQVLDMFGDHFGLNIVHVP  289 (525)
T ss_dssp             HHHHHTTCEEEEECCSSHHHHHHHHHHHHHHGGGEEEEEEECSC---SCT--------THHHHHHHHHTTTTCCCEEEEE
T ss_pred             HHHHHCCCEEEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCC---CCC--------CCHHHHHHHHHHHCCCEEEEEC
T ss_conf             99984887079972488216999999987305606899827876---646--------7299999999986297079976


Q ss_pred             HHHHHHHH---CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC-CCCEECCCC-CCCEEEECCCCCCCEEEEEEC
Q ss_conf             07886632---2441126787088612000015411058888874016-876452253-110254126787731688531
Q gi|254780151|r   92 YEERFRNA---VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL-GADVLATGH-YIRSRLYVGDDGKRRRIMCRP  166 (408)
Q Consensus        92 ~~~~f~~~---V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~-g~~~iATGH-Yar~~~~~~~~~~~~~~L~r~  166 (408)
                      .+++|-+.   |.+|=-.--.-|.|         +  ...|-+.|+++ +++|+|.|. |..+.++.+..+.....+...
T Consensus       290 a~~~Fl~~L~gv~dPE~KRkiIG~~---------F--i~vf~~~~~~~~~~~~L~QGTlypDviEs~~~~~~~a~~IKsH  358 (525)
T 1gpm_A          290 AEDRFLSALAGENDPEAKRKIIGRV---------F--VEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSH  358 (525)
T ss_dssp             CHHHHHHHHTTCCCHHHHHHHHHHH---------H--HHHHHHHHHHSSSEEEEECCCCHHHHHHTTC------------
T ss_pred             CHHHHHHHHCCCCCHHHHHCCCCHH---------H--HHHHHHHHHHCCCCEEEECCCCCCHHHHHCCCCCCCCCCEEEE
T ss_conf             1888899754876888960400178---------9--9999999850257708840442440665414778987734765


Q ss_pred             CCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             578787318986302022100334256899789899997412543
Q gi|254780151|r  167 MDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       167 ~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      +..        -.|+...=-+++-||.+|.|+|||++++++|||-
T Consensus       359 HNv--------gglp~~~~~~liEPl~~l~KdEVR~lg~~Lglp~  395 (525)
T 1gpm_A          359 HNV--------GGLPKEMKMGLVEPLKELFKDEVRKIGLELGLPY  395 (525)
T ss_dssp             ------------------CCEEECTTTTCCHHHHHHHHHHTTCCH
T ss_pred             CCC--------CCCCCCCCCCEECHHHHHHHHHHHHHHHHHCCCH
T ss_conf             346--------7651014663004388885899999998729988


No 11 
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway; 2.10A {Thermus thermophilus HB8} PDB: 2ywc_A*
Probab=99.72  E-value=6.8e-17  Score=139.89  Aligned_cols=163  Identities=26%  Similarity=0.306  Sum_probs=111.8

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             88863388999960985799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      ++...+.||++|+||||||||+|+||+++|-+.+++|+.+   +....        .+.+.+.+..+++|+++.++|.++
T Consensus       204 r~~vg~~~Vi~~lSGGVDSsV~A~Ll~kA~~~~~cvfVD~---GllRk--------~E~~~v~~~~~~~~~~~~~vda~~  272 (503)
T 2ywb_A          204 RERAGKDRVLLAVSGGVDSSTLALLLAKAGVDHLAVFVDH---GLLRL--------GEREEVEGALRALGVNLLVVDAKE  272 (503)
T ss_dssp             HHHHTTSEEEEEECSSHHHHHHHHHHHHHTCEEEEEEEEC---SCSCT--------THHHHHHHHHHHTTCCEEEEECHH
T ss_pred             HHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHEEEEEECC---CCCCC--------CHHHHHHHHHHHCCCCEEEEECHH
T ss_conf             9984886179983487065999999999765308999468---76657--------609999999987498589996048


Q ss_pred             HHHHHCCCCCHHHHHCCCCCCCEEC----CCCEEEHHHHHHHHCCCC-CCEECCCC-CCCEEEECCCCCCCEEEEEECCC
Q ss_conf             8663224411267870886120000----154110588888740168-76452253-11025412678773168853157
Q gi|254780151|r   95 RFRNAVIVPFASSYAAGETPLPCVD----CNRTVKFSDLLSVTRQLG-ADVLATGH-YIRSRLYVGDDGKRRRIMCRPMD  168 (408)
Q Consensus        95 ~f~~~V~~~~~~~y~~G~TPNPc~~----CN~~iKF~~l~~~a~~~g-~~~iATGH-Yar~~~~~~~~~~~~~~L~r~~D  168 (408)
                      +|-+.         .+|.| +|---    =+.+  +..|-+.|+++| ++|+|.|. |..+.++.+..+  ...+...+.
T Consensus       273 ~Fl~~---------L~gv~-dPE~KRkiIG~~F--i~vfe~~~~~~~~~~~L~QGTlypDvIES~~~~~--~~~iKsHHN  338 (503)
T 2ywb_A          273 RFLKA---------LKGVE-DPEEKRKIIGREF--VAAFSQVARERGPFRFLAQGTLYPDVIESAGGHG--AAKIKSHHN  338 (503)
T ss_dssp             HHHHH---------HTTCC-CHHHHHHHHHHHH--HHHHHHHHHHHCCCSEEECCCCHHHHHC-----------------
T ss_pred             HHHHH---------HCCCC-CHHHHHHHCCHHH--HHHHHHHHHHCCCCEEEECCCCCCCEECCCCCCC--CCCCCCCCC
T ss_conf             77786---------25987-9589743203899--9999999875489679952761365340367777--777603156


Q ss_pred             CCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             878731898630202210033425689978989999741254
Q gi|254780151|r  169 LERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       169 ~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                              --.|+++.--+++-||-++.|+|||++++++|||
T Consensus       339 --------vgglp~~~~~klvEPl~~lfKdEVR~lg~~Lglp  372 (503)
T 2ywb_A          339 --------VGGLPEDLEFELLEPFRLLFKDEVRELALLLGLP  372 (503)
T ss_dssp             ----------CCCSSCCCEEECTTTTCCHHHHHHHHHHTTCC
T ss_pred             --------CCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHCCC
T ss_conf             --------8864466230045689998578999999986898


No 12 
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Pyrococcus horikoshii OT3}
Probab=99.71  E-value=6e-19  Score=154.57  Aligned_cols=163  Identities=23%  Similarity=0.285  Sum_probs=114.8

Q ss_pred             CCCCCCCCCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             46788863388999960985799999999886-9-849999987047876655557788189999999999980995898
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      .++-+.....+|+|||||||||||+|+|++++ | ..|+|++|..+             +.++.++|+.+|+.|||+++.
T Consensus        14 ~d~~~~~g~~~vvvglSGGVDSav~A~La~~AlG~~~v~~v~~~~~-------------~~~~~~~A~~~~~~lgi~~~~   80 (257)
T 2e18_A           14 LEFIREKGNNGVVIGISGGVDSATVAYLATKALGKEKVLGLIMPYF-------------ENKDVEDAKLVAEKLGIGYKV   80 (257)
T ss_dssp             HHHHHHHCTTCEEEECCSSHHHHHHHHHHHHHHCGGGEEEEECCSS-------------CSTHHHHHHHHHHHHTCEEEE
T ss_pred             HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCC-------------CHHHHHHHHHHHHHHCCCCCE
T ss_conf             9999983999789968877999999999998638641688515765-------------303479999999863787302


Q ss_pred             CCHHHHHHHHCCCCCHHHHHCCCCCCCEECCC----CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEE
Q ss_conf             17078866322441126787088612000015----41105888887401687645225311025412678773168853
Q gi|254780151|r   90 FDYEERFRNAVIVPFASSYAAGETPLPCVDCN----RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCR  165 (408)
Q Consensus        90 ~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN----~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r  165 (408)
                      +++.+.|...     ++    ...++.+-.|-    .+++...|...|...|+-.+.||++.....  +      + ...
T Consensus        81 i~i~~~~~~~-----~~----~l~~~~~~~~~~ni~ar~r~~~l~~~a~~~~~~vl~t~n~se~~~--g------~-~t~  142 (257)
T 2e18_A           81 INIKPIVDSF-----VE----NLELNLDRKGLGNIMSRTRMIMLYAHANSLGRIVLGTSNRSEFLT--G------Y-FTK  142 (257)
T ss_dssp             CCCHHHHHHH-----HH----HHCSCCCHHHHHHHHHHHHHHHHHHHHHHHTCEEECCCCHHHHHH--T------C-SCT
T ss_pred             EECCHHHHHH-----HH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCHHHE--E------C-CCC
T ss_conf             4304789999-----99----864556677788789888689999998863977944787342320--1------3-555


Q ss_pred             CCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             157878731898630202210033425689978989999741254--35511102301
Q gi|254780151|r  166 PMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       166 ~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      .-|..                ..+.||++++|+|||++|+++|+|  +.+|+=|-|++
T Consensus       143 ~gd~~----------------~~~~Pl~dL~K~eVr~La~~Lglp~~ii~r~Psp~L~  184 (257)
T 2e18_A          143 WGDGA----------------SDYAPIINLYKTEVWEIAKRIGVPERIVKKKPSAGLW  184 (257)
T ss_dssp             TSTTC----------------SSBCTTTTSCHHHHHHHHHHHTCCHHHHHSCCCCCSS
T ss_pred             CCCCC----------------CCCCCCCCCCHHHHHHHHHHCCCCHHHHCCCCCCCCC
T ss_conf             67545----------------7765456884999999999849996886069996556


No 13 
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1
Probab=99.71  E-value=2.5e-17  Score=143.05  Aligned_cols=166  Identities=23%  Similarity=0.269  Sum_probs=119.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC-CCEEECCHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809-95898170788663
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN-VSHYVFDYEERFRN   98 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg-I~~~~~d~~~~f~~   98 (408)
                      ++||++|+|||+||||++.+|+++||||+++++.++..             +|++++++.|.++| ++++++|++++|++
T Consensus        14 k~KVvlAySGGLDTSv~l~~L~e~g~eVi~~~~d~Gq~-------------ed~~~~~~kA~~~GA~~~~v~D~r~ef~~   80 (421)
T 1vl2_A           14 KEKVVLAYSGGLDTSVILKWLCEKGFDVIAYVANVGQK-------------DDFVAIKEKALKTGASKVYVEDLRREFVT   80 (421)
T ss_dssp             CCEEEEECCSSHHHHHHHHHHHHTTCEEEEEEEESSCC-------------CCHHHHHHHHHHHTCSEEEEEECHHHHHH
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCH-------------HHHHHHHHHHHHHCCCEEEEECHHHHHHH
T ss_conf             37099993887489999999987799799999979976-------------77899999999849968999860999999


Q ss_pred             HCCCCCHHHHHCCCCCCCEECC-CCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEE
Q ss_conf             2244112678708861200001-541105888887401687645225311025412678773168853157878731898
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCVDC-NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFL  177 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~~C-N~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL  177 (408)
                      +.+.|++.+...-..+.||..+ -|.+--..+.+.|++.|+++||.|...+-        +             ||--|-
T Consensus        81 ~~i~p~I~ana~ye~~Y~l~tslaRplia~~~v~~A~~~ga~~iaHG~TGkG--------N-------------DQvRFe  139 (421)
T 1vl2_A           81 DYIFTALLGNAMYEGRYLLGTAIARPLIAKRQVEIAEKEGAQYVAHGATGKG--------N-------------DQVRFE  139 (421)
T ss_dssp             HTHHHHHTTTCCBTTTBCCHHHHHHHHHHHHHHHHHHHHTCSEEECCCCTTS--------S-------------HHHHHH
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCEEECCCCCCC--------C-------------CCCHHH
T ss_conf             9999999668876786534211115899999999999708748833652477--------7-------------541077


Q ss_pred             EEECCHHH-CEEECCCCCCC-------HHHHHHHHHHCCCCCC---CHHHCCC
Q ss_conf             63020221-00334256899-------7898999974125435---5111023
Q gi|254780151|r  178 FATTQQQL-CDLRFPLGDMK-------KESVRDLAREMGLDIA---DKSDSQD  219 (408)
Q Consensus       178 ~~l~~~~L-~~~~FPlg~~~-------K~eVR~~A~~~gl~~a---~K~eSqg  219 (408)
                      ..+..-.- -+++=|..++.       .++--+.|++.|+|+.   ++|=|.+
T Consensus       140 ~~~~aL~p~~~iiaP~R~~~~~~~~~~R~~~i~ya~~~gI~v~~~~~~pyS~D  192 (421)
T 1vl2_A          140 LTYAALNPNLKVISPWKDPEFLAKFKGRTDLINYAMEKGIPIKVSKKRPYSED  192 (421)
T ss_dssp             HHHHHHCTTSEEECGGGCHHHHHHTC--CHHHHHHHHHTCCCCSSCCCSSEEE
T ss_pred             HHHHHHCCCCCCCCCHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             77987289763158566665654201199999999975999731137886336


No 14 
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A*
Probab=99.69  E-value=8e-17  Score=139.38  Aligned_cols=160  Identities=19%  Similarity=0.167  Sum_probs=115.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-----------CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             3388999960985799999999886-----------98499999870478766555577881899999999999809958
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-----------GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-----------G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      ..++|+|||||||||||+|+|++++           +.++.++.|..+..          ..++|..+|  ++..+++.+
T Consensus        39 ~~k~vVlGLSGGVDSaV~A~L~~~Alg~~~v~~~~~~~~~~~v~mP~~~~----------~~~~d~~~a--~~~~~~~~~  106 (275)
T 1wxi_A           39 FIKSLVLGISGGQDSTLAGKLCQMAINELRLETGNESLQFIAVRLPYGVQ----------ADEQDCQDA--IAFIQPDRV  106 (275)
T ss_dssp             TCCEEEEECCSSHHHHHHHHHHHHHHHHHHHHHCCTTCEEEEEECCSSSC----------TTHHHHHHH--HHHHCCSEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCC----------CCHHHHHHH--HHHHCCCCC
T ss_conf             98859997888788999999999999988763155553189997898676----------425899999--986307655


Q ss_pred             EECCHHHHHHHHCCCCCHHH-HHCCCCCCCEECCCCEEEH--HHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEE
Q ss_conf             98170788663224411267-8708861200001541105--88888740168764522531102541267877316885
Q gi|254780151|r   88 YVFDYEERFRNAVIVPFASS-YAAGETPLPCVDCNRTVKF--SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMC  164 (408)
Q Consensus        88 ~~~d~~~~f~~~V~~~~~~~-y~~G~TPNPc~~CN~~iKF--~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~  164 (408)
                      ..+++...|..     +.+. ...|.++++...||-..++  ..|+.+|...|.-.++|||..-.  ..|      + ..
T Consensus       107 ~~i~i~~~~~~-----~~~~~~~~~~~~~~~~~~N~~aR~R~~~ly~~A~~~~~lVlgTgNksE~--~~G------y-~T  172 (275)
T 1wxi_A          107 LTVNIKGAVLA-----SEQALREAGIELSDFVRGNEKARERMKAQYSIAGMTSGVVVGTDHAAEA--ITG------F-FT  172 (275)
T ss_dssp             EECCCHHHHHH-----HHHHHHHHTCCCCHHHHHHHHHHHHHHHHHHHHHHTTEEEBCCCCHHHH--TTT------C-SC
T ss_pred             CCCCHHHHHHH-----HHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCEEECCCCHHHH--HCC------C-CC
T ss_conf             31570178999-----9987652067666320120257889999999984459878758848777--528------7-13


Q ss_pred             ECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCE
Q ss_conf             3157878731898630202210033425689978989999741254--3551110230
Q gi|254780151|r  165 RPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDI  220 (408)
Q Consensus       165 r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgI  220 (408)
                      ..-|..+|                ++|||++.|.|||++|+.+|+|  +-+|+=|-|+
T Consensus       173 k~GD~~~d----------------i~Pl~~L~K~eVr~La~~lgiP~~Ii~k~Psa~L  214 (275)
T 1wxi_A          173 KYGDGGTD----------------INPLYRLNKRQGKQLLAALACPEHLYKKAPTADL  214 (275)
T ss_dssp             TTTTTCCS----------------BCTTTTCCHHHHHHHHHHTTCCGGGTSCC-----
T ss_pred             CCCCCCCC----------------HHHHHCCCHHHHHHHHHHCCCCHHHCCCCCCCCC
T ss_conf             36776521----------------4557327789999999865999676269999334


No 15 
>1kqp_A NAD+ synthase;, NH(3)-dependent NAD(+) synthetase; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A
Probab=99.68  E-value=2.3e-17  Score=143.28  Aligned_cols=160  Identities=23%  Similarity=0.250  Sum_probs=111.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC--------C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE-
Q ss_conf             3388999960985799999999886--------9-84999998704787665555778818999999999998099589-
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD--------G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHY-   88 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~--------G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~-   88 (408)
                      +..+|+|||||||||||+|+|++++        | ..|.++.|-.             .+.++.++|+.+|+.+++.+. 
T Consensus        37 g~~~vVvGlSGGIDSav~A~L~~~a~~~~~~~~g~~~v~~v~mp~-------------~~~~~~~da~~~~~~~~~~~~~  103 (271)
T 1kqp_A           37 GAKGFVLGISGGQDSTLAGRLAQLAVESIREEGGDAQFIAVRLPH-------------GTQQDEDDAQLALKFIKPDKSW  103 (271)
T ss_dssp             TCCEEEEECCSSHHHHHHHHHHHHHHHHHHHTTCCCEEEEEECCS-------------SSCTTHHHHHHHHHHHCCSEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCC-------------CCCCCHHHHHHHHHHHCCCCEE
T ss_conf             898199979888889999999999999887606885799984687-------------6765699999999860766516


Q ss_pred             ECCHHHHHHHHCCCCCHHHHHCCCCCCCEECC----CCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEE
Q ss_conf             81707886632244112678708861200001----54110588888740168764522531102541267877316885
Q gi|254780151|r   89 VFDYEERFRNAVIVPFASSYAAGETPLPCVDC----NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMC  164 (408)
Q Consensus        89 ~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~C----N~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~  164 (408)
                      .+++.+.     ++.|.+.+.....++++-.|    ..++++..|+..|.+.|+-.++|||..-.  ..|      + ..
T Consensus       104 ~i~I~~~-----~~~~~~~~~~~~~~~~~~~~~~NiqaRiR~~~Ly~~An~~g~lvlgTgNksE~--~~G------y-~T  169 (271)
T 1kqp_A          104 KFDIKST-----VSAFSDQYQQETGDQLTDFNKGNVKARTRMIAQYAIGGQEGLLVLGTDHAAEA--VTG------F-FT  169 (271)
T ss_dssp             ECCCHHH-----HHHHHHHHHHHHSCCCCHHHHHHHHHHHHHHHHHHHHHHHTCEEBCCCCHHHH--TTT------C-SC
T ss_pred             EECCHHH-----HHHHHHHHHHHCCCCCCHHHHHCCCCHHHHHHHHHHHHHCCCEEECCCCCCCC--EEE------E-EE
T ss_conf             8640888-----86766531121023432144525421445589987664369669838971020--100------1-67


Q ss_pred             ECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC--CCCHHHCCCEE
Q ss_conf             3157878731898630202210033425689978989999741254--35511102301
Q gi|254780151|r  165 RPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD--IADKSDSQDIC  221 (408)
Q Consensus       165 r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~--~a~K~eSqgIC  221 (408)
                      ..-|..                .-++|||+++|.|||++|+.+|+|  +-+|+=|-|+.
T Consensus       170 kyGD~~----------------~di~Pi~~L~K~eV~~la~~lgiP~~ii~k~PsaeL~  212 (271)
T 1kqp_A          170 KYGDGG----------------ADLLPLTGLTKRQGRTLLKELGAPERLYLKEPTADLL  212 (271)
T ss_dssp             TTTTTC----------------CSBCTTTTCCHHHHHHHHHHTTCCTHHHHSCCBCCCC
T ss_pred             ECCCCC----------------CCCCCCCCCCHHHHHHHHHHHCCCHHHCCCCCCHHCC
T ss_conf             758787----------------4513233577899999999839987770589981012


No 16 
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens}
Probab=99.66  E-value=2.6e-16  Score=135.72  Aligned_cols=171  Identities=22%  Similarity=0.225  Sum_probs=106.9

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             8863388999960985799999999886-9-8499999870478766555577881899999999999809958981707
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      +...+.||++|+||||||+|+|+||.++ | -.|+++|+.+.   ....        .+.+.+.+..++||+++.++|.+
T Consensus       236 ~~Vg~~kVl~~lSGGVDStV~A~Ll~kAlG~drl~~v~IDnG---lmRk--------~E~~~V~~~~~~lgl~l~~vdas  304 (697)
T 2vxo_A          236 ERVGTSKVLVLLSGGVDSTVCTALLNRALNQEQVIAVHIDNG---FMRK--------RESQSVEEALKKLGIQVKVINAA  304 (697)
T ss_dssp             HHHTTCEEEEECCSSHHHHHHHHHHHHHSCGGGEEEEEEECS---CCCS--------STTHHHHHHHHHTTCCEEEEECH
T ss_pred             HHHCCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCC---CCCC--------CHHHHHHHHHHHCCCCEEEECCH
T ss_conf             862884489950587206999999998516474699982654---4775--------54999999999839967998267


Q ss_pred             HHHHHHCCCC------------CHHHHHCCCCCCCEECCCCEEEHH-----HHHHHHCCCC----CCEECCCC-CCCEEE
Q ss_conf             8866322441------------126787088612000015411058-----8888740168----76452253-110254
Q gi|254780151|r   94 ERFRNAVIVP------------FASSYAAGETPLPCVDCNRTVKFS-----DLLSVTRQLG----ADVLATGH-YIRSRL  151 (408)
Q Consensus        94 ~~f~~~V~~~------------~~~~y~~G~TPNPc~~CN~~iKF~-----~l~~~a~~~g----~~~iATGH-Yar~~~  151 (408)
                      +.|.+..-..            |++ -.+|.| +|-  =.|.| +|     .+-+.+.+++    +.|+|.|. |..+.+
T Consensus       305 ~~F~~~~t~~~~~~~~~~~~~~~l~-~L~gv~-dPE--eKRKI-IG~tFi~Vfe~~~~~~~~~~~~~~L~QGTlypDvIE  379 (697)
T 2vxo_A          305 HSFYNGTTTLPISDEDRTPRKRISK-TLNMTT-SPE--EKRKI-IGDTFVKIANEVIGEMNLKPEEVFLAQGTLRPDLIE  379 (697)
T ss_dssp             HHHHTCCCBCC----------CBCC-CGGGCC-CHH--HHHHH-HHHHHHHHHHHHHHHTCCCTTSEEEECCCSSCCSBC
T ss_pred             HHHHCCCCCCCCCCCCCHHHHHHHH-HHCCCC-CHH--HHHHH-HHHHHHHHHHHHHHHHCCCCCCEEEECCCCCCHHHC
T ss_conf             8641354454333445206788999-752877-889--97656-507659999988877414641104323651703430


Q ss_pred             ECCCCCCCEE-EEEECCCCCCCCEEEEEEECCHH-HC-EEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             1267877316-88531578787318986302022-10-033425689978989999741254
Q gi|254780151|r  152 YVGDDGKRRR-IMCRPMDLERDQSYFLFATTQQQ-LC-DLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       152 ~~~~~~~~~~-~L~r~~D~~KDQSYfL~~l~~~~-L~-~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      +.+..+.... .+...+..        -.|+++. +. +++-||.+|.|+|||++++++|||
T Consensus       380 S~~~~~~~~a~~IKsHHNv--------ggLp~~l~~~~~~vEPLr~LfKDEVR~lG~~LGlP  433 (697)
T 2vxo_A          380 SASLVASGKAELIKTHHND--------TELIRKLREEGKVIEPLKDFHKDEVRILGRELGLP  433 (697)
T ss_dssp             CHHHHHHSCCCGGGSCCSS--------CHHHHHHHHTTCEECGGGGSCHHHHHHHHHHTTCC
T ss_pred             CCCCCCCCCCCCEEEECCC--------CCCCHHHHCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             2566777765545501115--------77744330135403467777479999999986988


No 17 
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus}
Probab=99.63  E-value=3.5e-15  Score=127.59  Aligned_cols=177  Identities=13%  Similarity=0.123  Sum_probs=123.7

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHH----CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCH
Q ss_conf             86338899996098579999999988----69849999987047876655557788189999999999980995898170
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKR----DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDY   92 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~   92 (408)
                      -+++.+|+||+|||+||++.+.+|++    .|++|+++|+.   ++-..     ..+.++.+.++..|+.+|||+++..+
T Consensus        15 ~~~~~~v~va~SGG~DS~~Ll~~l~~~~~~~~~~~~~~hvn---h~lr~-----~~s~~~~~~~~~~~~~~~i~~~~~~~   86 (464)
T 3a2k_A           15 LSEGAAVIVGVSGGPDSLALLHVFLSLRDEWKLQVIAAHVD---HMFRG-----RESEEEMEFVKRFCVERRILCETAQI   86 (464)
T ss_dssp             SSCSSBEEEECCSSHHHHHHHHHHHHHHHTTTCBCEEEEEE---CTTCT-----HHHHHHHHHHHHHHHHTTCEEEEEEC
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEEEE---CCCCC-----CCHHHHHHHHHHHHHHCCCEEEEEEE
T ss_conf             99839899998071999999999999889729859999977---98998-----66699999999999984991999998


Q ss_pred             HHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCC
Q ss_conf             78866322441126787088612000015411058888874016876452253110254126787731688531578787
Q gi|254780151|r   93 EERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERD  172 (408)
Q Consensus        93 ~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KD  172 (408)
                      .           +..+......|+|..| |..++..|.+.|++.|+++|||||.+.=..    + +--..|.||....= 
T Consensus        87 ~-----------~~~~~~~~~~~~e~~a-R~~Ry~~~~~~~~~~~~~~i~~aHh~dD~~----E-T~l~~l~rg~~~~g-  148 (464)
T 3a2k_A           87 D-----------VPAFQRSAGLGAQEAA-RICRYRFFAELMEKHQAGYVAVGHHGDDQV----E-TILMRLVRGSTSKG-  148 (464)
T ss_dssp             C-----------CHHHHTTTTCCSHHHH-HHHHHHHHHHHHHTTTCCEEECCCCHHHHH----H-HHHHHHHHCCCSSS-
T ss_pred             E-----------EEHHHCCCCCCHHHHH-HHHHHHHHHCCCCCCCCCEEEEEEECCCHH----H-HHHHHHHHHCCCCC-
T ss_conf             6-----------0011025898989999-999987641233345631587542047589----9-99987543100123-


Q ss_pred             CEEEEEEECC---HHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC
Q ss_conf             3189863020---22100334256899789899997412543551110230111
Q gi|254780151|r  173 QSYFLFATTQ---QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV  223 (408)
Q Consensus       173 QSYfL~~l~~---~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi  223 (408)
                          |+.++.   ..--.++-||=.++|.|++..|++.+|+..+.+-.++..|.
T Consensus       149 ----l~~~~~~~~~~~~~~iRPll~~~k~ei~~y~~~~~l~~~~D~sN~~~~~~  198 (464)
T 3a2k_A          149 ----YAGIPVKRPFHGGYLIRPFLAVSRAEIEAYCRQMGLSPRCDPSNEKDDYT  198 (464)
T ss_dssp             ----TTCSCSEEECSSSEEECGGGGSCHHHHHHHHHHTCCSSCSCTTCCCTTSH
T ss_pred             ----CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             ----34553213334565778999757999999999848986668997677025


No 18 
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A*
Probab=99.56  E-value=8.6e-15  Score=124.85  Aligned_cols=173  Identities=21%  Similarity=0.251  Sum_probs=115.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-----CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             3388999960985799999999886-----98499999870478766555577881899999999999809958981707
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-----GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-----G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      .+.||+||+|||+||++.+.+|.+.     ..+|..+|+. +...        ..+..|.+.++++|+.+|||+++.+..
T Consensus        23 ~~~kvlva~SGG~DS~~Ll~~l~~l~~~~~~~~i~~~hv~-h~~r--------~~s~~~~~~v~~~~~~~~i~~~~~~~~   93 (317)
T 1wy5_A           23 GERRVLIAFSGGVDSVVLTDVLLKLKNYFSLKEVALAHFN-HMLR--------ESAERDEEFCKEFAKERNMKIFVGKED   93 (317)
T ss_dssp             SCCEEEEECCSSHHHHHHHHHHHHSTTTTTCSEEEEEEEE-CCSS--------THHHHHHHHHHHHHHHHTCCEEEEECC
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEEEE-CCCC--------CCHHHHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             9785999981829999999999999987799809999961-8999--------755999999999999606242211023


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             88663224411267870886120000154110588888740168764522531102541267877316885315787873
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      ..           ...... +.+|-.|-|.+++..|.+.|++.|+++|||||.+.=..    + +--..+.||.     .
T Consensus        94 ~~-----------~~~~~~-~~~~e~~aR~~Ry~~l~~~~~~~~~~~i~~gHh~dD~~----E-T~l~~l~rG~-----~  151 (317)
T 1wy5_A           94 VR-----------AFAKEN-RMSLEEAGRFLRYKFLKEILESEGFDCIATAHHLNDLL----E-TSLLFFTRGT-----G  151 (317)
T ss_dssp             HH-----------HHHHHT-TCCHHHHHHHHHHHHHHHHHHHTTCSEEECCCCHHHHH----H-HHHHHHHHCC-----C
T ss_pred             EE-----------EECCCC-CCCHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCCHH----H-HHHHHHHCCC-----C
T ss_conf             44-----------311479-98878999999998855323431266467613012288----8-9998874287-----7


Q ss_pred             EEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEEC
Q ss_conf             18986302022100334256899789899997412543551110230111
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFV  223 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi  223 (408)
                      ...|+.+.+.. ..++=||-.++|+|+++.|++.+++..+-+-..+..|.
T Consensus       152 ~~gl~~~~~~~-~~i~RPLl~~~k~ei~~y~~~~~i~~~~D~sN~~~~~~  200 (317)
T 1wy5_A          152 LDGLIGFLPKE-EVIRRPLYYVKRSEIEEYAKFKGLRWVEDETNYEVSIP  200 (317)
T ss_dssp             HHHHHCSCSEE-TTEECTTTTCCHHHHHHHHHHTTCCCCCCGGGGTCCHH
T ss_pred             CCCCCCCCCCC-CCCCCHHHCCCHHHHHHHHHHCCCCCCCCCCCCCCCCH
T ss_conf             67887766543-32166044177999999999759997889989986330


No 19 
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATP, ATPase, PP-type, PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1
Probab=99.42  E-value=6.5e-13  Score=111.40  Aligned_cols=167  Identities=20%  Similarity=0.220  Sum_probs=104.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHH-----CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             338899996098579999999988-----698499999870478766555577881899999999999809958981707
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKR-----DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~-----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      +++||+||+|||+||++.+.+|.+     .|+++..+|+   +++-..      -+.+|.+.+++.|+.+|||+++.++.
T Consensus        12 ~~~~vlva~SGG~DS~~ll~~l~~~~~~~~~~~~~~~h~---~h~~r~------~s~~~~~~v~~~~~~~~i~~~~~~~~   82 (433)
T 1ni5_A           12 TSRQILVAFSGGLDSTVLLHQLVQWRTENPGVALRAIHV---HHGLSA------NADAWVTHCENVCQQWQVPLVVERVQ   82 (433)
T ss_dssp             TCSEEEEECCSBHHHHHHHHHHHHHHTTSTTCEEEEEEE---CCSCCS------SHHHHHHHHHHHHHHTTCCEEEECCC
T ss_pred             CCCEEEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEEE---ECCCCC------CHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             998299998180999999999999897589981999998---298895------57999999999999759978999996


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCC
Q ss_conf             88663224411267870886120000154110588888740168764522531102541267877316885315787873
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQ  173 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQ  173 (408)
                      ..      .       .|..   +=.+-|...+..+  .+...++++|||||.+.=..    + +--..|.||....=  
T Consensus        83 ~~------~-------~~~~---~e~~aR~~Ry~~~--~~~~~~~~~i~~aHh~dD~~----E-t~l~~l~rg~~~~g--  137 (433)
T 1ni5_A           83 LA------Q-------EGLG---IEAQARQARYQAF--ARTLLPGEVLVTAQHLDDQC----E-TFLLALKRGSGPAG--  137 (433)
T ss_dssp             CC------C-------SSST---TTTHHHHHHHHHH--HHTCCTTEEEECCCCHHHHH----H-HHHHHHTTTCCTTG--
T ss_pred             CC------C-------CCCC---HHHHHHHHHHHHH--HHHHCCCCEEEEEEECHHHH----H-HHHHHHHCCCCCCC--
T ss_conf             47------8-------8888---7999999999987--86541657032200110389----9-99998725776433--


Q ss_pred             EEEEEEECCH---HHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEE
Q ss_conf             1898630202---210033425689978989999741254355111023011
Q gi|254780151|r  174 SYFLFATTQQ---QLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICF  222 (408)
Q Consensus       174 SYfL~~l~~~---~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICF  222 (408)
                         |++++..   .-.+++-||=.++|.|+++.|++.+|+--+-+-.++.-|
T Consensus       138 ---l~~~~~~~~~~~~~i~RPlL~~~k~ei~~y~~~~~i~~~eD~SN~d~~y  186 (433)
T 1ni5_A          138 ---LSAMAEVSEFAGTRLIRPLLARTRGELVQWARQYDLRWIEDESNQDDSY  186 (433)
T ss_dssp             ---GGCCCSEEEETTEEEECGGGSCCHHHHHHHHHHTTCCCBCCCCGGGTTS
T ss_pred             ---CCCCCCEECCCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCCCCCCCHH
T ss_conf             ---4343222115785088750018699999998746776203667776113


No 20 
>1k92_A Argininosuccinate synthase, argininosuccinate; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A*
Probab=99.36  E-value=1.2e-12  Score=109.51  Aligned_cols=169  Identities=20%  Similarity=0.215  Sum_probs=109.3

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHH
Q ss_conf             88863388999960985799999999886984999998704787665555778818999999999998099-58981707
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYE   93 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~   93 (408)
                      +.-|+.+||++|.|||.|+||++..|+++|++|++++..+.-..           ++|++.+++-|.++|. +++++|++
T Consensus         5 ~~~~~gkKVvLAySGGLDTSv~l~wL~e~g~eVia~~~DvGQ~~-----------~ed~e~i~~kA~~~GA~~~~viD~r   73 (455)
T 1k92_A            5 KHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANLGQPD-----------EEDYDAIPRRAMEYGAENARLIDCR   73 (455)
T ss_dssp             CSCCTTSEEEEECCSSHHHHHHHHHHHHTTCEEEEEEEECCCTT-----------CSCTTHHHHHHHHHTCSEEEEEECH
T ss_pred             HHCCCCCEEEEEECCCCHHHHHHHHHHHCCCEEEEEEEECCCCC-----------HHHHHHHHHHHHHHCCCEEEEECCH
T ss_conf             31998988999948982899999999974986999999799985-----------0417999999997199789997189


Q ss_pred             HHHHHHCCCCCHHHHHC------CCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECC
Q ss_conf             88663224411267870------886120000154110588888740168764522531102541267877316885315
Q gi|254780151|r   94 ERFRNAVIVPFASSYAA------GETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPM  167 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~------G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~  167 (408)
                      ++|+++.+ |.+..-+.      |.-|+--.+ -|.+-=..+.+.|++.|++.||.|-     +   ..++         
T Consensus        74 ~eF~~~~i-~~i~a~a~y~~~~~~~Y~l~tsl-aRplia~~~v~~A~~~ga~aiaHG~-----T---GkGN---------  134 (455)
T 1k92_A           74 KQLVAEGI-AAIQCGAFHNTTGGLTYFNTTPL-GRAVTGTMLVAAMKEDGVNIWGDGS-----T---YKGN---------  134 (455)
T ss_dssp             HHHHHHHH-HHHHHTCCCCEETTEECCCHHHH-HHHHHHHHHHHHHHHTTCCEEECCC-----C---TTSS---------
T ss_pred             HHHHHHHH-HHHHHCHHHHHCCCCCCCCCCCC-HHHHHHHHHHHHHHHCCCCEEECCC-----C---CCCC---------
T ss_conf             99999989-99985535541035665476520-8988999999999982992995476-----6---6765---------


Q ss_pred             CCCCCCEEE-E--EEECCHHHCEEECCCCCC-------CHHHHHHHHHHCCCCCC---CHHHCCC
Q ss_conf             787873189-8--630202210033425689-------97898999974125435---5111023
Q gi|254780151|r  168 DLERDQSYF-L--FATTQQQLCDLRFPLGDM-------KKESVRDLAREMGLDIA---DKSDSQD  219 (408)
Q Consensus       168 D~~KDQSYf-L--~~l~~~~L~~~~FPlg~~-------~K~eVR~~A~~~gl~~a---~K~eSqg  219 (408)
                          ||-=| +  ..+.+ .| +++=|..++       +-++-.+.|++.|+|+.   +|+=|.|
T Consensus       135 ----DQvRFe~~~~al~P-~l-~viaPwRd~~~~~~~~sR~~~i~ya~~~gIpv~~~~~~~ySiD  193 (455)
T 1k92_A          135 ----DIERFYRYGLLTNA-EL-QIYKPWLDTDFIDELGGRHEMSEFMIACGFDYKMSVEKAYSTD  193 (455)
T ss_dssp             ----HHHHHHHHHHHHCT-TC-EEECGGGCHHHHHHSSSHHHHHHHHHHTTCCCCCCCCCSSEEE
T ss_pred             ----CHHHHHHHHHHCCC-CC-EEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCEEC
T ss_conf             ----05657778974099-86-3556845066787776599999989971999887678885023


No 21 
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A*
Probab=99.36  E-value=9e-13  Score=110.39  Aligned_cols=162  Identities=22%  Similarity=0.336  Sum_probs=111.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHHHHH
Q ss_conf             88999960985799999999886-984999998704787665555778818999999999998099-5898170788663
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEERFRN   98 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~f~~   98 (408)
                      |||++|.|||.|+|+++..|+++ |+||++++..+..             .+|++.+++-|..+|. +++++|++++|.+
T Consensus         1 mKVvLAySGGLDTSv~l~wL~e~~~~eVi~~~~d~Gq-------------~~d~~~i~~kA~~~GA~~~~v~D~r~ef~~   67 (400)
T 1kor_A            1 MKIVLAYSGGLDTSIILKWLKETYRAEVIAFTADIGQ-------------GEEVEEAREKALRTGASKAIALDLKEEFVR   67 (400)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHHTCEEEEEEEESSC-------------SSCHHHHHHHHHHHTCSEEEEEECHHHHHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEEEEECCC-------------HHHHHHHHHHHHHHCCCEEEEECCHHHHHH
T ss_conf             9699994898179999999974059889999970886-------------676699999999849988999757999999


Q ss_pred             HCCCCCHHHHH--CCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEE---EEECCCCCCCC
Q ss_conf             22441126787--08861200001541105888887401687645225311025412678773168---85315787873
Q gi|254780151|r   99 AVIVPFASSYA--AGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRI---MCRPMDLERDQ  173 (408)
Q Consensus        99 ~V~~~~~~~y~--~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~---L~r~~D~~KDQ  173 (408)
                      +.+-|++.+-.  .|.-|.-+..--+.| =..+.+.|++.|+++||.|-=.        .++....   -.++.++.   
T Consensus        68 ~~i~p~i~ana~Ye~~Y~l~tslaRpli-a~~~v~~A~~~ga~~iaHG~TG--------kGNDQvRFe~~~~al~P~---  135 (400)
T 1kor_A           68 DFVFPMMRAGAVYEGYYLLGTSIARPLI-AKHLVRIAEEEGAEAIAHGATG--------KGNDQVRFELTAYALKPD---  135 (400)
T ss_dssp             HTHHHHHHTTCCBTTTBCCTTTTHHHHH-HHHHHHHHHHHTCSEEECCCCT--------TSSHHHHHHHHHHHHCTT---
T ss_pred             HHHHHHHHCCCCCCCCCCCCCCCHHHHH-HHHHHHHHHHCCCEEEECCCCC--------CCCCHHHHHHHHHHHCCC---
T ss_conf             9999999738655787623454106479-9999999854497699437775--------787236688899975999---


Q ss_pred             EEEEEEECCHHHCEEECCCCCC---CHHHHHHHHHHCCCCCCC---HHHCCC
Q ss_conf             1898630202210033425689---978989999741254355---111023
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDM---KKESVRDLAREMGLDIAD---KSDSQD  219 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~---~K~eVR~~A~~~gl~~a~---K~eSqg  219 (408)
                                 + +++=|..++   +.++--+.|++.|+|+..   |+=|+|
T Consensus       136 -----------l-~iiaPwRd~~~~sR~~~i~ya~~~gIpv~~~~~~~yS~D  175 (400)
T 1kor_A          136 -----------I-KVIAPWREWSFQGRKEMIAYAEAHGIPVPVTQEKPYSMD  175 (400)
T ss_dssp             -----------C-EEECGGGTCCCCSHHHHHHHHHHTTCCCC-----CCEEE
T ss_pred             -----------C-EEECCCHHCCCCCHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             -----------7-485010102536679999999984999865678887546


No 22 
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, structural genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens}
Probab=99.36  E-value=2.3e-12  Score=107.48  Aligned_cols=163  Identities=22%  Similarity=0.315  Sum_probs=112.6

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC-CEEECCHHHHHHH
Q ss_conf             388999960985799999999886984999998704787665555778818999999999998099-5898170788663
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV-SHYVFDYEERFRN   98 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI-~~~~~d~~~~f~~   98 (408)
                      +.||++|+|||.|+|+++..|+++|+||++++..+..             .+|++.+++-|..+|. +++++|++++|.+
T Consensus         5 k~kVvLAySGGLDTSv~l~wL~e~g~eVia~~~d~Gq-------------~~d~~~i~~kA~~~GA~~~~v~D~r~ef~~   71 (413)
T 2nz2_A            5 KGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQ-------------KEDFEEARKKALKLGAKKVFIEDVSREFVE   71 (413)
T ss_dssp             CEEEEEECCSSHHHHHHHHHHHHTTEEEEEEEEESSC-------------CCCHHHHHHHHHHHTCSEEEEEECHHHHHH
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEEEEECCC-------------HHHHHHHHHHHHHHCCCEEEEECCHHHHHH
T ss_conf             8879999089827999999999749869999996998-------------788899999999839988999717999999


Q ss_pred             HCCCCCHHHHH--CCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEE---EEECCCCCCCC
Q ss_conf             22441126787--08861200001541105888887401687645225311025412678773168---85315787873
Q gi|254780151|r   99 AVIVPFASSYA--AGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRI---MCRPMDLERDQ  173 (408)
Q Consensus        99 ~V~~~~~~~y~--~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~---L~r~~D~~KDQ  173 (408)
                      +.+-|++.+-.  .|.-|.-+...-+.| =..+.+.|++.|+++||.|-=-        .++....   -.++.++.   
T Consensus        72 ~~i~p~i~ana~yeg~Y~l~tslaRpli-a~~~v~~A~~~ga~~vaHG~TG--------kGNDQvRFe~~~~aL~P~---  139 (413)
T 2nz2_A           72 EFIWPAIQSSALYEDRYLLGTSLARPCI-ARKQVEIAQREGAKYVSHGATG--------KGNDQVRFELSCYSLAPQ---  139 (413)
T ss_dssp             HTHHHHHHTTCCBTTTBCCTTTTHHHHH-HHHHHHHHHHHTCSEEECCCCT--------TSSHHHHHHHHHHHHCTT---
T ss_pred             HHHHHHHHHCCCCCCCCCCCCCCHHHHH-HHHHHHHHHHCCCEEEECCCCC--------CCCHHHHHHHHHHHHCCC---
T ss_conf             9999999736455887312455218799-9999999998399798358776--------863688899999986999---


Q ss_pred             EEEEEEECCHHHCEEECCCCCC-------CHHHHHHHHHHCCCCCC---CHHHCCC
Q ss_conf             1898630202210033425689-------97898999974125435---5111023
Q gi|254780151|r  174 SYFLFATTQQQLCDLRFPLGDM-------KKESVRDLAREMGLDIA---DKSDSQD  219 (408)
Q Consensus       174 SYfL~~l~~~~L~~~~FPlg~~-------~K~eVR~~A~~~gl~~a---~K~eSqg  219 (408)
                         |         +++=|..++       +-+|--+.|++.|+|+.   +++=|.+
T Consensus       140 ---~---------~viaP~Rd~~~~~~~~sR~e~i~y~~~~gi~v~~~~~~~yS~D  183 (413)
T 2nz2_A          140 ---I---------KVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWSMD  183 (413)
T ss_dssp             ---C---------EEECGGGCHHHHTTCC-CHHHHHHHHHTTCCCCSSCCCSSCEE
T ss_pred             ---C---------CCCCCHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCCEEC
T ss_conf             ---7---------0256331256665307899999999985999876678775145


No 23 
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1
Probab=99.28  E-value=6.6e-12  Score=104.18  Aligned_cols=163  Identities=18%  Similarity=0.098  Sum_probs=107.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH--
Q ss_conf             889999609857999999998869849999987047876655557788189999999999980995898170788663--
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN--   98 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~--   98 (408)
                      +|++|.||||+||+++|++|+++|++|+++|+.. ..          ....+.+.++..+..++..++.++....+..  
T Consensus         3 kk~VvL~SGGlDS~v~a~~l~~~g~~v~~l~~~y-Gq----------~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~   71 (232)
T 2pg3_A            3 KRAVVVFSGGQDSTTCLIQALQDYDDVHCITFDY-GQ----------RHRAEIEVAQELSQKLGAAAHKVLDVGLLNELA   71 (232)
T ss_dssp             CEEEEECCSSHHHHHHHHHHHHHCSEEEEEEEES-SS----------SCHHHHHHHHHHHHHHTCSEEEEEECTHHHHTS
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCEEEEEEEEC-CC----------CHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHCC
T ss_conf             8699983680899999999997699699999979-98----------329999999986654310121012045554135


Q ss_pred             ------HCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCC
Q ss_conf             ------22441126787088612000015411058888874016876452253110254126787731688531578787
Q gi|254780151|r   99 ------AVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERD  172 (408)
Q Consensus        99 ------~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KD  172 (408)
                            .....+...+....+|+.++.+...+-+.....+|...+++.+++|....       +... +     .|..  
T Consensus        72 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~l~~a~~~a~~~~~~~~~~G~~~~-------d~~~-~-----~d~~--  136 (232)
T 2pg3_A           72 TSSLTRDSIPVPDYDANAQGIPNTFVPGRNILFLTLASIYAYQVGAEAVITGVCET-------DFSG-Y-----PDCR--  136 (232)
T ss_dssp             HHHHHHTTCCCCC---------CCCCTTHHHHHHHHHHHHHHHHTCSEEECCCCSC-------SSSC-C-----GGGS--
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCEEEECCHHHHHHHHHHHHHHCCCCCCCCCCCCC-------CCCC-C-----CCCC--
T ss_conf             65433444444321100236652353013088789999999983997531244466-------6667-7-----7644--


Q ss_pred             CEEE--EEE---ECCHHHCEEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             3189--863---020221003342568997898999974125
Q gi|254780151|r  173 QSYF--LFA---TTQQQLCDLRFPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       173 QSYf--L~~---l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl  209 (408)
                      +.|+  +..   +....--++.+|+-.+||.||.+++.+.+.
T Consensus       137 ~~f~~~~~~~~~~~~~~~~~i~~P~~~~tK~Ei~~~~~~~~~  178 (232)
T 2pg3_A          137 DEFVKALNQAIVLGIARDIRFETPLMWLNKAETWALADYYQQ  178 (232)
T ss_dssp             HHHHHHHHHHHHHHHTSCCEEECTTTTCCHHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEEECCCCCHHHHHHHHHHHCC
T ss_conf             869999999998557777269950225888999998543123


No 24 
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis}
Probab=99.24  E-value=1.3e-11  Score=101.98  Aligned_cols=170  Identities=21%  Similarity=0.173  Sum_probs=107.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999980995898170788663
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN   98 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~   98 (408)
                      +++|++|.||||+||+++|++|+++|++|+++|+..+..           +.+....++.+++.+.+.++..........
T Consensus         2 ~k~k~vvl~SGGlDS~~~a~~l~~~g~~v~~l~~~ygq~-----------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   70 (219)
T 3bl5_A            2 KKEKAIVVFSGGQDSTTCLLWALKEFEEVETVTFHYNQR-----------HSQEVEVAKSIAEKLGVKNHLLDMSLLNQL   70 (219)
T ss_dssp             -CCEEEEECCSSHHHHHHHHHHHHHCSEEEEEEEESSCT-----------TCHHHHHHHHHHHTTCCCEEEEECGGGGGG
T ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCC-----------CCHHHHHHHHHHHHHHHHCCCCHHHHHHHH
T ss_conf             977399995881889999999998799699999988864-----------210457789999985200011103344442


Q ss_pred             HCCCC----CHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCE
Q ss_conf             22441----12678708861200001541105888887401687645225311025412678773168853157878731
Q gi|254780151|r   99 AVIVP----FASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQS  174 (408)
Q Consensus        99 ~V~~~----~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQS  174 (408)
                      .....    ..........|...+.+...+.+....-.|...|++.+++|.-..-... ..+..  +...       |..
T Consensus        71 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~-~~~~~--~~f~-------~~~  140 (219)
T 3bl5_A           71 APNALTRNDIEIEVKDGELPSTFVPGRNLVFLSFASILAYQIGARHIITGVCETDFSG-YPDCR--DEFV-------KSC  140 (219)
T ss_dssp             STGGGC--------------CCCCTTHHHHHHHHHHHHHHHHTCSEEECCCCC----C-CGGGS--HHHH-------HHH
T ss_pred             CCCCCCCCCHHHHHHCCCCCCEEEEHHHHHHHHHHHHHHHHCCCCCEEECCCCCCCCC-CCCCC--HHHH-------HHH
T ss_conf             0242111203544301455534786103677789999988603441574225666557-89983--7899-------999


Q ss_pred             EEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             89863020221003342568997898999974125
Q gi|254780151|r  175 YFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       175 YfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl  209 (408)
                      .-+..+....--+++.|+..++|.||.+++.++|+
T Consensus       141 ~~~~~~~~~~~~~~~~P~~~~~K~eii~~~~~~~~  175 (219)
T 3bl5_A          141 NVTVNLAMEKPFVIHTPLMWLNKAETWKLADELGA  175 (219)
T ss_dssp             HHHHHHHHTSCCEEECTTTTCCHHHHHHHHHHTTC
T ss_pred             HHHHHHCCCCCEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             99997444550389724003729999999998289


No 25 
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis}
Probab=99.14  E-value=1.9e-11  Score=100.82  Aligned_cols=148  Identities=24%  Similarity=0.250  Sum_probs=98.9

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHC-C-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             8863388999960985799999999886-9-8499999870478766555577881899999999999809958981707
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRD-G-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~-G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      +...-++++||+|||+||+++|+|..++ | -+|+|++|-           +...+++...+|+.+|+.|||.++.+++.
T Consensus       322 ~~~g~~~~v~glSGGiDSal~a~la~~alg~~~v~~~~mP-----------~~~ss~~t~~~a~~l~~~lg~~~~~~~i~  390 (590)
T 3n05_A          322 AKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMP-----------SKYSSDHSKGDAAELARRTGLNFRTVSIE  390 (590)
T ss_dssp             HTTTCCCEEEECCSSHHHHHHHHHHHHHHCGGGEEEEECC-----------CSSCCHHHHHHHHHHHHHHTCEEEECCSH
T ss_pred             HHHCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCEEEECC-----------CCCCCCCCHHHHHHHHHHCCCCCCCEECH
T ss_conf             9819986999637993289999999985188651135468-----------66674020999999999719973214317


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCCCEECCCC--EEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCC
Q ss_conf             88663224411267870886120000154--1105888887401687645225311025412678773168853157878
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPLPCVDCNR--TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER  171 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPNPc~~CN~--~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~K  171 (408)
                      +.+...     +...    .+..-..=|-  ++.--.|+..|.+.|.=.+.||.-.-..  .|      +.-.. -|   
T Consensus       391 ~~~~~~-----~~~~----~~~~~~~eN~qar~R~~~l~~~a~~~~~lvl~t~n~sE~a--lG------~~t~~-gd---  449 (590)
T 3n05_A          391 PMFDAY-----MASL----GLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELA--VG------YSTLY-GD---  449 (590)
T ss_dssp             HHHHHH-----HHHH----CCCTHHHHHHHHHHHHHHHHHHHHHHTCEEBCCCCHHHHH--HT------CCCSS-CT---
T ss_pred             HHHHHH-----HHHC----CCCCHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCHHHHH--HC------CCEEC-CC---
T ss_conf             999999-----8621----3341356777887748999998714693796378674676--37------51113-67---


Q ss_pred             CCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCC
Q ss_conf             7318986302022100334256899789899997412
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMG  208 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~g  208 (408)
                                   ....+-|+|++.|.+|+.+|+.++
T Consensus       450 -------------~~~~~~p~~~l~Kt~v~~l~~~~~  473 (590)
T 3n05_A          450 -------------SVGAYGPIKDVYKTSIFRLAEWRN  473 (590)
T ss_dssp             -------------TSCSBCTTTTSCHHHHHHHHHHHH
T ss_pred             -------------CCCCCEECCCCCHHHHHHHHHHHH
T ss_conf             -------------763200037853999999999985


No 26 
>3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis}
Probab=98.99  E-value=8e-11  Score=96.43  Aligned_cols=152  Identities=18%  Similarity=0.233  Sum_probs=93.6

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-C------CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             3388999960985799999999886-9------84999998704787665555778818999999999998099589817
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-G------YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G------~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      .-+++++|+|||+||+++|++..++ |      -+|++++|-..           -.+++...+|+.+|+.|||.|+.++
T Consensus       360 g~~~~vlglSGGiDSal~a~la~~a~~~~~~~~~~v~~~~mps~-----------~ss~~s~~~A~~la~~lg~~~~~i~  428 (680)
T 3dla_A          360 DYPKVVIGVSGGLDSTHALIVATHAMDREGRPRSDILAFALPGF-----------ATGEHTKNNAIKLARALGVTFSEID  428 (680)
T ss_dssp             TSCEEEEECCSSHHHHHHHHHHHHHHHHTTCCGGGEEEEECCC----------------CTHHHHHHHHHHHTCEEEECC
T ss_pred             CCCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCC-----------CCCHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             98725522335753178899999976320477544489832644-----------4650339999988875498644455


Q ss_pred             HHHHHHHHCCCCCHHHHHCCCCCCCEECC-C--CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCC
Q ss_conf             07886632244112678708861200001-5--41105888887401687645225311025412678773168853157
Q gi|254780151|r   92 YEERFRNAVIVPFASSYAAGETPLPCVDC-N--RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMD  168 (408)
Q Consensus        92 ~~~~f~~~V~~~~~~~y~~G~TPNPc~~C-N--~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D  168 (408)
                      +.+.+... ...+...+..|. +..++.= |  .++.--.|+..|...|.=.+.||.-.-              +..|--
T Consensus       429 I~~~~~~~-~~~~~~~~~~~~-~~~~~~~eN~qaR~R~~~l~~~an~~~~lvl~t~N~sE--------------~~~Gy~  492 (680)
T 3dla_A          429 IGDTARLM-LHTIGHPYSVGE-KVYDVTFENVQAGLRTDYLFRIANQRGGIVLGTGDLSE--------------LALGWS  492 (680)
T ss_dssp             CHHHHHHH-HHHTTC----------CCHHHHHHHHHHHHHHHHHHHHHTEEEEECCCHHH--------------HHHTCS
T ss_pred             HHHHHHHH-HHHHHHHHCCCC-CCCCHHHHHHHHHHHHHHHHHHHCCCCEEEECCCCCCH--------------HHHCCE
T ss_conf             79999999-998643421787-54414665110478899999864127818977896103--------------653531


Q ss_pred             CCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHC
Q ss_conf             878731898630202210033425689978989999741
Q gi|254780151|r  169 LERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREM  207 (408)
Q Consensus       169 ~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~  207 (408)
                      .          +.--....-+=|+|++.|.+|+++|+.+
T Consensus       493 T----------l~yGD~~~~~~pi~~l~Kt~v~~l~~~~  521 (680)
T 3dla_A          493 T----------YGVGDQMSHYNVNAGVPKTLIQHLIRWV  521 (680)
T ss_dssp             C----------CSSSTTCCSEESSTTSCHHHHHHHHHHH
T ss_pred             E----------CCCCCCCCCCCEECCCCHHHHHHHHHHH
T ss_conf             0----------0458867574611795599999999999


No 27 
>2d13_A Hypothetical protein PH1257; structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Pyrococcus horikoshii} SCOP: c.26.2.1 PDB: 3h7e_A* 1ru8_A
Probab=98.74  E-value=3.9e-08  Score=77.22  Aligned_cols=96  Identities=17%  Similarity=0.092  Sum_probs=66.9

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      -++|+|..|||.||++|++++.++|++|+++..-+....+....     ..-..+-++..|+.||||+..+....++++ 
T Consensus         4 ~~~v~vl~SGGKDS~lAl~~a~~~G~~v~~L~t~~~~~~~s~~~-----h~~~~~ll~~qA~algiPL~~~~~~~~~e~-   77 (227)
T 2d13_A            4 LADVAVLYSGGKDSNYALYWALKSGLRVRYLVSMVSENEESYMY-----HTPNVELTSLQARALGIPIIKGFTKGEKEK-   77 (227)
T ss_dssp             SCEEEEECCSSHHHHHHHHHHHHTTCEEEEEEEEECCC--------------CCTTHHHHHHHHTCCEEEEEC--CTTS-
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHCCCEEEEEEEEECCCCCCEEC-----CCCCHHHHHHHHHHCCCCEEEEECCCCHHH-
T ss_conf             66499993686999999999998699279999974388881415-----577899999999975997178746786158-


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCC
Q ss_conf             24411267870886120000154110588888740168764522531
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHY  146 (408)
                                               .+..+.+..+++|++.|++|-.
T Consensus        78 -------------------------~~~~l~~~l~~~~v~~iv~Gdi   99 (227)
T 2d13_A           78 -------------------------EVEDLKNVLEGLKVDGIVAGAL   99 (227)
T ss_dssp             -------------------------HHHHHHHHHHTBCCSEEECCCS
T ss_pred             -------------------------HHHHHHHHHHHHCCCEEEEEEE
T ss_conf             -------------------------9999999999717560786237


No 28 
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii OT3} SCOP: c.26.2.6 d.308.1.1
Probab=98.65  E-value=2.9e-08  Score=78.08  Aligned_cols=128  Identities=16%  Similarity=0.286  Sum_probs=84.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      +-|+++.+|||. |.||||++.+.|.+|+.+|++.              +++..+.++.+++.|.               
T Consensus       179 ~Gk~l~LlSGGi-SpVAa~~~mKRG~~v~~v~f~~--------------~~~~~~kv~~l~~~l~---------------  228 (307)
T 1vbk_A          179 EGRMIGILHDEL-SALAIFLMMKRGVEVIPVYIGK--------------DDKNLEKVRSLWNLLK---------------  228 (307)
T ss_dssp             TCEEEEECSSHH-HHHHHHHHHHBTCEEEEEEESC--------------SSHHHHHHHHHHHHHH---------------
T ss_pred             CCCEEEEECCCC-CHHHHHHHHHCCCEEEEEEECC--------------CHHHHHHHHHHHHHHH---------------
T ss_conf             783589833773-0999999996698899999689--------------7889999999999999---------------


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEE
Q ss_conf             24411267870886120000154110588888740168764522531102541267877316885315787873189863
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA  179 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~  179 (408)
                             .|.-|..+..|+..    .|....+.|++.|+..+.||-=.....+                    ||-=|..
T Consensus       229 -------~~~~~~~~~~~~~~----~~~~~~~ia~~~~~~~ivtGeslgQVaS--------------------Qt~n~~~  277 (307)
T 1vbk_A          229 -------RYSYGSKGFLVVAE----SFDRVLKLIRDFGVKGVIKGLRPNDLNS--------------------EVSEITE  277 (307)
T ss_dssp             -------TTCTTSCCCCEEES----SHHHHHHHHHHHTCCEEECCCCGGGCCT--------------------TCHHHHH
T ss_pred             -------HHCCCCCEEEEECC----CHHHHHHHHHHCCCCEEEECCCHHHHHH--------------------HHHHHHH
T ss_conf             -------75899847999767----6899999999849989993515258899--------------------9998999


Q ss_pred             ECCHHHC-EEECCCCCCCHHHHHHHHHHCCC
Q ss_conf             0202210-03342568997898999974125
Q gi|254780151|r  180 TTQQQLC-DLRFPLGDMKKESVRDLAREMGL  209 (408)
Q Consensus       180 l~~~~L~-~~~FPlg~~~K~eVR~~A~~~gl  209 (408)
                      . ....+ -++.||-.|.|+||-++|++.||
T Consensus       278 ~-~~~~~~pi~RPLig~DK~EIi~~Ar~IGl  307 (307)
T 1vbk_A          278 D-FKMFPVPVYYPLIALPEEYIKSVKERLGL  307 (307)
T ss_dssp             H-HHHCSSCEECHHHHSCHHHHHHHHHHHTC
T ss_pred             H-HHCCCCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             9-84159870248378998999999998686


No 29 
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406}
Probab=98.59  E-value=1.6e-09  Score=87.19  Aligned_cols=169  Identities=18%  Similarity=0.189  Sum_probs=99.7

Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEEECCCHHHHHHHHHHHHC-C-----------------------------------CEE
Q ss_conf             6555444346788863388999960985799999999886-9-----------------------------------849
Q gi|254780151|r    4 SEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRD-G-----------------------------------YDV   47 (408)
Q Consensus         4 ~~~~~~~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~-G-----------------------------------~~V   47 (408)
                      ++|+.+..-++-++.+..++++++|||+||+++|.|..++ +                                   -+|
T Consensus       287 ~~al~lgl~Dy~~k~~~~~~vlglSGGiDSal~a~la~~al~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v  366 (634)
T 3ilv_A          287 WEATSLGLFDYMRKSRSKGFVLSLSGGADSSACAIMVAEMIRKGLKELGLTAFLQKSNMETLFDLPALQHLPFEEQAKKI  366 (634)
T ss_dssp             HHHHHHHHHHHHHHTTCCSEEEECCSSHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHTCGGGCCSSCSSCTTSHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEE
T ss_conf             98764207888764047776767862055769999999999987776332222245525555445665313334441037


Q ss_pred             EEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC--CCCC--CC-EEC-CC
Q ss_conf             999987047876655557788189999999999980995898170788663224411267870--8861--20-000-15
Q gi|254780151|r   48 IGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA--GETP--LP-CVD-CN  121 (408)
Q Consensus        48 ~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~--G~TP--NP-c~~-CN  121 (408)
                      .++.|-..-      .+..-.+++...+|+.+|+.|||+++++++.+.+...     ......  +..+  .+ ++. =|
T Consensus       367 ~~~~mp~~y------~s~~~~~d~t~~~A~~la~~lg~~~~~i~I~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~eN  435 (634)
T 3ilv_A          367 TAVFLTTAY------QSTRNSGDETYTSAKTLAESIGATFYNWSVDEEIEQY-----KATIENVIERPLTWEKDDITLQN  435 (634)
T ss_dssp             HHHHEEEEE------EECTTCCSHHHHHHHHHHHHHTCEEEEEECHHHHHHH-----HHHHHHHTTSCCCTTTCHHHHHH
T ss_pred             EEEECCCCC------CCCCCCHHHHHHHHHHHHHHHCCCEEEEEECHHHHHH-----HHHHHHHHCCCCCCCCCHHHHHH
T ss_conf             898658754------4677616889999999999718815788610899999-----97644320367676300334441


Q ss_pred             --CEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHH
Q ss_conf             --411058888874016876452253110254126787731688531578787318986302022100334256899789
Q gi|254780151|r  122 --RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES  199 (408)
Q Consensus       122 --~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~e  199 (408)
                        .++.--.|+..|.+.|.=.+.||.=  .+...|            -          +++.. .....+-|++++.|.+
T Consensus       436 iqaR~R~~~l~~~an~~~~lvl~TgN~--SE~a~G------------y----------~T~~G-D~~~~~~pi~~l~Kt~  490 (634)
T 3ilv_A          436 IQARGRAPIIWMLTNVKQALLITTSNR--SEGDVG------------Y----------ATMDG-DTAGGIAPIAGVDKDF  490 (634)
T ss_dssp             HHHHTTHHHHHHHHHHHTCEEBCCCCH--HHHHTT------------C----------SCTTT-TTCSSBBTTTTSCHHH
T ss_pred             HHHHHHHHHHHHHHHHCCEEEECCCCC--CCCEEC------------C----------EECCC-CCCCCCCCCCCCCHHH
T ss_conf             455677999999775479799857987--771041------------1----------03158-7666664016872899


Q ss_pred             HHHHHHHCC
Q ss_conf             899997412
Q gi|254780151|r  200 VRDLAREMG  208 (408)
Q Consensus       200 VR~~A~~~g  208 (408)
                      ||.+|+.++
T Consensus       491 v~~l~~~~~  499 (634)
T 3ilv_A          491 IRSWLRWAE  499 (634)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
T ss_conf             999999963


No 30 
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2
Probab=98.58  E-value=2.7e-07  Score=71.17  Aligned_cols=154  Identities=14%  Similarity=0.105  Sum_probs=99.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .+++|+.|||.||+|.+.|+.+.+.++..+|+...-           -..+-++.++++++.+|++++++.-....... 
T Consensus        45 ~~~~vs~S~GkDS~Vll~L~~~~~~~~~vvf~DTg~-----------~fpET~~~~~~~~~~~~l~~~~~~~~~~~~~~-  112 (215)
T 1sur_A           45 GEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGY-----------LFPETYRFIDELTDKLKLNLKVYRATESAAWQ-  112 (215)
T ss_dssp             SEEEEECCCCTTHHHHHHHHHHHSTTCEEEEEECSC-----------BCHHHHHHHHHHHHHTTCEEEEEECSSCHHHH-
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCCEEEEEECCC-----------CCHHHHHHHHHHHHHHCCEEEEEECCCHHHHH-
T ss_conf             988999558757999999997149995189963899-----------98999999999999849805999624117988-


Q ss_pred             CCCCHHHHHCCCCCCC--EECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEE
Q ss_conf             4411267870886120--00015411058888874016876452253110254126787731688531578787318986
Q gi|254780151|r  101 IVPFASSYAAGETPLP--CVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLF  178 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNP--c~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~  178 (408)
                          ...+...-..++  +-.|....|...+.+...+.+.+...||-    +..   ++..+..+ ...+..++      
T Consensus       113 ----~~~~~~~~~~~~~~~~~~~~~~K~~p~~~~l~~~~~~~~i~G~----R~~---es~~Ra~~-~~~~~~~~------  174 (215)
T 1sur_A          113 ----EARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGL----RRE---QSGSRANL-PVLAIQRG------  174 (215)
T ss_dssp             ----HHHHCCGGGSHHHHHHHHHHHHTHHHHHHHHHHTTEEEEECCC----CTT---SSSTTTTC-CSEEEETT------
T ss_pred             ----HHHCCCCCCCCCCHHHHCCCCHHHHHHHHHHHCCCCEEECCCC----CCC---CCHHHHCC-CCEEECCC------
T ss_conf             ----8651776667840223315523140799998515862641566----126---73346518-74530599------


Q ss_pred             EECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             302022100334256899789899997412543
Q gi|254780151|r  179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       179 ~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                            + --+.||-+++..+|-...++.|||.
T Consensus       175 ------~-~ki~Pi~~Wt~~DVw~Yi~~~~lp~  200 (215)
T 1sur_A          175 ------V-FKVLPIIDWDNRTIYQYLQKHGLKY  200 (215)
T ss_dssp             ------E-EEECTTTTCCHHHHHHHHHHHTCCC
T ss_pred             ------E-EEEECHHHCCHHHHHHHHHHCCCCC
T ss_conf             ------7-9995728699999999999819998


No 31 
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2
Probab=98.48  E-value=4.4e-07  Score=69.69  Aligned_cols=167  Identities=16%  Similarity=0.084  Sum_probs=101.1

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC----CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             88999960985799999999886----98499999870478766555577881899999999999809958981707886
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD----GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~----G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      .+++|++|||.||+|.+.|..++    +..+-.+|+..           ..-..+-++...++++.+|+++.+.--.+.+
T Consensus        47 ~~~vv~fSGGKDStVlLhLa~ka~~~~~~p~pvl~iDT-----------g~~FpETi~f~d~v~~~~gl~l~v~~~~~~~  115 (325)
T 1zun_A           47 DNPVMLYSIGKDSAVMLHLARKAFFPGKLPFPVMHVDT-----------RWKFQEMYRFRDQMVEEMGLDLITHINPDGV  115 (325)
T ss_dssp             SSEEEECCSSHHHHHHHHHHHHHHTTSCCSSCEEEECC-----------SCCCHHHHHHHHHHHHTTTCCEEEECC----
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHHCCCCCCEEEEEECC-----------CCCHHHHHHHHHHHHHHHCCCCEEECCCHHH
T ss_conf             99799954758999999999997342489835899548-----------9862999999999999829972251480677


Q ss_pred             HHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEEC---CCCCCCC
Q ss_conf             6322441126787088612000015411058888874016876452253110254126787731688531---5787873
Q gi|254780151|r   97 RNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRP---MDLERDQ  173 (408)
Q Consensus        97 ~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~---~D~~KDQ  173 (408)
                      ... ..++        +..| ..|+...|...|.+...+.+++...||.=.  ....... ..+..-.+.   .-..|.|
T Consensus       116 ~~g-~~~~--------~~~~-~~~~~~~K~~pl~~al~~~~~d~~i~G~Rr--dEs~~Ra-k~~~~s~r~~~~~~~~~~q  182 (325)
T 1zun_A          116 AQG-INPF--------THGS-AKHTDIMKTEGLKQALDKHGFDAAFGGARR--DEEKSRA-KERVYSFRDSKHRWDPKNQ  182 (325)
T ss_dssp             -------------------C-CHHHHHHTHHHHHHHHHHHTCSEEECCCCT--TSSGGGG-GCCSEEEECTTCCBCGGGC
T ss_pred             HCC-CCCC--------CCCH-HHHHHHHHHHHHHHHHHHCCCCEEEECCCH--HHHHHHC-CCCCCCEECCCCCCCCCCC
T ss_conf             617-7865--------5786-886478877889999986087638842435--4433430-2631010023554551005


Q ss_pred             EEEEEEECCHHH----CEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             189863020221----00334256899789899997412543
Q gi|254780151|r  174 SYFLFATTQQQL----CDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       174 SYfL~~l~~~~L----~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      .-=++.+-....    .--+|||-++|..||-+.-++.+||.
T Consensus       183 ~pe~w~~~~~~~~~~~~vrv~PI~dWTe~DVW~YI~~~~Ip~  224 (325)
T 1zun_A          183 RPELWNVYNGNVNKGESIRVFPLSNWTELDIWQYIYLEGIPI  224 (325)
T ss_dssp             CCCCSSCCCCCCCTTCEEEECTTTTCCHHHHHHHHHHHTCCC
T ss_pred             CHHHHHHCCCCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCC
T ss_conf             866665215756888755772554688999999999819998


No 32 
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli}
Probab=98.45  E-value=5.3e-07  Score=69.11  Aligned_cols=196  Identities=15%  Similarity=0.115  Sum_probs=114.1

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHH-H
Q ss_conf             889999609857999999998869849999987047876655557788189999999999980995898170788663-2
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRN-A   99 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~-~   99 (408)
                      .+++|++|||.||+|.+.|+.+.+.++..+|+...           .-..+-++.++++++.+|++++++........ .
T Consensus        46 ~~~~vs~SgGkDS~VlLhL~~k~~~~~~vvfvDTg-----------~efpET~~~~~~~~~~~~l~i~v~~~~~~~~~~~  114 (252)
T 2o8v_A           46 GEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTG-----------YLFPETYRFIDELTDKLKLNLKVYRATESAAWQE  114 (252)
T ss_dssp             SCEEEECCCSTTHHHHHHHHHHHSTTCEEEECCCS-----------CBCHHHHHHHHHHHHHTTCEEEECCCSSCHHHHH
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCCCEEEEECC-----------CCCHHHHHHHHHHHHHHCCCEEEECCCCHHHHHH
T ss_conf             98899946877999999999961899867997689-----------9999999999999997398627966871168887


Q ss_pred             C-CCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEE
Q ss_conf             2-441126787088612000015411058888874016876452253110254126787731688531578787318986
Q gi|254780151|r  100 V-IVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLF  178 (408)
Q Consensus       100 V-~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~  178 (408)
                      . ...+   +.. -.|. .-.|....|-..+.+..++.+.+...||    ++..   ++..+..+-. ....+       
T Consensus       115 ~~~~~~---~~~-~~~~-~~~cc~~~K~~p~~~~l~~~~~~~~i~G----~R~~---Es~~Ra~~~~-~~~~~-------  174 (252)
T 2o8v_A          115 ARYGKL---WEQ-GVEG-IEKYNDINKVEPMNRALKELNAQTWFAG----LRRE---QSGSRANLPV-LAIQR-------  174 (252)
T ss_dssp             HHTCCG---GGS-HHHH-HHHHHHHHTHHHHHHHHHHTTCSEEEEC----CCST---TTTCCTTSCS-EEESS-------
T ss_pred             HHCCCC---CCC-CCCH-HHHHHHHHHHHHHHHHHHHCCCCEECCC----CEEC---CCCCCCCCCC-EECCC-------
T ss_conf             351676---667-8506-7786457755149999863285000137----4017---8622014863-43159-------


Q ss_pred             EECCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCHH-HCCCEEECCCCCCHHHHHHCCCC-CCCCCCEECCCCCEE
Q ss_conf             30202210033425689978989999741254---35511-10230111277510345530766-434671103774322
Q gi|254780151|r  179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADKS-DSQDICFVQQGKYFDVVKRINAG-IALEGDIVHLNGQIL  253 (408)
Q Consensus       179 ~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K~-eSqgICFi~~~~~~~Fl~~~~~~-~~~~G~ivd~~G~vi  253 (408)
                          . + .-+.||-+++..||-...++.|||   ..++- .|-| |+---..       ..+. .++.|..... .+.=
T Consensus       175 ----~-~-~kv~PI~~Wt~~DVw~Yi~~~~lp~npLYd~Gy~siG-C~~CT~~-------~~~~~~~r~grw~~~-~~ec  239 (252)
T 2o8v_A          175 ----G-V-FKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVG-DTHTTRK-------WEPGMAEEETRFFGL-KREC  239 (252)
T ss_dssp             ----S-S-EEECGGGSCCHHHHHHHHHHTTCCCCTTTTTTCSSCC-BCTTTCC---------------------C-CSCC
T ss_pred             ----C-C-CCCCCHHHCCHHHHHHHHHHHCCCCCCHHHCCCCCCC-CCCCCCC-------CCCCCCCCCCCCCCC-CCCC
T ss_conf             ----9-0-1308737698999999999809998833543899777-6767887-------999998444453778-7236


Q ss_pred             EEECCCEEE
Q ss_conf             335783153
Q gi|254780151|r  254 GRHNGIINY  262 (408)
Q Consensus       254 G~H~G~~~y  262 (408)
                      |=|.|+.+.
T Consensus       240 glh~~~~~~  248 (252)
T 2o8v_A          240 GLHEGLEHH  248 (252)
T ss_dssp             CSCCC----
T ss_pred             CCCCCCCCC
T ss_conf             278585435


No 33 
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A*
Probab=98.43  E-value=8.3e-07  Score=67.70  Aligned_cols=110  Identities=20%  Similarity=0.146  Sum_probs=70.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH-HH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999980995898170788-66
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER-FR   97 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~-f~   97 (408)
                      .+..|.+.||||+|||+.|+++++.+-++..+++.+-+.             ++...|+++|+++|++|+.+.+..+ |+
T Consensus       237 sd~pvg~~LSGGlDSSlIaala~~~~~~i~tfs~g~~~~-------------de~~~A~~vA~~lg~~h~~~~~~~~d~~  303 (503)
T 1q15_A          237 RFDTVGIPLSGGLDSSLVTALASRHFKKLNTYSIGTELS-------------NEFEFSQQVADALGTHHQMKILSETEVI  303 (503)
T ss_dssp             GCSEEEEECCSSHHHHHHHHHHTTTCSEEEEEEEEETTB-------------CCHHHHHHHHHHHTCEEEEEEECHHHHH
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHHCCCEEEECCCCCCC-------------CHHHHHHHHHHHHCCCCCCCCCCHHHHH
T ss_conf             898568980587427999999875135301101577677-------------6579999999994991741057678898


Q ss_pred             HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCC
Q ss_conf             32244112678708861200001541105888887401687645225311
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYI  147 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYa  147 (408)
                      +.+- ..+  | .-.+|+|....+. +-+=.+.+.|++ ++.-+-||+=|
T Consensus       304 ~~l~-~~i--~-~~e~~~~~~~~~~-~~~~~l~k~a~~-~~kV~LsG~Ga  347 (503)
T 1q15_A          304 NGII-ESI--Y-YNEIFDGLSAEIQ-SGLFNVYRQAQG-QVSCMLTGYGS  347 (503)
T ss_dssp             HHHH-HHH--H-HHCCCCHHHHHHH-HHHHHHHHHHBT-TBSEEECCTTH
T ss_pred             HHHH-HHH--H-HHCCCCCCCHHHH-HHHHHHHHHHHH-CCEEEECCCCH
T ss_conf             8899-987--5-4047878614678-899999999762-56188624674


No 34 
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic acid, AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A*
Probab=98.31  E-value=1e-06  Score=67.12  Aligned_cols=110  Identities=22%  Similarity=0.168  Sum_probs=69.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH-HHHH
Q ss_conf             388999960985799999999886984999998704787665555778818999999999998099589817078-8663
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE-RFRN   98 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~-~f~~   98 (408)
                      +.+|.+.||||+|||+-++++++.+.++..+++.+.+.             +|...|+++|+++|++|+.+.+.. +|.+
T Consensus       241 d~~vg~~LSGGlDSSlIaala~k~~~~~~t~s~~~~~~-------------dE~~~A~~vA~~lg~~h~~i~i~~~~~~~  307 (513)
T 1jgt_A          241 GDTPLVVLSGGIDSSGVAACAHRAAGELDTVSMGTDTS-------------NEFREARAVVDHLRTRHREITIPTTELLA  307 (513)
T ss_dssp             TCCCEEECCSSHHHHHHHHHHHHHHSSCEEEEEECSSC-------------CCHHHHHHHHHHHTCEEEEEECCHHHHHT
T ss_pred             CCCCEEECCCCCCHHHHHHHHHHHCCCCCEEECCCCCC-------------CHHHHHHHHHHCCCCCCEEEECCHHHHHH
T ss_conf             88876977898344999998764124432574245456-------------52667776421010253378618999999


Q ss_pred             HCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             22441126787088612000015411058888874016876452253110
Q gi|254780151|r   99 AVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        99 ~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                      . +...+   ..-.+|.|-.. +..+-+ .++..+.+.|+..+-||+=|.
T Consensus       308 ~-l~~~i---~~~e~~~p~~~-~~~~~~-~~l~k~~~~~~kVvLsG~GaD  351 (513)
T 1jgt_A          308 Q-LPYAV---WASESVDPDII-EYLLPL-TALYRALDGPERRILTGYGAD  351 (513)
T ss_dssp             T-HHHHH---HHHCCCCHHHH-HHHHHH-HHHHHHCCSSCCEEECCTTTH
T ss_pred             H-HHHHH---HHHHCCHHCCC-CCHHHH-HHHHHCCCCCEEEEEEECCHH
T ss_conf             9-99999---98732021025-410124-443201355503999854605


No 35 
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1
Probab=98.13  E-value=5.9e-06  Score=61.58  Aligned_cols=113  Identities=18%  Similarity=0.174  Sum_probs=69.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCC--------------EEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             338899996098579999999988698--------------499999870478766555577881899999999999809
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGY--------------DVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~--------------~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      .+..|.+.||||+|||+.|+++++..-              ++..+...+             ....|...|+++|++||
T Consensus       225 sdvpvg~~LSGGlDSSlIaal~~k~~~~~~~~~~~~~~~~~~~~tfsig~-------------~~~~d~~~a~~vA~~l~  291 (553)
T 1ct9_A          225 SDVPYGVLLSGGLDSSIISAITKKYAARRVEDQERSEAWWPQLHSFAVGL-------------PGSPDLKAAQEVANHLG  291 (553)
T ss_dssp             CSSCEEEECCSSHHHHHHHHHHHHHC----------------CEEEEEES-------------TTCHHHHHHHHHHHHHT
T ss_pred             CCCCCEEEECCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCEEEECC-------------CCCCHHHHHHHHHHHCC
T ss_conf             88751477369974399999999863145555444312256653488328-------------99976899999999819


Q ss_pred             CCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             9589817078866322441126787088612000015411058888874016876452253110
Q gi|254780151|r   85 VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        85 I~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                      ++|+.+.+..+-..+.+...+.   .-.+|+|-..-.. +=.-.+.+.+.+.|+..+-||.-|.
T Consensus       292 ~~h~~v~~~~~~~~~~l~~~i~---~~e~p~~~~~~~~-~~~~~l~k~~~~~~~kVvLsGeGaD  351 (553)
T 1ct9_A          292 TVHHEIHFTVQEGLDAIRDVIY---HIETYDVTTIRAS-TPMYLMSRKIKAMGIKMVLSGEGSD  351 (553)
T ss_dssp             CEEEEEECCHHHHHHHHHHHHH---HHCCCCHHHHHHH-HHHHHHHHHHHHTTCCEEECCTTHH
T ss_pred             CCCEEEECCHHHHHHHHHHHHH---HHHCCCCCCCCHH-HHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             9776998388999999999999---9746785433101-0057889999966988999688751


No 36 
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa}
Probab=97.51  E-value=0.0011  Score=45.28  Aligned_cols=168  Identities=17%  Similarity=0.121  Sum_probs=96.8

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .+|+|++|||.|| |.+.|+.+.+-++.-+|+..   +        .-..+-++.++++++.+|++++++......++..
T Consensus        55 ~~i~vSfSGGKDs-VlL~L~~~~~~~i~Vvf~DT---G--------~efpET~~~~~~~~~~~~l~i~v~~~~~~~~e~~  122 (275)
T 2goy_A           55 DELWISFSGAEDV-VLVDMAWKLNRNVKVFSLDT---G--------RLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPL  122 (275)
T ss_dssp             TTEEEECCSSTTH-HHHHHHHHHCTTCCEEEECC---S--------CCCHHHHHHHHHHHHHHTCCCEEECCCHHHHHHH
T ss_pred             CCEEEECCCHHHH-HHHHHHHHHCCCCCEEEECC---C--------CCCHHHHHHHHHHHHHHCCCEEEEECCHHHHHHH
T ss_conf             9889981586999-99999998589971898358---9--------9989999999999998499738993785899999


Q ss_pred             CCCCHHHHHCCCC--CCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEEE--CCCCCCCCEEE
Q ss_conf             4411267870886--1200001541105888887401687645225311025412678773168853--15787873189
Q gi|254780151|r  101 IVPFASSYAAGET--PLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCR--PMDLERDQSYF  176 (408)
Q Consensus       101 ~~~~~~~y~~G~T--PNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~r--~~D~~KDQSYf  176 (408)
                      .    ..+.-...  .++ -.|....|..-|.......  +...||=    +....   ..+.....  ..|....    
T Consensus       123 ~----~~~~~~~~~~~~~-~~Cc~~~Kv~Pl~ral~~~--~~witG~----Rr~es---~~r~~~~~~~~~d~~~~----  184 (275)
T 2goy_A          123 V----KEKGLFSFYRDGH-GECCGIRKIEPLKRKLAGV--RAWATGQ----RRDQS---PGTRSQVAVLEIDGAFS----  184 (275)
T ss_dssp             H----HHHCSCHHHHHCT-HHHHHHHTHHHHHHHHHTC--SEEECCC----CGGGT---TSCSCCCCSEEECTTTC----
T ss_pred             H----HHCCCCCCCCCCH-HHHHHHHHHCCHHHHHHCC--CEEEECC----CCCCC---CCCCCCCCEEEECCCCC----
T ss_conf             9----8668754343466-8886555106256664202--3144056----50467---66534673268606667----


Q ss_pred             EEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC---CCCHH-HCCCEEEC
Q ss_conf             8630202210033425689978989999741254---35511-10230111
Q gi|254780151|r  177 LFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD---IADKS-DSQDICFV  223 (408)
Q Consensus       177 L~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~---~a~K~-eSqgICFi  223 (408)
                         -...- ...+.||-+++..||-...++.+||   ..+|- .|-| |+.
T Consensus       185 ---~~~~~-~~k~~PI~dWt~~DVw~Yi~~~~lp~npLYd~Gy~sIG-C~~  230 (275)
T 2goy_A          185 ---TPEKP-LYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIG-CEP  230 (275)
T ss_dssp             ---CSSSC-CEEECTTTTCCHHHHHHHHHHTTCCCCGGGGGTCSSCC-CGG
T ss_pred             ---CCCCC-EEEECCHHCCCHHHHHHHHHHCCCCCCCHHHCCCCCCC-CCC
T ss_conf             ---76666-05881220189999999999819998842434999777-747


No 37 
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae}
Probab=97.48  E-value=0.00011  Score=52.43  Aligned_cols=154  Identities=12%  Similarity=-0.025  Sum_probs=89.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCE---EEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC----EEECCHH
Q ss_conf             88999960985799999999886984---9999987047876655557788189999999999980995----8981707
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYD---VIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS----HYVFDYE   93 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~---V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~----~~~~d~~   93 (408)
                      .+++++.|+|.||+|.+.|+.+..-+   +--+|+   |.+.        -..+-++.+.++++++|.+    .+.+...
T Consensus        42 ~~~~~~~SfGkdS~VlLhL~~~v~~~~~~~~Vvfi---DTG~--------efpET~e~ve~l~~~~~~~~~~~~~~~~~~  110 (261)
T 2oq2_A           42 PHLFQTTAFGLTGLVTIDMLSKLSEKYYMPELLFI---DTLH--------HFPQTLTLKNEIEKKYYQPKNQTIHVYKPD  110 (261)
T ss_dssp             SSEEEECCCCHHHHHHHHHHHHHTTTSCCCEEEEE---CCSC--------BCHHHHHHHHHHHHHHTGGGTCCCEEECST
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCCCCCCEEEE---CCCC--------CCHHHHHHHHHHHHHHCCCCCCCCEEECCC
T ss_conf             99189986878899999999985666788867995---5999--------889999999999999586544343144575


Q ss_pred             HHHHHHCCCCCHHHHHCCCCC--CCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEECCCCCCCEEEEE-ECCCCC
Q ss_conf             886632244112678708861--20000154110588888740168764522531102541267877316885-315787
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETP--LPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMC-RPMDLE  170 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TP--NPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~~~~~~~~~~~L~-r~~D~~  170 (408)
                      ...    ....+.......-+  .| -.|....|-..|.++.++++.+.+.||=    +....   ..+..+. ...|..
T Consensus       111 ~~~----~~~~~~~~~~~~~~~~~~-~~cc~~~Kv~Pl~r~l~~~~~~~~i~Gi----R~~es---~~R~~~~~~~~~~~  178 (261)
T 2oq2_A          111 GCE----SEADFASKYGDFLWEKDD-DKYDYLAKVEPAHRAYKELHISAVFTGR----RKSQG---SARSQLSIIEIDEL  178 (261)
T ss_dssp             TCS----SHHHHHHHHCTTHHHHCH-HHHHHHHTHHHHHHHHHHTTCSEEECCC----CGGGC---GGGGGCCSEEEETT
T ss_pred             HHH----HHHHHHHHCCCCCCCCCH-HHHHHHHHCCHHHHHHHHCCCCEEEECC----CCCCC---CCCCCCCCEEECCC
T ss_conf             566----799998614876444688-9876676105478999851887477510----20461---31335751014378


Q ss_pred             CCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             8731898630202210033425689978989999741254
Q gi|254780151|r  171 RDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       171 KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      ..             ---++||-+++..||-...++.|||
T Consensus       179 ~~-------------~~~v~Pi~~Wt~~dVw~Yi~~~~lp  205 (261)
T 2oq2_A          179 NG-------------ILKINPLINWTFEQVKQYIDANNVP  205 (261)
T ss_dssp             TT-------------EEEECTTTTCCHHHHHHHHHHHTCC
T ss_pred             CC-------------CEEECHHHCCCHHHHHHHHHHCCCC
T ss_conf             99-------------4466234409999999999983999


No 38 
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae}
Probab=97.44  E-value=0.0025  Score=42.84  Aligned_cols=140  Identities=11%  Similarity=-0.014  Sum_probs=77.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCC----------------------EEEEEEEECCCCCCCCCCCCCCCCHHHHHH
Q ss_conf             6338899996098579999999988698----------------------499999870478766555577881899999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGY----------------------DVIGVTLQLYNSRKASKRKGSCCAGQDVYD   75 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~----------------------~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~   75 (408)
                      |....|++++|||.||+|.+.|+.++..                      .+..+|+..   .        ....+-.+-
T Consensus        51 p~~~ei~~SFSGGKDStVlL~L~~~a~~~~~~~~~~~~~~~~~~~~~~~~~i~~~yidt---~--------~~FpE~~~f  119 (306)
T 2wsi_A           51 PLNGEISFSYNGGKDCQVLLLLYLSCLWEYFFIKAQNSQFDFEFQSFPMQRLPTVFIDQ---E--------ETFPTLENF  119 (306)
T ss_dssp             SSSSSEEEECCSCHHHHHHHHHHHHHHHHHHHHHHHHC--------CCCCCEEEEECCC---T--------TCCHHHHHH
T ss_pred             CCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECC---C--------CCCHHHHHH
T ss_conf             54574899815833799999999998531344212455556543445578875799479---9--------998789999


Q ss_pred             HHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC-CCCEECCCCCCCEEEECC
Q ss_conf             9999998099589817078866322441126787088612000015411058888874016-876452253110254126
Q gi|254780151|r   76 ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL-GADVLATGHYIRSRLYVG  154 (408)
Q Consensus        76 a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~-g~~~iATGHYar~~~~~~  154 (408)
                      ....++.+|+++.+......                     +-.+    +...+-++.+.. +.+.+.+|    ++..  
T Consensus       120 v~~~~~~~~l~~~~~~~~~~---------------------~~~~----~~~~~~~~lk~~p~~~aii~G----~R~~--  168 (306)
T 2wsi_A          120 VLETSERYCLSLYESQRQSG---------------------ASVN----MADAFRDFIKIYPETEAIVIG----IRHT--  168 (306)
T ss_dssp             HHHHHHHTTEEEEECCC--------------------------CC----HHHHHHHHHHHCTTCCEEECC----CCCC--
T ss_pred             HHHHHHHCCCEEEEEECCCC---------------------HHHH----HHHHHHHHHHHCCCCCEEEEC----CCCC--
T ss_conf             99999972945999837843---------------------7777----568889999849998689962----4046--


Q ss_pred             CCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             787731688531578787318986302022100334256899789899997412543
Q gi|254780151|r  155 DDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       155 ~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                       ++..+.           ++.|-..-+..-----++||-+++-.+|=..-++.++|.
T Consensus       169 -Es~~R~-----------~~~~~~~d~~~p~~~rv~PI~dWt~~DVW~yi~~~~lpy  213 (306)
T 2wsi_A          169 -DPFGEA-----------LKPIQRTDSNWPDFMRLQPLLHWDLTNIWSFLLYSNEPI  213 (306)
T ss_dssp             -SSSCCC-----------CCSEEECCTTSCSCEEECTTTTCCHHHHHHHHHHHCCCB
T ss_pred             -CCCHHC-----------CCCCCCCCCCCCCEEEECCHHHCCHHHHHHHHHHCCCCC
T ss_conf             -754001-----------585002059988638982236399999999999729998


No 39 
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A*
Probab=97.42  E-value=0.0021  Score=43.38  Aligned_cols=137  Identities=11%  Similarity=-0.019  Sum_probs=71.0

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEE----------------------EEEEEECCCCCCCCCCCCCCCCHHHHHHH
Q ss_conf             33889999609857999999998869849----------------------99998704787665555778818999999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDV----------------------IGVTLQLYNSRKASKRKGSCCAGQDVYDA   76 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V----------------------~g~~m~~~~~~~~~~~~~~c~~~~d~~~a   76 (408)
                      -...|.+++|||.||+|.+.|+.+...++                      ..++++.           .....+..+-.
T Consensus        57 ~~~~i~~SFSGGKDStVlL~L~~~~~~~~~~~~~dt~~~~~~~~~~~~~~~~~~~id~-----------~~~f~e~~~fv  125 (308)
T 3fwk_A           57 LNGEISFSYNGGKDCQVLLLLYLSCLWEYYIVKLSQSQFDGKFHRFPLTKLPTVFIDH-----------DDTFKTLENFI  125 (308)
T ss_dssp             SSSSEEEECCSSHHHHHHHHHHHHHHHHHHTCCE-----------------EEEECCC-----------TTCCHHHHHHH
T ss_pred             CCCCEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHCCCCCCEEEEECC-----------CCCCHHHHHHH
T ss_conf             7772899847861499999999998653375425664557412202567740798578-----------87643599999


Q ss_pred             HHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCC-CCCEECCCCCCCEEEECCC
Q ss_conf             999998099589817078866322441126787088612000015411058888874016-8764522531102541267
Q gi|254780151|r   77 RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL-GADVLATGHYIRSRLYVGD  155 (408)
Q Consensus        77 ~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~-g~~~iATGHYar~~~~~~~  155 (408)
                      ...++..+++++...-                       ++.    .-+..++-++.++. +.+.+.+|-    +..   
T Consensus       126 ~~~~~~~~l~l~~~~~-----------------------~~~----~~~~~~~~~~lk~~p~~~aii~G~----R~~---  171 (308)
T 3fwk_A          126 EETSLRYSLSLYESDR-----------------------DKC----ETMAEAFETFLQVFPETKAIVIGI----RHT---  171 (308)
T ss_dssp             HHHHHHTTEEEEECCT-----------------------TSC----CCHHHHHHHHHHHCTTCCEEECCC----CTT---
T ss_pred             HHHHHHCCCCEEEECC-----------------------CHH----HHHHHHHHHHHHHCCCCCEEEECC----CCC---
T ss_conf             9999864996299758-----------------------602----368999999999779972786035----004---


Q ss_pred             CCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCC
Q ss_conf             87731688531578787318986302022100334256899789899997412543
Q gi|254780151|r  156 DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDI  211 (408)
Q Consensus       156 ~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~  211 (408)
                      ++..+..           +.|...-+...=---++||-+++..||=..-.+.++|.
T Consensus       172 Es~~R~~-----------~~~~~~~~~~p~~~rv~PI~dWt~~DVW~Yi~~~~lpy  216 (308)
T 3fwk_A          172 DPFGEHL-----------KPIQKTDANWPDFYRLQPLLHWNLANIWSFLLYSNEPI  216 (308)
T ss_dssp             STTCTTC-----------CSEEECCTTSCSCEEECTTTTCCHHHHHHHHHHHTCCC
T ss_pred             CCHHHHC-----------CCCCCCCCCCCCEEEEEEHHHCCHHHHHHHHHHCCCCC
T ss_conf             7014532-----------84115579998728982036489999999999849998


No 40 
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A*
Probab=93.09  E-value=0.39  Score=27.07  Aligned_cols=58  Identities=21%  Similarity=0.284  Sum_probs=37.1

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHC---CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             63388999960985799999999886---984999998704787665555778818999999999998099589817078
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRD---GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~---G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      ...+||+|-.||+ .|.+.|.+-...   ..+|+++.-   +.+        |       .+...|++.|||.++++..+
T Consensus        10 ~~p~riavl~SG~-Gsnl~aLi~~~~~~~~~~iv~vi~---~~~--------~-------~~~~~A~~~gIp~~~i~~~~   70 (215)
T 3da8_A           10 SAPARLVVLASGT-GSLLRSLLDAAVGDYPARVVAVGV---DRE--------C-------RAAEIAAEASVPVFTVRLAD   70 (215)
T ss_dssp             CSSEEEEEEESSC-CHHHHHHHHHSSTTCSEEEEEEEE---SSC--------C-------HHHHHHHHTTCCEEECCGGG
T ss_pred             CCCCEEEEEECCC-CHHHHHHHHHHCCCCCCEEEEEEE---CCC--------H-------HHHHHHHHCCCCEEEEECCC
T ss_conf             9988899998368-265999999637799977999996---785--------6-------68899998399737740578


No 41 
>2bln_A Protein YFBG; transferase, formyltransferase, L-ARA4N biosynthesis, methyltransferase; HET: FON U5P; 1.2A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 1yrw_A
Probab=91.14  E-value=0.87  Score=24.61  Aligned_cols=60  Identities=18%  Similarity=0.282  Sum_probs=37.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      |||+|.-++.+-..+.-.|+ ++|++|.+|+-+   .+..... ..      ..+.++.|+..|||++..+
T Consensus         1 Mkiv~~~~~~~~~~~l~~L~-~~~~~i~~V~t~---~~~~~~~-~~------~~~v~~~a~~~~ip~~~~~   60 (305)
T 2bln_A            1 MKTVVFAYHDMGCLGIEALL-AAGYEISAIFTH---TDNPGEK-AF------YGSVARLAAERGIPVYAPD   60 (305)
T ss_dssp             CEEEEEECHHHHHHHHHHHH-HTTCEEEEEECC---CC-------C------CCCHHHHHHHHTCCEECCS
T ss_pred             CEEEEECCCHHHHHHHHHHH-HCCCCEEEEEEC---CCCCCCC-CC------CCHHHHHHHHCCCCEECCC
T ss_conf             95999927789999999999-789988999908---9999887-89------8989999998699898459


No 42 
>1q8f_A Pyrimidine nucleoside hydrolase; open alpha-beta structure, NH-fold; 1.70A {Escherichia coli} SCOP: c.70.1.1 PDB: 3b9x_A*
Probab=89.47  E-value=1.2  Score=23.65  Aligned_cols=57  Identities=14%  Similarity=0.445  Sum_probs=45.8

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             388999960985799999999886-9849999987047876655557788189999999999980995
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      ++||++=-.+|+|-++|..+|... .++|.|++.-.          |-|+.++...++.++++.+|.+
T Consensus         3 k~kvIiDtD~G~DD~~AL~lal~~p~~~l~gIt~v~----------GN~~~~~~~~n~~~~l~~~~~~   60 (313)
T 1q8f_A            3 KRKIILDCDPGHDDAIAIMMAAKHPAIDLLGITIVA----------GNQTLDKTLINGLNVCQKLEIN   60 (313)
T ss_dssp             CEEEEEEECCCHHHHHHHHHHHHCTTEEEEEEEECS----------SSSCHHHHHHHHHHHHHHTTCC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHCCCC
T ss_conf             878999899987999999999778998899999955----------9737999999999999971999


No 43 
>1jny_A EF-1-alpha, elongation factor 1-alpha, EF-TU, TUF-1; GTPase, alpha/beta structure, protein biosynthesis, translation; HET: GDP; 1.80A {Sulfolobus solfataricus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1skq_A*
Probab=88.65  E-value=1.1  Score=23.99  Aligned_cols=68  Identities=18%  Similarity=0.191  Sum_probs=38.7

Q ss_pred             CEEEEEECCCHH---HHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             889999609857---99999999886984999998704787665555778818999999999998099589817078866
Q gi|254780151|r   21 MRVVVAMSGGVD---SSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        21 ~kV~va~SGGVD---Ssvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      ..|=|++-|-||   |+++-.||.+.|.                      -..+..+..++.+..+|-.       ..-+
T Consensus         5 p~ini~~~Ghvd~GKSTl~g~L~~~~g~----------------------~~~~~~~~~~~~~~~~~~~-------~~~~   55 (435)
T 1jny_A            5 PHLNLIVIGHVDHGKSTLVGRLLMDRGF----------------------IDEKTVKEAEEAAKKLGKE-------SEKF   55 (435)
T ss_dssp             CEEEEEEEESTTSSHHHHHHHHHHHHBC----------------------CCHHHHHHHHHHHHHHTCT-------HHHH
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHCCC----------------------CCHHHHHHHHHHHHHHCCC-------CCCC
T ss_conf             9269999906897699999999987699----------------------6567889989899871876-------5441


Q ss_pred             HHCCCCCHHHHHCCCCCCCE
Q ss_conf             32244112678708861200
Q gi|254780151|r   98 NAVIVPFASSYAAGETPLPC  117 (408)
Q Consensus        98 ~~V~~~~~~~y~~G~TPNPc  117 (408)
                      .-+.+..-++..+|.|-+.-
T Consensus        56 ~~~~d~~~~e~~rg~ti~~~   75 (435)
T 1jny_A           56 AFLLDRLKEERERGVTINLT   75 (435)
T ss_dssp             HHHHHHHHHC----------
T ss_pred             EEECCCCHHHHHCCCEEECE
T ss_conf             25614886676459608010


No 44 
>1mvl_A PPC decarboxylase athal3A; flavoprotein, active site mutant C175S, lyase; HET: FMN; 2.00A {Arabidopsis thaliana} SCOP: c.34.1.1 PDB: 1mvn_A* 1e20_A*
Probab=87.77  E-value=0.72  Score=25.17  Aligned_cols=40  Identities=23%  Similarity=0.397  Sum_probs=29.4

Q ss_pred             CCCCCCCCCCCCEEEEEECCCHHHHHHH---HHHHHCCCEEEEE
Q ss_conf             4346788863388999960985799999---9998869849999
Q gi|254780151|r   10 NSLDLDKNPKDMRVVVAMSGGVDSSVVA---ALLKRDGYDVIGV   50 (408)
Q Consensus        10 ~~~~~~~~~k~~kV~va~SGGVDSsvaa---~lL~~~G~~V~g~   50 (408)
                      ..|.+.+.|+++||+++.||++-.--+.   .+|+ +|++|..+
T Consensus         9 ~~~~~~~~~~k~rIllgvtGsIAayK~~~lir~L~-~~~~V~vv   51 (209)
T 1mvl_A            9 QDMEVNTTPRKPRVLLAASGSVAAIKFGNLCHCFT-EWAEVRAV   51 (209)
T ss_dssp             ----------CCEEEEEECSSGGGGGHHHHHHHHH-TTSEEEEE
T ss_pred             HHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHHH-CCCEEEEE
T ss_conf             11002489999869999816999999999999986-17869999


No 45 
>1s0u_A EIF-2-gamma, translation initiation factor 2 gamma subunit; GTPase, EF-1A, tRNA; 2.40A {Methanocaldococcus jannaschii} SCOP: b.43.3.1 b.44.1.1 c.37.1.8
Probab=86.40  E-value=1.8  Score=22.37  Aligned_cols=57  Identities=12%  Similarity=0.176  Sum_probs=37.8

Q ss_pred             EEEECCCCCCEEEEE-EECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             998017887008999-8299799997597200069638999738886658887689714
Q gi|254780151|r  328 VKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISG  385 (408)
Q Consensus       328 vkiR~~~~pvp~~i~-~~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~  385 (408)
                      ++++.....+++++. ...+-+.+.|+.|.- +-+|+=.++=+++-...|.+|+|+|++
T Consensus       351 ~~l~~gt~~~~~~I~~~~~~~~~i~l~~Pi~-~e~gdrf~l~rR~~~~~rtig~G~I~~  408 (408)
T 1s0u_A          351 LMLNIGTATTAGVITSARGDIADIKLKLPIC-AEIGDRVAISRRVGSRWRLIGYGTIEG  408 (408)
T ss_dssp             EEEEETTEEEEEEEEEEETTEEEEEEEEEEE-CCTTCEEEEEEECSSSEEEEEEEEECC
T ss_pred             EEEEEECCEEEEEEEECCCCEEEEEECCEEE-CCCCCEEEEEECCCCCCEEEEEEEECC
T ss_conf             9999958838799994689879999581267-167999999954899738999999829


No 46 
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide complex; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A*
Probab=85.80  E-value=1.2  Score=23.59  Aligned_cols=47  Identities=19%  Similarity=0.332  Sum_probs=36.9

Q ss_pred             CCCCCCCCCCCCCCCCCCEEEEEE-CCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             655544434678886338899996-098579999999988698499999
Q gi|254780151|r    4 SEATRLNSLDLDKNPKDMRVVVAM-SGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus         4 ~~~~~~~~~~~~~~~k~~kV~va~-SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +.-.|-|+.++.-.+++|||+|-= +|=+-|.++..|++ +|++|+++-
T Consensus         4 ~~~~~~~~~~~~~~~~~MkILVTGgtGfiG~~lv~~Ll~-~G~~V~~~d   51 (330)
T 2pzm_A            4 SHHHHHHSSGLVPRGSHMRILITGGAGCLGSNLIEHWLP-QGHEILVID   51 (330)
T ss_dssp             ----------CCSTTTCCEEEEETTTSHHHHHHHHHHGG-GTCEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             554433346878899997699989877899999999997-869899997


No 47 
>3mcu_A Dipicolinate synthase, B chain; NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Bacillus cereus}
Probab=85.63  E-value=1.1  Score=23.78  Aligned_cols=35  Identities=20%  Similarity=0.195  Sum_probs=25.6

Q ss_pred             CCCCCEEEEEECCCHHHH---H-HHHHHHHCCCEEEEEE
Q ss_conf             863388999960985799---9-9999988698499999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSS---V-VAALLKRDGYDVIGVT   51 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSs---v-aa~lL~~~G~~V~g~~   51 (408)
                      +-+++||++|+||++.+-   . ....|+++|++|.-+.
T Consensus         2 ~L~gKrI~lgiTGs~aa~~~~~~li~~L~~~g~~V~vv~   40 (207)
T 3mcu_A            2 SLKGKRIGFGFTGSHCTYEEVMPHLEKLIAEGAEVRPVV   40 (207)
T ss_dssp             CCTTCEEEEEECSCGGGGTTSHHHHHHHHHTTCEEEEEE
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             888999999974849999999999999998899699998


No 48 
>3mmp_A Elongation factor TU 2, elongation factor TS; RDRP,HOST-factor complex, translation, transferase; HET: PXN; 2.50A {Escherichia coli}
Probab=85.39  E-value=2  Score=22.03  Aligned_cols=94  Identities=13%  Similarity=0.179  Sum_probs=46.2

Q ss_pred             CCCCEEEEECCCCCCCCCEEECCCEECCCCCC--CCCCCCCEEEEEEEECCCCCCEEEEEEEC--------CE--EEEEE
Q ss_conf             55312565235554222112002230377655--54456871899998017887008999829--------97--99997
Q gi|254780151|r  285 KNSSRVIVGPRESLEVHRIYLREINWLGDGLF--EDAVVDGFKCFVKIRSSQDPVPVFVQRND--------DG--VYVDF  352 (408)
Q Consensus       285 ~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~--~~~~~~~~~~~vkiR~~~~pvp~~i~~~~--------~~--~~V~f  352 (408)
                      .....|+..+.+.....++.+ .+.|++....  ......+.++.+  .....-++|++...+        +.  +.++|
T Consensus       571 i~rGdvL~~~~~~~p~~~F~a-~i~vL~~~~~~~~~pl~~G~~~~l--~~gt~~~~~~I~~~~~~~~l~~gd~a~V~~~l  647 (678)
T 3mmp_A          571 IERGQVLAKPGTIKPHTKFES-EVYILSKDEGGRHTPFFKGYRPQF--YFRTTDVTGTIELPEGVEMVMPGDNIKMVVTL  647 (678)
T ss_dssp             CCTTCEEECTTSCCEEEEEEE-EEEECCTTTTSCSSCBCTTCCCEE--EETTEEEEEEEECCTTCCCBCTTCEEEEEEEE
T ss_pred             CCCCCEEEECCCCCCCCEEEE-EEEEECCCCCCCCCCCCCCCEEEE--EEECCEEEEEEEECCCCCCCCCCCEEEEEEEE
T ss_conf             798539997999887238999-999952776667775358967999--99878999999906881113899979999998


Q ss_pred             CCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             5972000696389997388866588876897145
Q gi|254780151|r  353 EKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       353 ~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      ++|. .+.||+-.+|=++    ++.+|+|+|...
T Consensus       648 ~~pv-~~~~~~RfilRd~----g~Tvg~G~V~~v  676 (678)
T 3mmp_A          648 IHPI-AMDDGLRFAIREG----GRTVGAGVVAKV  676 (678)
T ss_dssp             EEEE-ECCTTCEEEEEET----TEEEEEEEEEEE
T ss_pred             CCEE-EECCCCEEEEEEC----CEEEEEEEEEEE
T ss_conf             9668-7379988999989----989999999983


No 49 
>3lqk_A Dipicolinate synthase subunit B; flavoprotein, PSI2, MCSG, structural genomics, protein structure initiative; 2.10A {Bacillus halodurans}
Probab=85.39  E-value=0.98  Score=24.22  Aligned_cols=35  Identities=17%  Similarity=0.040  Sum_probs=25.9

Q ss_pred             CCCCCEEEEEECCCHHHH----HHHHHHHHCCCEEEEEE
Q ss_conf             863388999960985799----99999988698499999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSS----VVAALLKRDGYDVIGVT   51 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSs----vaa~lL~~~G~~V~g~~   51 (408)
                      +-+++||++|++|++-+-    -.+..|+++|++|.-+.
T Consensus         4 ~l~gK~I~lgITGs~a~~~~~l~li~~L~~~g~~V~vI~   42 (201)
T 3lqk_A            4 NFAGKHVGFGLTGSHCTYHEVLPQMERLVELGAKVTPFV   42 (201)
T ss_dssp             CCTTCEEEEECCSCGGGGGGTHHHHHHHHHTTCEEEEEC
T ss_pred             CCCCCEEEEEECCHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             878998999975859999999999999998899699997


No 50 
>1p3y_1 MRSD protein; flavoprotein, FMN, rossmann fold, HFCD family, oxdidative decarboxylation, cystein, lantibiotics, mersacidin, oxidoreductase; HET: FAD; 2.54A {Bacillus SP} SCOP: c.34.1.1
Probab=84.77  E-value=1.1  Score=23.96  Aligned_cols=33  Identities=18%  Similarity=0.228  Sum_probs=24.4

Q ss_pred             CCCEEEEEECCCHHHH---HHHHHHHHCCCEEEEEE
Q ss_conf             3388999960985799---99999988698499999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSS---VVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va~SGGVDSs---vaa~lL~~~G~~V~g~~   51 (408)
                      +++||++|.||++-+.   --+..|+++|++|.-+.
T Consensus         7 ~~KkIllgiTGSiaa~k~~~li~~L~~~g~~V~vv~   42 (194)
T 1p3y_1            7 KDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVM   42 (194)
T ss_dssp             GGCEEEEEECSCGGGGGTHHHHHHHTTTSSEEEEEE
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             899699999488999999999999997899399999


No 51 
>1d2e_A Elongation factor TU (EF-TU); G-protein, beta-barrel, RNA binding protein; HET: GDP; 1.94A {Bos taurus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1xb2_A* 2hcj_A* 2hdn_A*
Probab=84.33  E-value=2.2  Score=21.71  Aligned_cols=38  Identities=13%  Similarity=0.302  Sum_probs=28.3

Q ss_pred             EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCCCC
Q ss_conf             9999759720006963899973888665888768971455530
Q gi|254780151|r  348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSD  390 (408)
Q Consensus       348 ~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~~~  390 (408)
                      +.++|++|. .+.+|+-.+|-++.    +-+|+|+|.+....-
T Consensus       352 v~i~l~~pi-~i~~~~rfilRd~~----~tig~G~V~~~~~~~  389 (397)
T 1d2e_A          352 LTLILRQPM-ILEKGQRFTLRDGN----RTIGTGLVTDTPAMT  389 (397)
T ss_dssp             EEEEEEEEE-CCCTTCEEEEEETT----EEEEEEEEEECCCCC
T ss_pred             EEEEECCCE-EECCCCEEEEEECC----EEEEEEEEECCCCCC
T ss_conf             999999718-63789989999899----889999997279998


No 52 
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp}
Probab=84.30  E-value=1.4  Score=23.12  Aligned_cols=34  Identities=15%  Similarity=0.222  Sum_probs=27.3

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             8863388999960985799999999886984999
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIG   49 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g   49 (408)
                      .-+++++|++--.+|.-|..||.+|+++||+++.
T Consensus        52 ~l~~~~~iv~~C~~G~rS~~aa~~L~~~G~~~~~   85 (100)
T 3foj_A           52 YFNDNETYYIICKAGGRSAQVVQYLEQNGVNAVN   85 (100)
T ss_dssp             GSCTTSEEEEECSSSHHHHHHHHHHHTTTCEEEE
T ss_pred             CCCCCCCEEEECCCCHHHHHHHHHHHHCCCCEEE
T ss_conf             3666553699869986999999999986998799


No 53 
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A*
Probab=84.14  E-value=0.67  Score=25.41  Aligned_cols=31  Identities=39%  Similarity=0.471  Sum_probs=27.6

Q ss_pred             CCEEEE-EECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             388999-9609857999999998869849999
Q gi|254780151|r   20 DMRVVV-AMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        20 ~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      .|||+| |=+|=+-|.++..||++.||+|+++
T Consensus         2 ~MkILVTGa~GFIGs~Lv~~LL~~~g~~V~~v   33 (397)
T 1gy8_A            2 HMRVLVCGGAGYIGSHFVRALLRDTNHSVVIV   33 (397)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHHCCCEEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             88799968876899999999998289979998


No 54 
>1kk1_A EIF2gamma; initiation of translation; HET: GNP; 1.80A {Pyrococcus abyssi} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1kjz_A* 1kk2_A* 1kk3_A* 1kk0_A* 2d74_A 2dcu_A*
Probab=83.20  E-value=2.4  Score=21.39  Aligned_cols=50  Identities=18%  Similarity=0.203  Sum_probs=33.7

Q ss_pred             CCCEEEEE-EECCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             87008999-8299799997597200069638999738886658887689714
Q gi|254780151|r  335 DPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISG  385 (408)
Q Consensus       335 ~pvp~~i~-~~~~~~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~  385 (408)
                      ..++|++. .+.+.+.++|++|. .+-|||-.++-+..-...+.+|+|+|..
T Consensus       360 ~~~~~~i~~~~~~~v~l~l~~Pi-~~~~gdrfvl~R~~~~~~rTig~G~I~~  410 (410)
T 1kk1_A          360 ARTMGLVTGLGKDEIEVKLQIPV-CAEPGDRVAISRQIGSRWRLIGYGIIKE  410 (410)
T ss_dssp             EEEEEEEEEEETTEEEEEEEEEE-ECCTTCEEEEEEEETTEEEEEEEEEEEC
T ss_pred             CEEEEEEEECCCCEEEEEECCCE-EECCCCEEEEEECCCCCCEEEEEEEEEC
T ss_conf             70258999769967999979642-1378999999956899767999999959


No 55 
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis}
Probab=82.67  E-value=2.4  Score=21.44  Aligned_cols=108  Identities=15%  Similarity=0.158  Sum_probs=63.3

Q ss_pred             CCCCCCCCCCC-CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             54443467888-63388999960985799999999886984999998704787665555778818999999999998099
Q gi|254780151|r    7 TRLNSLDLDKN-PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV   85 (408)
Q Consensus         7 ~~~~~~~~~~~-~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI   85 (408)
                      ..|++++-.++ |.+|||+|-=|||-.-+.|-.|.+..  .|.-+|.-..+..-....+-..-...|.+.....|++.+|
T Consensus         7 ~~~~~~~~~~~~~~~mkvLviGsGgREhAi~~~l~~s~--~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~l~~~~~~~~i   84 (442)
T 3lp8_A            7 HHMGTLEAQTQGPGSMNVLVIGSGGREHSMLHHIRKST--LLNKLFIAPGREGMSGLADIIDIDINSTIEVIQVCKKEKI   84 (442)
T ss_dssp             -------------CCEEEEEEECSHHHHHHHHHHTTCT--TEEEEEEEECCGGGTTTSEECCCCTTCHHHHHHHHHHTTC
T ss_pred             CCHHHHHHCCCCCCCCEEEEECCCHHHHHHHHHHHHCC--CCCEEEEECCCHHHHHCCCEEEECCCCHHHHHHHHHHCCC
T ss_conf             00245662468999868999898889999999997598--9898999799678874182166277899999999998299


Q ss_pred             CEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCC
Q ss_conf             5898170788663224411267870886120000154
Q gi|254780151|r   86 SHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR  122 (408)
Q Consensus        86 ~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~  122 (408)
                      .+-++--+..-...+.|.|-   ++|.   ||+.-++
T Consensus        85 DlvvvGpE~pL~~Gi~D~l~---~~gi---~vfGps~  115 (442)
T 3lp8_A           85 ELVVIGPETPLMNGLSDALT---EEGI---LVFGPSK  115 (442)
T ss_dssp             CEEEECSHHHHHTTHHHHHH---HTTC---EEESCCH
T ss_pred             CEEEECCCHHHHHHHHHHHH---HCCC---CEEECCH
T ss_conf             99998983898878899997---4899---4786478


No 56 
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1}
Probab=81.53  E-value=1.6  Score=22.78  Aligned_cols=31  Identities=19%  Similarity=0.376  Sum_probs=20.5

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             6338899996098579999999988698499
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      +++++|++-=.+|..|..|+.+|++.||+|.
T Consensus        53 ~~d~~iv~yC~~G~rS~~aa~~L~~~Gf~v~   83 (108)
T 3gk5_A           53 ERDKKYAVICAHGNRSAAAVEFLSQLGLNIV   83 (108)
T ss_dssp             CTTSCEEEECSSSHHHHHHHHHHHTTTCCEE
T ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHCCCCEE
T ss_conf             8777767888998499999999998499889


No 57 
>3eme_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics; 2.00A {Staphylococcus aureus subsp} PDB: 3iwh_A 3mzz_A
Probab=81.16  E-value=2  Score=22.09  Aligned_cols=33  Identities=27%  Similarity=0.408  Sum_probs=25.4

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             886338899996098579999999988698499
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      +-+++++|++-=.+|..|..||..|+++||+++
T Consensus        52 ~l~~~~~iv~~C~~G~rs~~aa~~L~~~G~~~v   84 (103)
T 3eme_A           52 SFNKNEIYYIVCAGGVRSAKVVEYLEANGIDAV   84 (103)
T ss_dssp             GCCTTSEEEEECSSSSHHHHHHHHHHTTTCEEE
T ss_pred             ECCCCCEEEEECCCCHHHHHHHHHHHHCCCCEE
T ss_conf             104796399994999799999999998599889


No 58 
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural genomics center for infectious disease; 2.20A {Anaplasma phagocytophilum HZ}
Probab=80.87  E-value=2.9  Score=20.81  Aligned_cols=59  Identities=19%  Similarity=0.248  Sum_probs=35.5

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHH----HCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             633889999609857999999998----8698499999870478766555577881899999999999809958981707
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLK----RDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~----~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      .|+|||+|-.||+ -|.+.|.+-.    +-+++|.++.-   +..+        +  .    ....|+..+++...++-.
T Consensus         6 ~k~mkIavl~SG~-Gsnl~aii~~~~~~~~~~eI~~VIs---n~~~--------~--~----~l~~~~~~~i~~~~~~~~   67 (215)
T 3kcq_A            6 KKELRVGVLISGR-GSNLEALAKAFSTEESSVVISCVIS---NNAE--------A--R----GLLIAQSYGIPTFVVKRK   67 (215)
T ss_dssp             -CCEEEEEEESSC-CHHHHHHHHHTCCC-CSEEEEEEEE---SCTT--------C--T----HHHHHHHTTCCEEECCBT
T ss_pred             CCCCEEEEEEECC-CHHHHHHHHHHHCCCCCEEEEEEEE---CCCC--------C--H----HHHHHHHCCCCEEECCCC
T ss_conf             9987899999398-7739999999776998839999995---7964--------1--7----776777549988742667


Q ss_pred             H
Q ss_conf             8
Q gi|254780151|r   94 E   94 (408)
Q Consensus        94 ~   94 (408)
                      .
T Consensus        68 ~   68 (215)
T 3kcq_A           68 P   68 (215)
T ss_dssp             T
T ss_pred             C
T ss_conf             6


No 59 
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A
Probab=80.67  E-value=3  Score=20.77  Aligned_cols=88  Identities=13%  Similarity=0.008  Sum_probs=56.6

Q ss_pred             CCCCCCCCC-CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE
Q ss_conf             434678886-3388999960985799999999886984999998704787665555778818999999999998099589
Q gi|254780151|r   10 NSLDLDKNP-KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHY   88 (408)
Q Consensus        10 ~~~~~~~~~-k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~   88 (408)
                      .+++-.-.. +.|||+|-=|||-..++|-.|.+.  ..|.-+++-..+..-....+.......|.+...++|++..|.+-
T Consensus        10 ~~~~~~~~~~~~mkvLviGsGgrEhAia~~l~~s--~~~~~v~~~pgN~g~~~~~~~~~i~~~d~~~i~~~~~~~~iD~v   87 (451)
T 2yrx_A           10 HSSGENLYFQSHMNVLVIGRGGREHAIAWKAAQS--PLVGKLYVAPGNPGIADVAELVHIDELDIEALVQFAKQQAIDLT   87 (451)
T ss_dssp             -----CCCCCSSEEEEEEECSHHHHHHHHHHHTC--TTEEEEEEEECCTTGGGTSEECCCCTTCHHHHHHHHHHTTCSEE
T ss_pred             CCCCCCCHHHCCCEEEEECCCHHHHHHHHHHHHC--CCCCEEEEECCCHHHHHHCEEEECCCCCHHHHHHHHHHHCCCEE
T ss_conf             5754420241297899989788999999999749--89898999789879985170462486899999999998399999


Q ss_pred             ECCHHHHHHHH
Q ss_conf             81707886632
Q gi|254780151|r   89 VFDYEERFRNA   99 (408)
Q Consensus        89 ~~d~~~~f~~~   99 (408)
                      ++--+.--...
T Consensus        88 vvGpE~pL~~g   98 (451)
T 2yrx_A           88 IVGPEAPLASG   98 (451)
T ss_dssp             EECSHHHHHTT
T ss_pred             EECCCHHHHHH
T ss_conf             98975788889


No 60 
>2c78_A Elongation factor TU-A; hydrolase, GTPase, translation elongation factor, protein synthesis, antibiotic, GTP-binding, nucleotide-binding; HET: GNP PUL; 1.4A {Thermus thermophilus} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2wrn_Z* 2wrq_Z* 2c77_A* 1aip_A 1exm_A* 1ha3_A* 3fic_Z* 1b23_P* 1ob5_A* 1ttt_A* 1tui_A* 1zc8_Y 1eft_A* 1mj1_A* 1ob2_A* 1dg1_G* 1efc_A* 1ls2_A 1qzd_A 2bvn_A* ...
Probab=79.96  E-value=3.1  Score=20.61  Aligned_cols=34  Identities=18%  Similarity=0.359  Sum_probs=24.7

Q ss_pred             EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             999975972000696389997388866588876897145
Q gi|254780151|r  348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       348 ~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      ++++|.+|. ++-||+-.+|=++    ++.+|+|+|.+-
T Consensus       370 v~~~l~~p~-~~~~~~RfilR~~----g~tvg~G~V~~v  403 (405)
T 2c78_A          370 FTVELIKPV-ALEEGLRFAIREG----GRTVGAGVVTKI  403 (405)
T ss_dssp             EEEEEEEEE-EECTTCEEEEEET----TEEEEEEEEEEE
T ss_pred             EEEEECCEE-EECCCCEEEEEEC----CEEEEEEEEEEE
T ss_conf             999989848-8777989999959----978999999898


No 61 
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, cytoplasm, hydrolase, nucleotide-B protease, serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A
Probab=79.47  E-value=3.2  Score=20.50  Aligned_cols=123  Identities=11%  Similarity=0.109  Sum_probs=72.6

Q ss_pred             HHHHHHHHHCCCCEEECCHH---HH---------HHHHCCCCCHHHHHCCCCCCCEECCCCEEE---------HHHHHHH
Q ss_conf             99999999809958981707---88---------663224411267870886120000154110---------5888887
Q gi|254780151|r   74 YDARRVCDTINVSHYVFDYE---ER---------FRNAVIVPFASSYAAGETPLPCVDCNRTVK---------FSDLLSV  132 (408)
Q Consensus        74 ~~a~~va~~LgI~~~~~d~~---~~---------f~~~V~~~~~~~y~~G~TPNPc~~CN~~iK---------F~~l~~~  132 (408)
                      .-|+.+|+.||.|+..+++.   ++         |-.-+-.+.++.+.++.++||.+.-+..=|         ..+|++.
T Consensus       123 s~ar~ia~~l~~~f~~islgG~~d~~~lrGh~~ty~Gs~pg~I~q~l~~~~~~nPVi~lDEIdK~~~~~~gd~~~aLL~v  202 (543)
T 3m6a_A          123 SLAKSIAKSLGRKFVRISLGGVRDESEIRGHRRTYVGAMPGRIIQGMKKAGKLNPVFLLDEIDKMSSDFRGDPSSAMLEV  202 (543)
T ss_dssp             HHHHHHHHHHTCEEEEECCCC--------------------CHHHHHHTTCSSSEEEEEEESSSCC---------CCGGG
T ss_pred             HHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHCCCCCCEEECCCCCCCCCCCCCCHHHHHHHH
T ss_conf             99998887608981698566455321347887775688650799999862888843622755555768788888875554


Q ss_pred             HCC-CCCCEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEE-ECCCCCCCHHHHHHHHHHCCCC
Q ss_conf             401-68764522531102541267877316885315787873189863020221003-3425689978989999741254
Q gi|254780151|r  133 TRQ-LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL-RFPLGDMKKESVRDLAREMGLD  210 (408)
Q Consensus       133 a~~-~g~~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~-~FPlg~~~K~eVR~~A~~~gl~  210 (408)
                      .+. ....|  +-||-....    +-.....++-+.|.        ..++..-++|+ ++.+-.++..|..+||+++=+|
T Consensus       203 LDp~qn~~f--~D~y~~~~~----dls~vlfi~TaN~~--------~~I~~~L~dR~evI~~~~yt~~Ek~~Ia~~~LlP  268 (543)
T 3m6a_A          203 LDPEQNSSF--SDHYIEETF----DLSKVLFIATANNL--------ATIPGPLRDRMEIINIAGYTEIEKLEIVKDHLLP  268 (543)
T ss_dssp             TCTTTTTBC--CCSSSCCCC----BCSSCEEEEECSST--------TTSCHHHHHHEEEEECCCCCHHHHHHHHHHTHHH
T ss_pred             CCCCCCCCC--CCCCCCCCC----CCCCEEEEEECCCC--------CCCCHHHHCCCEEEECCCCCHHHHHHHHHHHCCH
T ss_conf             076567666--464336898----84717999736983--------2178557507457706987777888889862179


No 62 
>3agp_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase; 2.80A {Escherichia coli O157} PDB: 3agq_A
Probab=79.38  E-value=3.3  Score=20.49  Aligned_cols=37  Identities=14%  Similarity=0.277  Sum_probs=27.1

Q ss_pred             EEEEECCCCCCCCCCEEEEEECCCCCCCEEEEEEEECCCCCC
Q ss_conf             999975972000696389997388866588876897145553
Q gi|254780151|r  348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRS  389 (408)
Q Consensus       348 ~~V~f~eP~~aiAPGQ~~VfY~~D~~~~~vLGGGiI~~t~~~  389 (408)
                      +.+.|++|. .+.+|+-.+|-+..    +-+|+|+|....+.
T Consensus       643 V~l~L~~PI-~ve~g~RFVLRD~G----rTVG~GvVikVls~  679 (1289)
T 3agp_A          643 MVVTLIHPI-AMDDGLRFAIREGG----RTVGAGVVAKVLSG  679 (1289)
T ss_dssp             EEEEEEEEE-ECCTTCEEEEEETT----EEEEEEEEEEEECC
T ss_pred             EEEEECCEE-EECCCCEEEEEECC----EEEEEEEEEEECCC
T ss_conf             999989748-97679989999899----68999999895789


No 63 
>3fz0_A Nucleoside hydrolase, putative; NH fold, open alpha/beta structure, glycosidase; HET: BTB; 2.50A {Trypanosoma brucei}
Probab=79.24  E-value=3.3  Score=20.46  Aligned_cols=56  Identities=16%  Similarity=0.290  Sum_probs=41.7

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             3388999960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      .++||++=...|+|-++|..++..+ ..||.|++.-.          |-|..++....|.++.+.+|
T Consensus         5 ~~kkvIiDtD~G~DDa~Al~~al~~~~~~l~gIt~v~----------GN~~~~~~~~na~~~l~~~g   61 (360)
T 3fz0_A            5 VHRKLIIDTDCGGDDAIAIMLAMTQPDVEVIAITVVW----------GNVEVNQGMENIGKLLDLYD   61 (360)
T ss_dssp             CEEEEEEEECCCHHHHHHHHHHHTSTTEEEEEEEECC----------SSSCHHHHHHHHHHHHHHHT
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             7765999899966899999999878998899998777----------98489999999999999848


No 64 
>2ejb_A Probable aromatic acid decarboxylase; phenylacrylic acid decarboxylase, X-RAY diffraction, structural genomics, NPPSFA; 2.15A {Aquifex aeolicus}
Probab=79.04  E-value=3.2  Score=20.56  Aligned_cols=31  Identities=16%  Similarity=0.199  Sum_probs=23.4

Q ss_pred             CEEEEEECCCHHHHHHHHH---HHHCCCEEEEEE
Q ss_conf             8899996098579999999---988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAAL---LKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~l---L~~~G~~V~g~~   51 (408)
                      +||++|+||+.-+..+..|   |++.|++|.-+.
T Consensus         2 krI~lgITGasga~~a~~l~~~L~k~g~~V~vv~   35 (189)
T 2ejb_A            2 QKIALCITGASGVIYGIKLLQVLEELDFSVDLVI   35 (189)
T ss_dssp             CEEEEEECSSTTHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             8899997428999999999999997899799996


No 65 
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis F11}
Probab=78.19  E-value=2.1  Score=21.93  Aligned_cols=12  Identities=25%  Similarity=0.526  Sum_probs=5.3

Q ss_pred             HHHHHHHHCCCC
Q ss_conf             989999741254
Q gi|254780151|r  199 SVRDLAREMGLD  210 (408)
Q Consensus       199 eVR~~A~~~gl~  210 (408)
                      .+-..++++|++
T Consensus        95 ~aa~~L~~~Gf~  106 (148)
T 2fsx_A           95 GAAEVATEAGIT  106 (148)
T ss_dssp             HHHHHHHHTTCC
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999984974


No 66 
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus}
Probab=78.05  E-value=3  Score=20.79  Aligned_cols=30  Identities=23%  Similarity=0.431  Sum_probs=24.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             338899996098579999999988698499
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      ++++|++--.+|..|..+|..|++.||+|.
T Consensus        52 ~~~~iv~~C~~g~rs~~aa~~L~~~G~~~~   81 (94)
T 1wv9_A           52 PRRPLLLVCEKGLLSQVAALYLEAEGYEAM   81 (94)
T ss_dssp             CSSCEEEECSSSHHHHHHHHHHHHHTCCEE
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHCCCCEE
T ss_conf             344436777998249999999998699399


No 67 
>1sbz_A Probable aromatic acid decarboxylase; FMN binding, PAD1, UBIX, montreal-kingston bacterial structural genomics initiative, BSGI; HET: FMN; 2.00A {Escherichia coli O157} SCOP: c.34.1.1
Probab=78.02  E-value=2.8  Score=20.97  Aligned_cols=30  Identities=27%  Similarity=0.451  Sum_probs=23.4

Q ss_pred             CEEEEEECCCHHHHHHHHHH---HH-CCCEEEEE
Q ss_conf             88999960985799999999---88-69849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL---KR-DGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL---~~-~G~~V~g~   50 (408)
                      |||+||+||+.-+..+..|+   ++ .|++|.-+
T Consensus         1 MrIvvgITGasga~~a~~ll~~L~~~~g~eV~vV   34 (197)
T 1sbz_A            1 MKLIVGMTGATGAPLGVALLQALREMPNVETHLV   34 (197)
T ss_dssp             CEEEEEECSSSCHHHHHHHHHHHHTCTTCEEEEE
T ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             9899997118999999999999973389879999


No 68 
>2c40_A Inosine-uridine preferring nucleoside hydrolase family protein; spine; 2.2A {Bacillus anthracis}
Probab=76.85  E-value=3.8  Score=19.98  Aligned_cols=54  Identities=24%  Similarity=0.389  Sum_probs=42.6

Q ss_pred             EEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCC
Q ss_conf             8999960985799999999886-984999998704787665555778818999999999998099
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINV   85 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI   85 (408)
                      ||++=-..|+|-++|..++... .++|.|++.-.          |-|..++....|.++.+.+|.
T Consensus         3 kvIiDtD~g~DD~~AL~~al~~p~~~l~gIt~v~----------GN~~~~~~~~na~~~l~~~g~   57 (312)
T 2c40_A            3 KVYFNHDGGVDDLVSLFLLLQMDNVELTGVSVIP----------ADCYLEPAMSASRKIIDRFGK   57 (312)
T ss_dssp             EEEEEECCSHHHHHHHHHHTTCTTEEEEEEEECS----------SSSCHHHHHHHHHHHHHHHCC
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHHHCC
T ss_conf             8999899987999999999878998899999905----------985889999999999998289


No 69 
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, X-RAY crystallography, structural genomics; 2.10A {Mycobacterium tuberculosis H37RV} PDB: 2zjf_A*
Probab=76.30  E-value=3.5  Score=20.31  Aligned_cols=68  Identities=19%  Similarity=0.186  Sum_probs=44.0

Q ss_pred             CCCEEEEEECCCHHHHHH----HHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             338899996098579999----99998869849999987047876655557788189999999999980995
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVV----AALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus        19 k~~kV~va~SGGVDSsva----a~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      .+...+|.+-|.-+|+..    +-.|.++||.|+.+-++-+...+.......-..++...|+..+.++|+++
T Consensus        25 ~~gp~vvllHG~~~s~~~w~~~~~~L~~~g~~Vva~Dl~G~G~S~~~~~~~~~s~~~~~~dl~~~~~~l~~~   96 (356)
T 2e3j_A           25 QQGPLVVLLHGFPESWYSWRHQIPALAGAGYRVVAIDQRGYGRSSKYRVQKAYRIKELVGDVVGVLDSYGAE   96 (356)
T ss_dssp             CCSCEEEEECCTTCCGGGGTTTHHHHHHTTCEEEEECCTTSTTSCCCCSGGGGSHHHHHHHHHHHHHHTTCS
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             899928986999878899999999998499989997699989999998877665788999999889873468


No 70 
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), structural genomics; HET: ACO UNL; 1.70A {Mus musculus}
Probab=76.26  E-value=1.9  Score=22.18  Aligned_cols=47  Identities=32%  Similarity=0.276  Sum_probs=30.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCE-------EEEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             46555444346788863388-------99996098579--9999999886984999
Q gi|254780151|r    3 VSEATRLNSLDLDKNPKDMR-------VVVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus         3 ~~~~~~~~~~~~~~~~k~~k-------V~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      -||-+|...++.--.|-+.+       .+||+.||.-|  |.+|..|++.|+.|+-
T Consensus        49 sss~~r~~~lg~~~~~~~~~~~~~~~~~IIGLTGgigSGKStva~~L~~~G~~vid  104 (281)
T 2f6r_A           49 SSSSFRQRILGNLLQPPNERPELPSGLYVLGLTGISGSGKSSVAQRLKNLGAYIID  104 (281)
T ss_dssp             ------CEETTSCCSCCCCCTTSCTTCEEEEEEECTTSCHHHHHHHHHHHTCEEEE
T ss_pred             CCHHHHHHHHHHCCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             65288999866300887668999999989998788752199999999987996998


No 71 
>2mas_A Inosine-uridine nucleoside N-ribohydrolase; purine nucleoside hydrolase, IU-NH, purine nucleosidase; HET: PIR; 2.30A {Crithidia fasciculata} SCOP: c.70.1.1 PDB: 1mas_A* 1ezr_A
Probab=75.46  E-value=4.2  Score=19.73  Aligned_cols=58  Identities=17%  Similarity=0.291  Sum_probs=44.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC---CCEE
Q ss_conf             88999960985799999999886-98499999870478766555577881899999999999809---9589
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN---VSHY   88 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg---I~~~   88 (408)
                      +||++=-..|+|-++|..++... -.+|.|++.-.          |-|..++..+.|.++.+.+|   ||.+
T Consensus         2 kkvIiDtD~G~DDa~AL~~al~~p~v~l~gIt~v~----------GN~~~~~~~~n~~~ll~~~g~~dIPV~   63 (314)
T 2mas_A            2 KKIILDCDPGLDDAVAILLAHGNPEIELLAITTVV----------GNQTLAKVTRNAQLVADIAGITGVPIA   63 (314)
T ss_dssp             EEEEEEECCSHHHHHHHHHHHHCTTEEEEEEEECS----------SSSCHHHHHHHHHHHHHHTTCCSCCEE
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHHHCCCCCCEE
T ss_conf             87999899966999999999768997899999777----------984799999999999998589998885


No 72 
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, PSI-2, protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}
Probab=75.21  E-value=2.8  Score=20.92  Aligned_cols=37  Identities=22%  Similarity=0.330  Sum_probs=29.9

Q ss_pred             CCCCCCCCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             7888633889999-6098579999999988698499999
Q gi|254780151|r   14 LDKNPKDMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        14 ~~~~~k~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      -..+-+.|||+|. =||++-+.++..||+ +|++|+++.
T Consensus        15 ~~~~~~~MkIlI~GasG~iG~~lv~~Ll~-~g~~V~~l~   52 (236)
T 3e8x_A           15 ENLYFQGMRVLVVGANGKVARYLLSELKN-KGHEPVAMV   52 (236)
T ss_dssp             ------CCEEEEETTTSHHHHHHHHHHHH-TTCEEEEEE
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             44577999089999988899999999997-859899998


No 73 
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A*
Probab=73.66  E-value=2.6  Score=21.18  Aligned_cols=35  Identities=29%  Similarity=0.510  Sum_probs=27.3

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             7888633889999609857999999998869849999
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |.+.+ .|+|+| +=||+-...||+.|+++|++|+=+
T Consensus        11 mp~~~-~~~V~I-IGaGiaGL~aA~~L~~~G~~V~vl   45 (478)
T 2ivd_A           11 MPRTT-GMNVAV-VGGGISGLAVAHHLRSRGTDAVLL   45 (478)
T ss_dssp             -------CCEEE-ECCBHHHHHHHHHHHTTTCCEEEE
T ss_pred             CCCCC-CCCEEE-ECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             88999-999899-898789999999998589988999


No 74 
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5
Probab=73.31  E-value=3.8  Score=19.99  Aligned_cols=37  Identities=32%  Similarity=0.370  Sum_probs=28.1

Q ss_pred             CCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             67888633889999609857999999998869849999
Q gi|254780151|r   13 DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        13 ~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +.++....+||+| +=||+-...||+.|.++|++|+=+
T Consensus         6 ~~~~~~~~kkVvI-IGaG~aGL~aA~~L~~~G~~V~Vl   42 (504)
T 1sez_A            6 GEDKHSSAKRVAV-IGAGVSGLAAAYKLKIHGLNVTVF   42 (504)
T ss_dssp             -------CCEEEE-ECCSHHHHHHHHHHHTTSCEEEEE
T ss_pred             CCCCCCCCCEEEE-ECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             7877799891899-898889999999998589999999


No 75 
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris}
Probab=72.77  E-value=4.8  Score=19.29  Aligned_cols=37  Identities=14%  Similarity=0.356  Sum_probs=28.4

Q ss_pred             CCCCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             788863388999-96098579999999988698499999
Q gi|254780151|r   14 LDKNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        14 ~~~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |+.++|++.|+| |=|+|+-.++|-.|+ ++|+.|+.+.
T Consensus         1 M~~~~knk~vlITGas~GIG~aiA~~la-~~Ga~V~i~~   38 (252)
T 3h7a_A            1 MSLTPRNATVAVIGAGDYIGAEIAKKFA-AEGFTVFAGR   38 (252)
T ss_dssp             ----CCSCEEEEECCSSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             9899999989997585589999999999-8799999998


No 76 
>3dlo_A Universal stress protein; unknown function, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.97A {Archaeoglobus fulgidus}
Probab=71.95  E-value=5  Score=19.16  Aligned_cols=101  Identities=18%  Similarity=0.100  Sum_probs=57.8

Q ss_pred             CCCEEEEEECCCHHHHH-----HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             33889999609857999-----9999988698499999870478766555577881899999999999809958981707
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSV-----VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        19 k~~kV~va~SGGVDSsv-----aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      --++|+|+..-|-|.|-     |+.+.+..|-.++.++..-+.......  ..--.++.++.+.+.++..|++..+.-  
T Consensus        23 ~~~~IlVavD~~S~~s~~al~~A~~~A~~~~~~l~lvhv~~~~~~~~~~--~~~~~~~~l~~~~~~~~~~~~~~~~~~--   98 (155)
T 3dlo_A           23 IYMPIVVAVDKKSDRAERVLRFAAEEARLRGVPVYVVHSLPGGGRTKDE--DIIEAKETLSWAVSIIRKEGAEGEEHL--   98 (155)
T ss_dssp             CCCCEEEECCSSSHHHHHHHHHHHHHHHHHTCCEEEEEEECCSTTSCHH--HHHHHHHHHHHHHHHHHHTTCCEEEEE--
T ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCHH--HHHHHHHHHHHHHHHHHHHCCCCEEEE--
T ss_conf             7473899987959899999999999999839969999974388777667--899999999999999998499948999--


Q ss_pred             HHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCC
Q ss_conf             8866322441126787088612000015411058888874016876452253110
Q gi|254780151|r   94 ERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        94 ~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar  148 (408)
                                    ...+..|           ...+.++|++.++|.|..|...+
T Consensus        99 --------------~v~~g~~-----------~~~I~~~a~~~~adLIV~G~~~~  128 (155)
T 3dlo_A           99 --------------LVRGKEP-----------PDDIVDFADEVDAIAIVIGIRKR  128 (155)
T ss_dssp             --------------EESSSCH-----------HHHHHHHHHHTTCSEEEEECCEE
T ss_pred             --------------EEECCCH-----------HHHHHHHHHHCCCCEEEECCCCC
T ss_conf             --------------9957898-----------99999999872998998568999


No 77 
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1
Probab=71.21  E-value=5.2  Score=19.04  Aligned_cols=92  Identities=12%  Similarity=0.222  Sum_probs=49.1

Q ss_pred             HHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH--HHHHH-----------
Q ss_conf             79999999988698499999870478766555577881899999999999809958981707--88663-----------
Q gi|254780151|r   32 DSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE--ERFRN-----------   98 (408)
Q Consensus        32 DSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~--~~f~~-----------   98 (408)
                      |+.-.+..|.+.|.+.+-+..-.+....... ...-........++.+.+..++|...+.--  .+.-+           
T Consensus       229 ~~~~~~~~l~~~g~d~~~~~~g~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~pvi~~g~~~~~~~ae~~l~~g~~D~v  307 (671)
T 1ps9_A          229 ETVELAQAIEAAGATIINTGIGWHEARIPTI-ATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMV  307 (671)
T ss_dssp             HHHHHHHHHHHHTCSEEEEEECBTTCSSCSS-STTSCTTTTHHHHHHHTTSCSSCEEECSSCCSHHHHHHHHHTTSCSEE
T ss_pred             HHHHHHHHHHHHCCCEEECCCCCCCCCCCCC-CCCCCCHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCCEE
T ss_conf             9999999999848720212235544567655-676641156999999851443347971787778999999977998866


Q ss_pred             -----HCCCC-CHHHHHCCCCC--CCEECCCCEE
Q ss_conf             -----22441-12678708861--2000015411
Q gi|254780151|r   99 -----AVIVP-FASSYAAGETP--LPCVDCNRTV  124 (408)
Q Consensus        99 -----~V~~~-~~~~y~~G~TP--NPc~~CN~~i  124 (408)
                           -+-+| +++-.+.|+.-  .||+.||+-.
T Consensus       308 ~~gR~~iadPd~~~k~~~g~~~~i~~C~~cn~~~  341 (671)
T 1ps9_A          308 SMARPFLADAELLSKAQSGRADEINTCIGCNQAC  341 (671)
T ss_dssp             EESTHHHHCTTHHHHHHTTCGGGCCCCCCCCTTT
T ss_pred             ECCHHHHHCCHHHHHHHCCCCCCCCCCCCCCCCC
T ss_conf             0045977194689999729944587272657605


No 78 
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae}
Probab=70.95  E-value=4.3  Score=19.64  Aligned_cols=33  Identities=21%  Similarity=0.306  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             9999999998099589817078866322441126787088612
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                      .++++++=+.-.=.+.++|.++.          ++|..|.-|+
T Consensus        27 ~~e~~~ll~~~~~~~~liDvR~~----------~e~~~ghIpg   59 (139)
T 3d1p_A           27 FEDMKRIVGKHDPNVVLVDVREP----------SEYSIVHIPA   59 (139)
T ss_dssp             HHHHHHHHHHTCTTEEEEECSCH----------HHHHHCCCTT
T ss_pred             HHHHHHHHHCCCCCEEEEECCCH----------HHHHCCCCCC
T ss_conf             99999998566949899989888----------9997396789


No 79 
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha JMP134}
Probab=70.61  E-value=4.3  Score=19.62  Aligned_cols=32  Identities=28%  Similarity=0.352  Sum_probs=25.0

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             633889999609857999999998869849999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      -.+|||+|-=-|.+-|.+|++ |.++|+||+-+
T Consensus        17 ~~~MkI~IlGaGaiGt~~A~~-L~~aG~dV~li   48 (318)
T 3hwr_A           17 FQGMKVAIMGAGAVGCYYGGM-LARAGHEVILI   48 (318)
T ss_dssp             ---CEEEEESCSHHHHHHHHH-HHHTTCEEEEE
T ss_pred             HCCCEEEEECCCHHHHHHHHH-HHHCCCCEEEE
T ss_conf             169989999907999999999-98479908999


No 80 
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1}
Probab=70.61  E-value=5.3  Score=18.96  Aligned_cols=63  Identities=24%  Similarity=0.213  Sum_probs=39.0

Q ss_pred             CCCCCCCCCCEEEEEECCC----HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             4678886338899996098----579999999988698499999870478766555577881899999999999809958
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGG----VDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGG----VDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      .-..++.++.||++|--+|    +-..+.+.+|...||+|+-+              |.+.+.+++-++   |.+-+...
T Consensus        10 ~~~~~p~rk~rvvia~~~~D~HdiG~~~va~~l~~~G~eV~~L--------------G~~~p~e~~v~~---a~~~~~d~   72 (161)
T 2yxb_A           10 RVLGTPRRRYKVLVAKMGLDGHDRGAKVVARALRDAGFEVVYT--------------GLRQTPEQVAMA---AVQEDVDV   72 (161)
T ss_dssp             ------CCSCEEEEEEESSSSCCHHHHHHHHHHHHTTCEEECC--------------CSBCCHHHHHHH---HHHTTCSE
T ss_pred             HHCCCCCCCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEC--------------CCCCCHHHHHHH---HHHCCCCE
T ss_conf             8425998898799980498624788999999999789889978--------------977899999999---98669989


Q ss_pred             EECC
Q ss_conf             9817
Q gi|254780151|r   88 YVFD   91 (408)
Q Consensus        88 ~~~d   91 (408)
                      ..+.
T Consensus        73 v~lS   76 (161)
T 2yxb_A           73 IGVS   76 (161)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             9985


No 81 
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A*
Probab=70.41  E-value=5.4  Score=18.93  Aligned_cols=34  Identities=18%  Similarity=0.352  Sum_probs=26.0

Q ss_pred             CCCCCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8633889999-6098579999999988698499999
Q gi|254780151|r   17 NPKDMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        17 ~~k~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +.|+|||+|- -||=+-|.++-.|++ +||+|+++-
T Consensus        26 ~~~~MKILVTGatGfIGs~Lv~~L~~-~g~~Vi~~d   60 (379)
T 2c5a_A           26 PSENLKISITGAGGFIASHIARRLKH-EGHYVIASD   60 (379)
T ss_dssp             TTSCCEEEEETTTSHHHHHHHHHHHH-TTCEEEEEE
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             77999799989998899999999997-839899996


No 82 
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A*
Probab=70.31  E-value=1.5  Score=22.83  Aligned_cols=98  Identities=12%  Similarity=0.127  Sum_probs=56.4

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEEEEC---CCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCC
Q ss_conf             996098579999999988698499999870---47876655557788189999999999980995898170788663224
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGVTLQL---YNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVI  101 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~~m~~---~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~  101 (408)
                      |.+|||+..++.  -.++.|++.+-+|+.+   |...        --+++++...++.++..|+....+..        .
T Consensus         8 ~~~~~gl~~a~~--~a~~~G~~~~qif~~~p~~w~~~--------~~~~~~~~~~r~~~~~~~l~~~~~~~--------h   69 (285)
T 1qtw_A            8 VSAAGGLANAAI--RAAEIDATAFALFTKNQRQWRAA--------PLTTQTIDEFKAACEKYHYTSAQILP--------H   69 (285)
T ss_dssp             CCCTTCHHHHHH--HHHHTTCSEEECCSSCSSCSSCC--------CCCHHHHHHHHHHHHHTTCCGGGBCC--------B
T ss_pred             ECCCCCHHHHHH--HHHHCCCCEEEEECCCCCCCCCC--------CCCHHHHHHHHHHHHHCCCCCCEEEE--------E
T ss_conf             777547999999--99974999999978997777889--------99999999999999982999735998--------4


Q ss_pred             CCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECC
Q ss_conf             411267870886120000154110588888740168764522
Q gi|254780151|r  102 VPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLAT  143 (408)
Q Consensus       102 ~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iAT  143 (408)
                      .|+.-   .=..|+|-++=...=.|...++.|.++|+..|.+
T Consensus        70 ~py~~---nl~s~~~~~r~~si~~~~~~l~~a~~LGa~~vv~  108 (285)
T 1qtw_A           70 DSYLI---NLGHPVTEALEKSRDAFIDEMQRCEQLGLSLLNF  108 (285)
T ss_dssp             CCTTC---CTTCSSHHHHHHHHHHHHHHHHHHHHTTCCEEEE
T ss_pred             CCCCC---CCCCCCHHHHHHHHHHHHHHHHHHHHCCCCCEEE
T ss_conf             78655---6478887999999999999999999808865474


No 83 
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, structural genomics; HET: PGE; 1.76A {Clostridium difficile 630}
Probab=69.39  E-value=3.6  Score=20.19  Aligned_cols=25  Identities=32%  Similarity=0.521  Sum_probs=15.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEE
Q ss_conf             9999609857999999998869849
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDV   47 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V   47 (408)
                      |++.-+||..|+.++.+|++.||+|
T Consensus        93 v~~~~~~g~rs~~~~~~L~~~G~~v  117 (134)
T 3g5j_A           93 VIYCARGGMRSGSIVNLLSSLGVNV  117 (134)
T ss_dssp             EEECSSSSHHHHHHHHHHHHTTCCC
T ss_pred             EEEECCCCCHHHHHHHHHHHHCCCE
T ss_conf             9985787718999999999949980


No 84 
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa}
Probab=69.16  E-value=4.9  Score=19.22  Aligned_cols=36  Identities=14%  Similarity=0.233  Sum_probs=28.5

Q ss_pred             CCCCCCCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             888633889999-6098579999999988698499999
Q gi|254780151|r   15 DKNPKDMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        15 ~~~~k~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      .++-.+|||+|- -||-|-|.++..|++ +|++|.++.
T Consensus         8 ~~~~~~mkilVtGatG~vG~~l~~~L~~-~g~~V~~l~   44 (342)
T 2x4g_A            8 SRPGAHVKYAVLGATGLLGHHAARAIRA-AGHDLVLIH   44 (342)
T ss_dssp             ----CCCEEEEESTTSHHHHHHHHHHHH-TTCEEEEEE
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             7999999499989998899999999997-869899997


No 85 
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} PDB: 3icp_A*
Probab=68.96  E-value=2.7  Score=21.05  Aligned_cols=30  Identities=40%  Similarity=0.609  Sum_probs=24.7

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             88999-96098579999999988698499999
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+| |-||-+-+.++-.|++ +|++|+++-
T Consensus         1 MKILItGatGfiG~~l~~~L~~-~g~~V~~~~   31 (312)
T 3ko8_A            1 MRIVVTGGAGFIGSHLVDKLVE-LGYEVVVVD   31 (312)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHH-TTCEEEEEC
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             9699988886899999999997-869899997


No 86 
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2
Probab=68.70  E-value=5.8  Score=18.68  Aligned_cols=58  Identities=14%  Similarity=0.322  Sum_probs=37.0

Q ss_pred             CCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             63388999-9609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   18 PKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        18 ~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      -+++.++| |=|+|+-.++|-.|+ ++|++|+.....                   .+.++.+++.++......|++++
T Consensus         3 L~gK~~lVTG~s~GIG~aia~~la-~~Ga~V~~~~r~-------------------~~~~~~~~~~~~~~~~~~Dv~~~   61 (245)
T 1uls_A            3 LKDKAVLITGAAHGIGRATLELFA-KEGARLVACDIE-------------------EGPLREAAEAVGAHPVVMDVADP   61 (245)
T ss_dssp             TTTCEEEEESTTSHHHHHHHHHHH-HTTCEEEEEESC-------------------HHHHHHHHHTTTCEEEECCTTCH
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEECC-------------------HHHHHHHHHHCCCEEEEEECCCH
T ss_conf             899899993778789999999999-879999999798-------------------78999999875996999957999


No 87 
>2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Helicobacter pylori 26695}
Probab=68.24  E-value=4.3  Score=19.60  Aligned_cols=31  Identities=23%  Similarity=0.279  Sum_probs=24.3

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             6338899996098579999999988698499
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      .++++|++-=.+|.-|..|+..|++.||+.+
T Consensus        54 ~k~~~iiv~C~sG~rS~~a~~~L~~~G~~~v   84 (110)
T 2k0z_A           54 HKDKKVLLHCRAGRRALDAAKSMHELGYTPY   84 (110)
T ss_dssp             CSSSCEEEECSSSHHHHHHHHHHHHTTCCCE
T ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHCCCCEE
T ss_conf             7998689988998489999999998599879


No 88 
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2
Probab=67.67  E-value=3  Score=20.75  Aligned_cols=33  Identities=24%  Similarity=0.422  Sum_probs=26.9

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEEC
Q ss_conf             88999-96098579999999988698499999870
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQL   54 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~   54 (408)
                      +||+| |-+|-+-|.++..||+ +||+|+|+-...
T Consensus        15 k~vLITGatGfIGs~l~~~Ll~-~g~~V~~i~r~~   48 (335)
T 1rpn_A           15 RSALVTGITGQDGAYLAKLLLE-KGYRVHGLVARR   48 (335)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHH-TTCEEEEEECCC
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEEECCC
T ss_conf             5499975887899999999997-849899998999


No 89 
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A
Probab=66.85  E-value=4.1  Score=19.75  Aligned_cols=29  Identities=41%  Similarity=0.662  Sum_probs=22.8

Q ss_pred             CEEEEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             8899996098579--9999999886984999
Q gi|254780151|r   21 MRVVVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus        21 ~kV~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      ||.+||+.||.-|  |.+|-+|++.|+.|+-
T Consensus         3 m~~IIgItG~igSGKStva~~l~~~G~~vid   33 (218)
T 1vht_A            3 LRYIVALTGGIGSGKSTVANAFADLGINVID   33 (218)
T ss_dssp             CCEEEEEECCTTSCHHHHHHHHHHTTCEEEE
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             7769998798878799999999987991998


No 90 
>1r5b_A Eukaryotic peptide chain release factor GTP- binding subunit; translation termination, peptide release, GTPase; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A
Probab=66.57  E-value=6.4  Score=18.39  Aligned_cols=93  Identities=10%  Similarity=0.188  Sum_probs=48.1

Q ss_pred             CCCCCCEEEEECCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEE-------------------
Q ss_conf             1755312565235554222112002230377655544568718999980178870089998-------------------
Q gi|254780151|r  283 LDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-------------------  343 (408)
Q Consensus       283 id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pvp~~i~~-------------------  343 (408)
                      +|.....|++.+...+........++.|+..+   .....+.++.+.+.+...  +|++..                   
T Consensus       344 ~~~~~G~vl~~~~~~~~~~~~F~A~v~vl~~~---~~i~~G~~~~lhi~t~~~--~~~i~~I~~~id~~~~~~~~~~~~~  418 (467)
T 1r5b_A          344 SDVQTGYVLTSTKNPVHATTRFIAQIAILELP---SILTTGYSCVMHIHTAVE--EVSFAKLLHKLDKTNRKSKKPPMFA  418 (467)
T ss_dssp             TTCCTTCEEECSSSCCCEEEEEEEEEEECSSC---CCBSSCCCBEEESSSCCC--CBEESSCCCCCCSSCCCCSSCCSBC
T ss_pred             CCCCCCEEEECCCCCCCCEEEEEEEEEECCCC---CCCCCCCEEEEEECCEEE--EEEEEEEEEEECCCCCEECCCHHCC
T ss_conf             10137706845999874168999999310598---778899768999865299--9999999888627885763543004


Q ss_pred             -ECC--EEEEEECCCCCCCCCCEE------EEEECCCCCCCEEEEEEEECC
Q ss_conf             -299--799997597200069638------999738886658887689714
Q gi|254780151|r  344 -NDD--GVYVDFEKSEVGVASGQA------CVFYTSDSNEARVLGGGIISG  385 (408)
Q Consensus       344 -~~~--~~~V~f~eP~~aiAPGQ~------~VfY~~D~~~~~vLGGGiI~~  385 (408)
                       .++  .++++|++|. ++.+++.      -+|=++    ++-+|+|+|.+
T Consensus       419 ~~gd~a~v~~~~~~pi-~ve~~~~~~~lgRfilRd~----g~Tvg~G~I~~  464 (467)
T 1r5b_A          419 TKGMKIIAELETQTPV-CMERFEDYQYMGRFTLRDQ----GTTVAVGKVVK  464 (467)
T ss_dssp             CTTCBCCEEEEEEEEE-ECCCTTTCHHHHEEEEECS----SSCEEEEEEEE
T ss_pred             CCCCEEEEEEEECCEE-EECCCCCCCCCCEEEEEEC----CEEEEEEEEEE
T ss_conf             8998799999989818-9836774787875999989----99799999999


No 91 
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate assisted catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A*
Probab=66.45  E-value=6.4  Score=18.37  Aligned_cols=48  Identities=27%  Similarity=0.318  Sum_probs=34.3

Q ss_pred             CCCCCCCCCCCCCCCEEEEE------E-------CCCHHHHHH--HHHHHHCCCEEEEEEEEC
Q ss_conf             54443467888633889999------6-------098579999--999988698499999870
Q gi|254780151|r    7 TRLNSLDLDKNPKDMRVVVA------M-------SGGVDSSVV--AALLKRDGYDVIGVTLQL   54 (408)
Q Consensus         7 ~~~~~~~~~~~~k~~kV~va------~-------SGGVDSsva--a~lL~~~G~~V~g~~m~~   54 (408)
                      ..-.++++--..++|||++-      |       +||+...+.  |.-|.++||+|+=++...
T Consensus         7 ~~~~~~~~~~~~~~~ri~~vs~~~~P~~~~g~~d~GG~e~~v~~La~~L~~~Gh~V~v~t~~~   69 (438)
T 3c48_A            7 HHHHSSGLVPRGSHMRVAMISMHTSPLQQPGTGDSGGMNVYILSTATELAKQGIEVDIYTRAT   69 (438)
T ss_dssp             ------------CCCEEEEECTTSCTTCC-------CHHHHHHHHHHHHHHTTCEEEEEEECC
T ss_pred             CCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCC
T ss_conf             435678889999997799984663630005999867999999999999997799699995478


No 92 
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A*
Probab=66.33  E-value=5.6  Score=18.79  Aligned_cols=76  Identities=14%  Similarity=0.154  Sum_probs=45.0

Q ss_pred             CCCCCCCCCCEEEEEECC--CHHHHHHHHHHHHCCCEEEEEEEECCCCCCCC---CCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             467888633889999609--85799999999886984999998704787665---5557788189999999999980995
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSG--GVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS---KRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SG--GVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~---~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      |++-.....+||++.=||  |.--+.|   +++.|++|+.+..   +.+...   .....+....|.+...++|+..++.
T Consensus        11 ~~~~~~~~~~kIlIlG~Gqlgr~la~a---A~~lG~~v~v~d~---~~~~pa~~~ad~~~~~~~~D~e~l~~~a~~~~~d   84 (433)
T 2dwc_A           11 LGTATTDSAQKILLLGSGELGKEIAIE---AQRLGVEVVAVDR---YANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPD   84 (433)
T ss_dssp             ECCTTSTTCCEEEEESCSHHHHHHHHH---HHHTTCEEEEEES---STTCHHHHHSSEEEESCTTCHHHHHHHHHHHCCS
T ss_pred             HCCCCCCCCCEEEEECCCHHHHHHHHH---HHHCCCEEEEEEC---CCCCCHHHHCCEEEECCCCCHHHHHHHHHHHCCC
T ss_conf             289989999899999988999999999---9986998999979---7988677735558977999999999999982999


Q ss_pred             EEECCHH
Q ss_conf             8981707
Q gi|254780151|r   87 HYVFDYE   93 (408)
Q Consensus        87 ~~~~d~~   93 (408)
                      ..+..++
T Consensus        85 ~v~~~~e   91 (433)
T 2dwc_A           85 AIIPEIE   91 (433)
T ss_dssp             EEEECSS
T ss_pred             EEEECCC
T ss_conf             9997978


No 93 
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesis; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A*
Probab=65.93  E-value=6.6  Score=18.31  Aligned_cols=31  Identities=19%  Similarity=0.416  Sum_probs=23.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             33889999609857999999998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |++||+| +=||.=-.+||+.|+++|++|+=+
T Consensus         2 k~kki~I-IGaG~sGL~~A~~L~k~g~~V~v~   32 (384)
T 2bi7_A            2 KSKKILI-VGAGFSGAVIGRQLAEKGHQVHII   32 (384)
T ss_dssp             CCCEEEE-ECCSHHHHHHHHHHHTTTCEEEEE
T ss_pred             CCCCEEE-ECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             8686999-896199999999998489957999


No 94 
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3
Probab=65.67  E-value=5.6  Score=18.81  Aligned_cols=26  Identities=19%  Similarity=0.219  Sum_probs=11.4

Q ss_pred             HHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHH
Q ss_conf             89999741254355111023011127751034553
Q gi|254780151|r  200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKR  234 (408)
Q Consensus       200 VR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~  234 (408)
                      +-...++.|+..        +..+ +|.+......
T Consensus        98 aa~~L~~~G~~n--------V~~l-~GG~~~W~~~  123 (137)
T 1qxn_A           98 AGKTLREYGFKT--------IYNS-EGGMDKWLEE  123 (137)
T ss_dssp             HHHHHHHHTCSC--------EEEE-SSCHHHHHHT
T ss_pred             HHHHHHHCCCCC--------EEEE-CCHHHHHHHC
T ss_conf             999999849966--------7980-1879999987


No 95 
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334}
Probab=65.49  E-value=6.1  Score=18.56  Aligned_cols=30  Identities=33%  Similarity=0.550  Sum_probs=24.3

Q ss_pred             CEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             889999-6098579999999988698499999
Q gi|254780151|r   21 MRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+|- =||.+-+.++..|+ ++||+|+++.
T Consensus         1 MkIlV~GatG~iG~~lv~~L~-~~G~~V~~~~   31 (224)
T 3h2s_A            1 MKIAVLGATGRAGSAIVAEAR-RRGHEVLAVV   31 (224)
T ss_dssp             CEEEEETTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             969999989589999999999-7879899998


No 96 
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP binding, purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A
Probab=65.40  E-value=6.7  Score=18.24  Aligned_cols=74  Identities=15%  Similarity=0.079  Sum_probs=47.1

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHH
Q ss_conf             889999609857999999998869-84999998704787665555778818999999999998099589817078866
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFR   97 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~   97 (408)
                      |||+|--|||-.-++|-+|.+... .+|..+   ..+...............|.+....+|+..+|.+-++..+.-.+
T Consensus         1 mkvliiG~GgrEha~~~~l~~~~~~~~~~~~---~~N~g~~~~~~~~~~~~~d~~~i~~~~~~~~id~vi~g~e~~l~   75 (424)
T 2yw2_A            1 MKVLVVGNGGREHAIAWKVAQSPLVKELYVA---KGNAGIWEIAKRVDISPTDVEKLAEFAKNEGVDFTIVGPEAPLV   75 (424)
T ss_dssp             CEEEEEESSHHHHHHHHHHTTCTTCSEEEEE---ECCTTGGGTSEEECSCTTCHHHHHHHHHHHTCSEEEECSHHHHH
T ss_pred             CEEEEECCCHHHHHHHHHHHHCCCCCEEEEE---CCCHHHHHHCCEEEECCCCHHHHHHHHHHHCCCEEEECCCHHHH
T ss_conf             9899989589999999999858998889998---89888985430086288999999999999699999989847888


No 97 
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris CGA009}
Probab=65.40  E-value=6.7  Score=18.24  Aligned_cols=10  Identities=10%  Similarity=0.225  Sum_probs=6.2

Q ss_pred             CCEEECCHHH
Q ss_conf             9589817078
Q gi|254780151|r   85 VSHYVFDYEE   94 (408)
Q Consensus        85 I~~~~~d~~~   94 (408)
                      -++.++|.++
T Consensus        38 ~~~~lIDvR~   47 (139)
T 2hhg_A           38 SDVVIVDIRD   47 (139)
T ss_dssp             TTEEEEECSC
T ss_pred             CCEEEEECCC
T ss_conf             8959998998


No 98 
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus}
Probab=65.02  E-value=6.8  Score=18.19  Aligned_cols=41  Identities=17%  Similarity=0.293  Sum_probs=31.3

Q ss_pred             CCCCCCCCCCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             467888633889999-609857999999998869849999987
Q gi|254780151|r   12 LDLDKNPKDMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVTLQ   53 (408)
Q Consensus        12 ~~~~~~~k~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~m~   53 (408)
                      +...-++.+|||+|- -||=+-|.++..|++ +||+|+++.-.
T Consensus         4 ~~~~~~~~~MKILVtGatGfIG~~l~~~Ll~-~g~~V~~~~r~   45 (321)
T 2pk3_A            4 SHHHHHHGSMRALITGVAGFVGKYLANHLTE-QNVEVFGTSRN   45 (321)
T ss_dssp             ---------CEEEEETTTSHHHHHHHHHHHH-TTCEEEEEESC
T ss_pred             CCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEECC
T ss_conf             6578889966799967888899999999998-84989998088


No 99 
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehydrogenase, reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A*
Probab=64.50  E-value=3.8  Score=20.05  Aligned_cols=60  Identities=13%  Similarity=0.072  Sum_probs=36.9

Q ss_pred             CCCCCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             86338899-9960985799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   17 NPKDMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        17 ~~k~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      +.++++|+ +|=+|.+-|+++-.||+ +||+|.++. +.-..            .    .+......-|+.+...|+.+
T Consensus         2 ~~~kktIlVtGaTG~iG~~lv~~Ll~-~G~~V~~l~-R~~~~------------~----~~~~l~~~~gv~~~~gD~~d   62 (352)
T 1xgk_A            2 AQQKKTIAVVGATGRQGASLIRVAAA-VGHHVRAQV-HSLKG------------L----IAEELQAIPNVTLFQGPLLN   62 (352)
T ss_dssp             -CCCCCEEEESTTSHHHHHHHHHHHH-TTCCEEEEE-SCSCS------------H----HHHHHHTSTTEEEEESCCTT
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE-CCCCC------------C----CHHHCCCCCCCEEEEEECCC
T ss_conf             99999899989971899999999995-899599997-78530------------0----12340114898899975899


No 100
>1g63_A Epidermin modifying enzyme EPID; alpha, beta protein, rossmann like fold, oxidoreductase; HET: FMN; 2.50A {Staphylococcus epidermidis} SCOP: c.34.1.1 PDB: 1g5q_A*
Probab=61.06  E-value=5.2  Score=19.05  Aligned_cols=31  Identities=10%  Similarity=0.109  Sum_probs=23.8

Q ss_pred             CEEEEEECCCHHHHHHHHH---HHHCCCEEEEEE
Q ss_conf             8899996098579999999---988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAAL---LKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~l---L~~~G~~V~g~~   51 (408)
                      .||+++.||++...-+..+   |+++|++|..+.
T Consensus         3 ~kIll~vtGSiaa~k~~~li~~L~~~g~~V~vv~   36 (181)
T 1g63_A            3 GKLLICATASINVININHYIVELKQHFDEVNILF   36 (181)
T ss_dssp             CCEEEEECSCGGGGGHHHHHHHHTTTSSCEEEEE
T ss_pred             CEEEEEEECHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             7399999789999999999999997699379996


No 101
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae}
Probab=60.39  E-value=8.2  Score=17.62  Aligned_cols=55  Identities=18%  Similarity=0.214  Sum_probs=41.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      +||+|-=+|+|-++++..|++..+++|+-.     +              .+.+.|+++++.+++....+|..+
T Consensus        24 kkIlvlGaG~vg~~~a~~L~~~~~~~v~va-----~--------------r~~~~a~~~~~~~~~~~~~~D~~d   78 (467)
T 2axq_A           24 KNVLLLGSGFVAQPVIDTLAANDDINVTVA-----C--------------RTLANAQALAKPSGSKAISLDVTD   78 (467)
T ss_dssp             EEEEEECCSTTHHHHHHHHHTSTTEEEEEE-----E--------------SSHHHHHHHHGGGTCEEEECCTTC
T ss_pred             CCEEEECCCHHHHHHHHHHHHCCCCEEEEE-----E--------------CCHHHHHHHHHCCCCCEEEEECCC
T ss_conf             828999987899999999970899349999-----6--------------999999998601598469984799


No 102
>3lls_A 3-ketoacyl-(acyl-carrier-protein) reductase; niaid, emerald biostructures, UW, SBRI, oxidoreductase, structural genomics; 2.40A {Mycobacterium tuberculosis}
Probab=60.19  E-value=8.3  Score=17.60  Aligned_cols=20  Identities=25%  Similarity=0.228  Sum_probs=10.4

Q ss_pred             CEEEEEECCCHHHHHHHHHH
Q ss_conf             88999960985799999999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL   40 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL   40 (408)
                      -.|+++=+|-+-..+.+.|.
T Consensus        67 g~~~~~~~~~~~~~~~~~~~   86 (475)
T 3lls_A           67 GSLLIGGAGRVVEPLRAALE   86 (475)
T ss_dssp             SEEEEEESSSSHHHHHHHHT
T ss_pred             CCEEEECCCCHHHHHHHHHH
T ss_conf             87688037521789999975


No 103
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A
Probab=60.10  E-value=7  Score=18.13  Aligned_cols=24  Identities=21%  Similarity=0.285  Sum_probs=9.4

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCC
Q ss_conf             899996098579999999988698
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGY   45 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~   45 (408)
                      .|++-=.+|..|..+|.+|++.||
T Consensus        76 ~vv~~c~~G~rS~~aa~~L~~~G~   99 (134)
T 1vee_A           76 TLYILDKFDGNSELVAELVALNGF   99 (134)
T ss_dssp             EEEEECSSSTTHHHHHHHHHHHTC
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             799974885479999999998199


No 104
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, PSI; HET: MSE; 2.00A {Enterococcus faecalis V583}
Probab=59.63  E-value=8.4  Score=17.53  Aligned_cols=31  Identities=26%  Similarity=0.460  Sum_probs=24.5

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             33889999609857999999998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      ..|||+|-=.|.+-+.+|+ .|.++|++|+.+
T Consensus         2 ~~MkI~IiGaGaiG~~~a~-~La~~G~~V~lv   32 (316)
T 2ew2_A            2 NAMKIAIAGAGAMGSRLGI-MLHQGGNDVTLI   32 (316)
T ss_dssp             --CEEEEECCSHHHHHHHH-HHHHTTCEEEEE
T ss_pred             CCCEEEEECCCHHHHHHHH-HHHHCCCCEEEE
T ss_conf             9898999992899999999-999689978999


No 105
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes}
Probab=59.09  E-value=8.6  Score=17.47  Aligned_cols=30  Identities=17%  Similarity=0.371  Sum_probs=24.1

Q ss_pred             CEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             889999-6098579999999988698499999
Q gi|254780151|r   21 MRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||+|- =||.+-|.++..|++ +||+|+++.
T Consensus         1 MkIlV~GatG~iG~~l~~~L~~-~G~~V~~~~   31 (221)
T 3ew7_A            1 MKIGIIGATGRAGSRILEEAKN-RGHEVTAIV   31 (221)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHH-TTCEEEEEE
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             9499999881899999999997-869899998


No 106
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: NAD; 2.50A {Legionella pneumophila subsp}
Probab=58.76  E-value=5.8  Score=18.69  Aligned_cols=101  Identities=15%  Similarity=0.067  Sum_probs=57.1

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             38899996098579999999988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .+||++-=.|+|-++++-.|++...++..-+++-  +.+..               +.+++...|+++....+..+=...
T Consensus        13 ~~kILiIG~GsVG~~vl~lL~rh~d~~~~~itVi--d~~~~---------------~~~~~~~~g~~~~~~~ld~~N~~~   75 (480)
T 2ph5_A           13 KNRFVILGFGCVGQALMPLIFEKFDIKPSQVTII--AAEGT---------------KVDVAQQYGVSFKLQQITPQNYLE   75 (480)
T ss_dssp             CSCEEEECCSHHHHHHHHHHHHHBCCCGGGEEEE--ESSCC---------------SCCHHHHHTCEEEECCCCTTTHHH
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCCCCEEEEE--CCCHH---------------HHHHHHHCCCCEEEEECCHHHHHH
T ss_conf             7988998987758999999985426787649997--66555---------------788887528843676338777999


Q ss_pred             CCCCCHHHHHCCCCCCCEECCCC--EEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             24411267870886120000154--11058888874016876452253
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCVDCNR--TVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~~CN~--~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      ++.+.+.        ..|+.-|-  .+---.+++.+.+.|+.|+=|-=
T Consensus        76 ~L~~~l~--------~~D~VVNls~~~~s~~I~~aC~e~Gv~YlDts~  115 (480)
T 2ph5_A           76 VIGSTLE--------ENDFLIDVSIGISSLALIILCNQKGALYINAAT  115 (480)
T ss_dssp             HTGGGCC--------TTCEEEECCSSSCHHHHHHHHHHHTCEEEESSC
T ss_pred             HHHHHHC--------CCCEEEECCCCCCCHHHHHHHHHHCCCEEECCC
T ss_conf             9999834--------799899898411689999999984996686313


No 107
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}
Probab=58.72  E-value=8.7  Score=17.43  Aligned_cols=19  Identities=16%  Similarity=0.048  Sum_probs=8.9

Q ss_pred             HHHHHHHHHHCCCCEEECC
Q ss_conf             9999999998099589817
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d   91 (408)
                      .+-++++.++.+||.+.-+
T Consensus        26 ~~~i~~~~~~~~i~~~~~~   44 (373)
T 2qm3_A           26 KEIVERVKTKTKIPVYERS   44 (373)
T ss_dssp             HHHHHHHHTTCSSCCCHHH
T ss_pred             HHHHHHHHHHCCCCHHHHH
T ss_conf             9999999987398466768


No 108
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei}
Probab=58.46  E-value=8.8  Score=17.40  Aligned_cols=29  Identities=31%  Similarity=0.444  Sum_probs=23.7

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             889999609857999999998869849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |||+| +=||.=-.+||+.|+++|++|+=+
T Consensus         1 MkviV-IGaG~~GL~aA~~L~k~G~~V~vl   29 (425)
T 3ka7_A            1 MKTVV-IGAGLGGLLSAARLSKAGHEVEVF   29 (425)
T ss_dssp             CEEEE-ECCBHHHHHHHHHHHHTTCEEEEE
T ss_pred             CCEEE-ECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             94899-997889999999999789978999


No 109
>3epw_A IAG-nucleoside hydrolase; rossmann fold, active site loops, aromatic stacking; HET: JMQ; 1.30A {Trypanosoma vivax} PDB: 3epx_A* 1hoz_A 1hp0_A* 2ff1_A* 2ff2_A* 1kic_A* 1kie_A* 1r4f_A* 3b9g_A*
Probab=58.27  E-value=8.9  Score=17.38  Aligned_cols=61  Identities=18%  Similarity=0.318  Sum_probs=42.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHH--CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHH----HHHCCCCEEE
Q ss_conf             338899996098579999999988--6984999998704787665555778818999999999----9980995898
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKR--DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV----CDTINVSHYV   89 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~--~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~v----a~~LgI~~~~   89 (408)
                      ..+||++=...|+|-++|+.+|..  .-.||.|++.-.          |-|..++....|.++    +...+||.+.
T Consensus        12 ~~~kvIiDtD~G~DDa~Al~~ll~~~~~vellgIt~v~----------GN~~~~~~~~na~~~l~~~~~~~diPv~~   78 (338)
T 3epw_A           12 SAKNVVLDHDGNLDDFVAMVLLASNTEKVRLIGALCTD----------ADCFVENGFNVTGKIMCLMHNNMNLPLFP   78 (338)
T ss_dssp             -CEEEEEEECCSHHHHHHHHHHHHCTTTEEEEEEEECS----------SSSCHHHHHHHHHHHHHHHHHHHCCCCCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEECC----------CCCCHHHHHHHHHHHHHHHHCCCCCCEEE
T ss_conf             78759998999869999999997389998899999826----------98248999999999999972879998884


No 110
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, lyase; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A*
Probab=58.22  E-value=5.8  Score=18.69  Aligned_cols=31  Identities=26%  Similarity=0.408  Sum_probs=24.9

Q ss_pred             CEE-EEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             889-99960985799999999886984999998
Q gi|254780151|r   21 MRV-VVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        21 ~kV-~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      ++| +.|-+|-+-|-++-+||+ .||+|+|+--
T Consensus        29 K~~LVTGatGfIGs~L~~~Ll~-~gy~V~g~dr   60 (381)
T 1n7h_A           29 KIALITGITGQDGSYLTEFLLG-KGYEVHGLIR   60 (381)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHH-TTCEEEEEEC
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEEEC
T ss_conf             9899925662899999999997-8598999978


No 111
>2hun_A 336AA long hypothetical DTDP-glucose 4,6- dehydratase; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii OT3}
Probab=58.08  E-value=6.9  Score=18.16  Aligned_cols=34  Identities=21%  Similarity=0.437  Sum_probs=27.5

Q ss_pred             CCCEEEE-EECCCHHHHHHHHHHHH-CCCEEEEEEE
Q ss_conf             3388999-96098579999999988-6984999998
Q gi|254780151|r   19 KDMRVVV-AMSGGVDSSVVAALLKR-DGYDVIGVTL   52 (408)
Q Consensus        19 k~~kV~v-a~SGGVDSsvaa~lL~~-~G~~V~g~~m   52 (408)
                      ..|||+| |-||=+-|.++-.|+++ .|++|+|+--
T Consensus         2 ~~MkILITGatGfiG~~l~~~L~~~~~~~~V~~~d~   37 (336)
T 2hun_A            2 HSMKLLVTGGMGFIGSNFIRYILEKHPDWEVINIDK   37 (336)
T ss_dssp             -CCEEEEETTTSHHHHHHHHHHHHHCTTCEEEEEEC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCCEEEEEEC
T ss_conf             998899987887899999999996699978999967


No 112
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold; HET: SAM; 2.00A {Mycobacterium tuberculosis H37RV} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A*
Probab=57.88  E-value=3.2  Score=20.56  Aligned_cols=51  Identities=20%  Similarity=0.275  Sum_probs=35.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             338899996098579999999988698499999870478766555577881899999999999809958
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      ..+||+=-=+| .- .++.++.++.|.+|+|+++                +++.++.|++.++..|+..
T Consensus        90 ~g~rVLDIGCG-~G-~~a~~~a~~~g~~v~gi~i----------------s~~q~~~a~~~~~~~gl~~  140 (318)
T 2fk8_A           90 PGMTLLDIGCG-WG-TTMRRAVERFDVNVIGLTL----------------SKNQHARCEQVLASIDTNR  140 (318)
T ss_dssp             TTCEEEEESCT-TS-HHHHHHHHHHCCEEEEEES----------------CHHHHHHHHHHHHTSCCSS
T ss_pred             CCCEEEEECCC-CC-HHHHHHHHHCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCC
T ss_conf             99989897887-36-9999999836963899989----------------9999999999987638741


No 113
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis}
Probab=57.39  E-value=8.4  Score=17.54  Aligned_cols=33  Identities=18%  Similarity=0.338  Sum_probs=24.6

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHC------CCEEEEE
Q ss_conf             863388999960985799999999886------9849999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRD------GYDVIGV   50 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~------G~~V~g~   50 (408)
                      +++++||+ =+=||+=...||+.|.++      |++|+=+
T Consensus         2 ~~~~k~V~-IIGaGiaGL~aA~~L~~~~~~~~~G~~V~vl   40 (470)
T 3i6d_A            2 SDGKKHVV-IIGGGITGLAAAFYMEKEIKEKNLPLELTLV   40 (470)
T ss_dssp             ---CEEEE-EECCSHHHHHHHHHHHHHHTTTTCSEEEEEE
T ss_pred             CCCCCEEE-EECCCHHHHHHHHHHHHCCCCCCCCCCEEEE
T ss_conf             89997399-9898789999999998647444799848999


No 114
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate biosynthesis, PSI-2; 1.90A {Methylococcus capsulatus}
Probab=57.30  E-value=9.2  Score=17.27  Aligned_cols=30  Identities=30%  Similarity=0.335  Sum_probs=24.1

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             3889999609857999999998869849999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      .|||+|-=.|++-|.+|+ .|.++|++|+-+
T Consensus         2 ~MkI~IiGaGaiG~~~a~-~L~~aG~~Vtlv   31 (320)
T 3i83_A            2 SLNILVIGTGAIGSFYGA-LLAKTGHCVSVV   31 (320)
T ss_dssp             -CEEEEESCCHHHHHHHH-HHHHTTCEEEEE
T ss_pred             CCEEEEECCCHHHHHHHH-HHHHCCCCEEEE
T ss_conf             888999996899999999-998489917999


No 115
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}
Probab=56.52  E-value=7.3  Score=17.97  Aligned_cols=32  Identities=31%  Similarity=0.485  Sum_probs=24.9

Q ss_pred             CCCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             33889999-6098579999999988698499999
Q gi|254780151|r   19 KDMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +-|||+|. -+|++-+.++-.|++ +||+|+++.
T Consensus         3 ~m~KIlItGatG~iG~~l~~~Ll~-~g~~V~~l~   35 (227)
T 3dhn_A            3 KVKKIVLIGASGFVGSALLNEALN-RGFEVTAVV   35 (227)
T ss_dssp             CCCEEEEETCCHHHHHHHHHHHHT-TTCEEEEEC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             999999988998899999999997-849899998


No 116
>1yoe_A Hypothetical protein YBEK; pyrimidine nucleoside hydrolase, bacterial nucleosidase, ribose, enzyme/product complex; HET: RIB; 1.78A {Escherichia coli} PDB: 3g5i_A*
Probab=56.27  E-value=9.5  Score=17.15  Aligned_cols=56  Identities=16%  Similarity=0.264  Sum_probs=42.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHC-CCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC
Q ss_conf             3388999960985799999999886-98499999870478766555577881899999999999809
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRD-GYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN   84 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~-G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg   84 (408)
                      ...+|++=..+|+|-++|..+|... ..+|.|++.-.          |-|..++....|.++-+.+|
T Consensus        12 ~~~pvIiDtD~G~DDa~AL~~al~~p~v~l~gIt~~~----------Gn~~~~~~~~n~~~ll~~~g   68 (322)
T 1yoe_A           12 SALPILLDCDPGHDDAIAIVLALASPELDVKAITSSA----------GNQTPEKTLRNVLRMLTLLN   68 (322)
T ss_dssp             CCEEEEEEECCSHHHHHHHHHHHTCTTEEEEEEEECS----------SSSCHHHHHHHHHHHHHHTT
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEEEC----------CCCCHHHHHHHHHHHHHHHC
T ss_conf             8863999899965999999999778898799999945----------98689999999999999818


No 117
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, binary complex; HET: GDP; 2.40A {Mycobacterium smegmatis str} PDB: 2gej_A*
Probab=56.22  E-value=9.6  Score=17.14  Aligned_cols=46  Identities=28%  Similarity=0.393  Sum_probs=32.7

Q ss_pred             CCCCCCCCCCCCCCCCEEEEE------ECCCHHHHHH--HHHHHHCCCEEEEEE
Q ss_conf             554443467888633889999------6098579999--999988698499999
Q gi|254780151|r    6 ATRLNSLDLDKNPKDMRVVVA------MSGGVDSSVV--AALLKRDGYDVIGVT   51 (408)
Q Consensus         6 ~~~~~~~~~~~~~k~~kV~va------~SGGVDSsva--a~lL~~~G~~V~g~~   51 (408)
                      ...-.+++|..+.+.|||++-      .+||+-..+.  |.-|+++||+|+=++
T Consensus         6 ~~~~~~~~~~~~~~~MkI~iv~~~~~p~~GG~~~~i~~La~~L~~~GheV~v~~   59 (406)
T 2gek_A            6 HHHHHSSGLVPRGSHMRIGMVCPYSFDVPGGVQSHVLQLAEVLRDAGHEVSVLA   59 (406)
T ss_dssp             ---------------CEEEEECSSCTTSCCHHHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCCCCCCCCCCCCCCCEEEEECCCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             444557788789699889998998789998799999999999997799899994


No 118
>1fmt_A Methionyl-tRNA FMet formyltransferase; initiator tRNA, translation initiation; 2.00A {Escherichia coli} SCOP: b.46.1.1 c.65.1.1 PDB: 2fmt_A*
Probab=55.01  E-value=10  Score=17.01  Aligned_cols=64  Identities=19%  Similarity=0.249  Sum_probs=37.1

Q ss_pred             CCCEEEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             33889999609857999999-99886984999998704787665555778818999999999998099589817
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      ++|||+..  |--+-|+.++ .|.++|++|.+|.-+  .+..  ...+.-..   ...++..|++.|||++..+
T Consensus         2 ~~mkI~f~--Gs~~~a~~~L~~L~~~~~~i~~VvT~--pd~~--~grg~~~~---~~~v~~~A~~~~i~~~~~~   66 (314)
T 1fmt_A            2 ESLRIIFA--GTPDFAARHLDALLSSGHNVVGVFTQ--PDRP--AGRGKKLM---PSPVKVLAEEKGLPVFQPV   66 (314)
T ss_dssp             CCCEEEEE--ECSHHHHHHHHHHHHTTCEEEEEECC--CCBC--------CB---CCHHHHHHHHTTCCEECCS
T ss_pred             CCCEEEEE--CCCHHHHHHHHHHHHCCCCEEEEEEC--CCCC--CCCCCCCC---CCHHHHHHHHCCCCCCCCC
T ss_conf             96289998--89889999999999789977999909--9985--56888488---9979999998599840352


No 119
>3e1y_E Eukaryotic peptide chain release factor GTP- binding subunit ERF3A; translation termination, peptide release, PTC, acetylation, cytoplasm; HET: ATP; 3.80A {Homo sapiens}
Probab=54.84  E-value=10  Score=16.99  Aligned_cols=114  Identities=9%  Similarity=0.062  Sum_probs=52.7

Q ss_pred             CCEEEEECCCCCCCCCCCCCCEEEECCCCCCEEEEECCCCCCCCCEEECCCEECCCCCCCCCCCCCEEEEEEEECCCCCC
Q ss_conf             83153102334335657786137631755312565235554222112002230377655544568718999980178870
Q gi|254780151|r  258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPV  337 (408)
Q Consensus       258 G~~~yTIGQRkGL~i~~~eP~YVv~id~~~N~ViVg~~~~L~~~~i~l~d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pv  337 (408)
                      -+-.-.-||+-+|.+..     +-..|.....|+..+...+.........+.|+....   ....+..+.+++..  .-+
T Consensus        57 ~~~~a~aG~~v~l~L~~-----i~~~~i~rG~vl~~~~~~~~~~~~f~a~i~~l~~~~---~~~~g~~~~~~~~t--~~~  126 (204)
T 3e1y_E           57 ETDTVAPGENLKIRLKG-----IEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKS---IICPGYNAVLHIHT--CIE  126 (204)
T ss_dssp             CBSEECTTSEEEEEEEE-----SSSSCCCTTCEEBCSSSCCCCCSEEEEEEECCSCCS---CCCTTEEEEEESSS--CEE
T ss_pred             CCCCCCCCCEEEEEECC-----CEEECCCCEEEEEECCCCCCCEEEEEEEEEEECCCC---CCCCCCEEEEEECE--EEE
T ss_conf             00201688667788638-----400011110899825886643027789998625887---56699759999750--899


Q ss_pred             EEEEEE---------------------ECCE--EEEEECCCCCC------CCCCEEEEEECCCCCCCEEEEEEEECCC
Q ss_conf             089998---------------------2997--99997597200------0696389997388866588876897145
Q gi|254780151|r  338 PVFVQR---------------------NDDG--VYVDFEKSEVG------VASGQACVFYTSDSNEARVLGGGIISGS  386 (408)
Q Consensus       338 p~~i~~---------------------~~~~--~~V~f~eP~~a------iAPGQ~~VfY~~D~~~~~vLGGGiI~~t  386 (408)
                      +|++..                     .++.  +.+.+++|.--      ..-|.++ +=|+    ++-+|+|+|...
T Consensus       127 ~~~i~~~~~~~~~~~~~~~~~~~~~l~~~d~a~v~l~~~~pi~~e~~~~~~~~Grfi-Lrd~----~~Tva~G~V~~v  199 (204)
T 3e1y_E          127 EVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFT-LRDE----GKTIAIGKVLKL  199 (204)
T ss_dssp             EEEEEEECCCCCSSTTCCCSSCCSCCCTTCEEEEEEEESSCCCCCCTTSSGGGTEEE-EECS----SSCCEEEEEEEE
T ss_pred             EEEEEEEEEEEECCCCCEECCCCCCCCCCCEEEEEEEECCCEEEEECCCCCCCCEEE-EEEC----CEEEEEEEEEEC
T ss_conf             999978999996588958613876358998999999979808986555477887099-9989----987999999870


No 120
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-2; 2.00A {Corynebacterium glutamicum}
Probab=54.68  E-value=10  Score=16.97  Aligned_cols=35  Identities=23%  Similarity=0.307  Sum_probs=25.8

Q ss_pred             CCCCCEEEEEE-CCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             86338899996-0985799999999886984999998
Q gi|254780151|r   17 NPKDMRVVVAM-SGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        17 ~~k~~kV~va~-SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      +.+.|||+|.= ||=+-|.++..|+ ++||+|+++.-
T Consensus       144 ~~~~mkILITGatGfIG~~Lv~~L~-~~Gh~V~~l~R  179 (516)
T 3oh8_A          144 DGSPLTVAITGSRGLVGRALTAQLQ-TGGHEVIQLVR  179 (516)
T ss_dssp             CCCCCEEEEESTTSHHHHHHHHHHH-HTTCEEEEEES
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEEC
T ss_conf             9999989998987589999999999-78798999978


No 121
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; 15025322, structural genomics, JCSG, protein structure initiative, PSI; HET: NAI UNL; 2.05A {Clostridium acetobutylicum atcc 824} SCOP: c.2.1.2
Probab=54.61  E-value=10  Score=16.97  Aligned_cols=38  Identities=16%  Similarity=0.376  Sum_probs=26.6

Q ss_pred             CCCCCCCCEEEEEE-CCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             78886338899996-0985799999999886984999998
Q gi|254780151|r   14 LDKNPKDMRVVVAM-SGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        14 ~~~~~k~~kV~va~-SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      +..-..+|||+|.= +|-+-|.++-+ |.++||+|+++..
T Consensus         6 ~~~~~~~MKILItGatGfIG~~lv~~-L~~~g~~V~~~~r   44 (292)
T 1vl0_A            6 IHHHHHHMKILITGANGQLGREIQKQ-LKGKNVEVIPTDV   44 (292)
T ss_dssp             ------CEEEEEESTTSHHHHHHHHH-HTTSSEEEEEECT
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHH-HHHCCCEEEEEEC
T ss_conf             78789987589989998899999999-9868798999323


No 122
>3nbm_A PTS system, lactose-specific IIBC components; PTS_IIB_LACTOSE, phosphoenolpyruvate:carbohydrate system, P- phosphorylation; HET: MSE; 1.30A {Streptococcus pneumoniae}
Probab=54.58  E-value=10  Score=16.96  Aligned_cols=76  Identities=9%  Similarity=-0.007  Sum_probs=47.1

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHH----CCC--EEEEEEEECCCCCCCCCCCC---CCCC-HHHHHHHHHHHHHCCCC
Q ss_conf             86338899996098579999999988----698--49999987047876655557---7881-89999999999980995
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKR----DGY--DVIGVTLQLYNSRKASKRKG---SCCA-GQDVYDARRVCDTINVS   86 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~----~G~--~V~g~~m~~~~~~~~~~~~~---~c~~-~~d~~~a~~va~~LgI~   86 (408)
                      ..|++||++.=+||.-||+-+--+++    +|.  +|.++-..-..  +....-.   ..+. .--.+++++.|+..|||
T Consensus         3 ~~k~~kIlL~C~~GmSSsll~~km~~~a~~~~~~~~v~A~~~~~~~--~~~~~~DviLL~PQv~~~~~~i~~~~~~~~ip   80 (108)
T 3nbm_A            3 ASKELKVLVLCAGSGTSAQLANAINEGANLTEVRVIANSGAYGAHY--DIMGVYDLIILAPQVRSYYREMKVDAERLGIQ   80 (108)
T ss_dssp             --CCEEEEEEESSSSHHHHHHHHHHHHHHHHTCSEEEEEEETTSCT--TTGGGCSEEEECGGGGGGHHHHHHHHTTTTCE
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEHHHHH--HHHHCCCEEEECHHHHHHHHHHHHHHHHCCCC
T ss_conf             7763469999799975999999999999976997899995389999--88642899998667999999999998773992


Q ss_pred             EEECCHHH
Q ss_conf             89817078
Q gi|254780151|r   87 HYVFDYEE   94 (408)
Q Consensus        87 ~~~~d~~~   94 (408)
                      .-.+|...
T Consensus        81 v~~I~~~~   88 (108)
T 3nbm_A           81 IVATRGME   88 (108)
T ss_dssp             EEECCHHH
T ss_pred             EEEECHHH
T ss_conf             88728787


No 123
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A
Probab=54.01  E-value=10  Score=16.90  Aligned_cols=31  Identities=26%  Similarity=0.335  Sum_probs=25.4

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEE
Q ss_conf             6338899996098579999999988698499
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVI   48 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~   48 (408)
                      .++++|++-=.+|.-|..|+..|+++||+.+
T Consensus        39 d~~~~iv~yC~~G~rs~~aa~~L~~~G~~~v   69 (85)
T 2jtq_A           39 DKNDTVKVYCNAGRQSGQAKEILSEMGYTHV   69 (85)
T ss_dssp             CTTSEEEEEESSSHHHHHHHHHHHHTTCSSE
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCCEE
T ss_conf             7887799988998279999999998699979


No 124
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A
Probab=53.65  E-value=8.1  Score=17.67  Aligned_cols=29  Identities=24%  Similarity=0.397  Sum_probs=19.8

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCE
Q ss_conf             63388999960985799999999886984
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYD   46 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~   46 (408)
                      +++++|++-=.+|.-|..||.+|++.||+
T Consensus        50 ~~~~~Iv~~C~~g~rs~~aa~~L~~~G~~   78 (106)
T 3hix_A           50 EKSRDIYVYGAGDEQTSQAVNLLRSAGFE   78 (106)
T ss_dssp             CTTSCEEEECSSHHHHHHHHHHHHHTTCS
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCC
T ss_conf             99984999999982999999999982985


No 125
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 2.50A {Geobacter metallireducens gs-15}
Probab=53.44  E-value=11  Score=16.84  Aligned_cols=30  Identities=27%  Similarity=0.345  Sum_probs=23.8

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             3889999609857999999998869849999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      .|||+|-=.|.+-|.+|+. |.++|++|+-+
T Consensus         2 ~MkI~ViGaGaiG~~~a~~-L~~aG~~Vtlv   31 (312)
T 3hn2_A            2 SLRIAIVGAGALGLYYGAL-LQRSGEDVHFL   31 (312)
T ss_dssp             --CEEEECCSTTHHHHHHH-HHHTSCCEEEE
T ss_pred             CCEEEEECCCHHHHHHHHH-HHHCCCCEEEE
T ss_conf             8889999928999999999-98369956999


No 126
>2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.70A {Thermus thermophilus HB8} PDB: 2eg3_A
Probab=53.40  E-value=11  Score=16.84  Aligned_cols=12  Identities=8%  Similarity=0.232  Sum_probs=7.0

Q ss_pred             HHHHHHHHCCCC
Q ss_conf             999999980995
Q gi|254780151|r   75 DARRVCDTINVS   86 (408)
Q Consensus        75 ~a~~va~~LgI~   86 (408)
                      ...++...+||.
T Consensus        50 ~~~~~l~~~Gi~   61 (230)
T 2eg4_A           50 GLTELFQTLGLR   61 (230)
T ss_dssp             HHHHHHHHTTCC
T ss_pred             HHHHHHHHCCCC
T ss_conf             999999970998


No 127
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5
Probab=53.04  E-value=11  Score=16.80  Aligned_cols=67  Identities=18%  Similarity=0.204  Sum_probs=33.9

Q ss_pred             CCCCEEEEEECCCHHHHHHH----HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             63388999960985799999----99988698499999870478766555577881899999999999809958981707
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVA----ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa----~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      .++.|+.+|++|=- .|.+-    +.+++.|.+..-.  .+ +.             ++++++.+..+.++  +.-+++.
T Consensus         3 ~~~t~~~~~~~g~p-~s~sp~iHn~~f~~lgl~~~Y~--~~-~~-------------~~l~~~~~~l~~~~--~~G~nVT   63 (271)
T 1npy_A            3 NKDTQLCMSLSGRP-SNFGTTFHNYLYDKLGLNFIYK--AF-TT-------------QDIEHAIKGVRALG--IRGCAVS   63 (271)
T ss_dssp             CTTCEEEEEECSSC-CSHHHHHHHHHHHHHTCCEEEE--EE-CC-------------SCHHHHHHHHHHHT--CCEEEEC
T ss_pred             CCCCEEEEEEECCC-CCCCHHHHHHHHHHCCCCCEEE--EE-CC-------------CCHHHHHHHHHHCC--CCEEEEC
T ss_conf             89866899992176-6569999999999879991899--85-20-------------10999999986489--9989988


Q ss_pred             HHHHHHCCCC
Q ss_conf             8866322441
Q gi|254780151|r   94 ERFRNAVIVP  103 (408)
Q Consensus        94 ~~f~~~V~~~  103 (408)
                      --|++.++..
T Consensus        64 ~P~K~~~~~~   73 (271)
T 1npy_A           64 MPFKETCMPF   73 (271)
T ss_dssp             TTCTTTTGGG
T ss_pred             HHHHHHHHHH
T ss_conf             8579999998


No 128
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei}
Probab=53.01  E-value=11  Score=16.79  Aligned_cols=37  Identities=30%  Similarity=0.455  Sum_probs=25.3

Q ss_pred             CCCCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             788863388999-96098579999999988698499999
Q gi|254780151|r   14 LDKNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        14 ~~~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |+++-+++.++| |=|+|+-.++|-.|+ ++|++|+.+.
T Consensus        22 M~~~L~gKvalITGas~GIG~aiA~~la-~~Ga~Vv~~~   59 (270)
T 3ftp_A           22 MDKTLDKQVAIVTGASRGIGRAIALELA-RRGAMVIGTA   59 (270)
T ss_dssp             -CCTTTTCEEEETTCSSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             9998799989993868589999999999-8699999997


No 129
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2
Probab=52.27  E-value=6.4  Score=18.41  Aligned_cols=31  Identities=26%  Similarity=0.508  Sum_probs=24.0

Q ss_pred             EEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEE
Q ss_conf             8999-9609857999999998869849999987
Q gi|254780151|r   22 RVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQ   53 (408)
Q Consensus        22 kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~   53 (408)
                      +|+| |-+|=+-|-++-.||+ +||+|+|+.-.
T Consensus        26 ~~LITGatGfIGs~l~~~Ll~-~g~~V~~~~r~   57 (375)
T 1t2a_A           26 VALITGITGQDGSYLAEFLLE-KGYEVHGIVRR   57 (375)
T ss_dssp             EEEEETTTSHHHHHHHHHHHH-TTCEEEEEECC
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCEEEEEECC
T ss_conf             699960862899999999997-84989999798


No 130
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A*
Probab=52.18  E-value=11  Score=16.70  Aligned_cols=80  Identities=23%  Similarity=0.195  Sum_probs=47.6

Q ss_pred             CCCCCCCCCCEEEEEECC--CHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             467888633889999609--857999999998869849999987047876655557788189999999999980995898
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSG--GVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SG--GVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      |+....|..+||+|-=||  |.--+.|   .++.|++|+.+................+....|.+...++|+..++...+
T Consensus         3 ~~~~~~~~~~kvlIiG~Gqlgr~~a~A---ak~lG~~v~~~~~~~~~p~~~~ad~~~~~~~~D~e~l~~~a~~~~~d~v~   79 (391)
T 1kjq_A            3 LGTALRPAATRVMLLGSGELGKEVAIE---CQRLGVEVIAVDRYADAPAMHVAHRSHVINMLDGDALRRVVELEKPHYIV   79 (391)
T ss_dssp             BCCTTSTTCCEEEEESCSHHHHHHHHH---HHTTTCEEEEEESSTTCGGGGGSSEEEECCTTCHHHHHHHHHHHCCSEEE
T ss_pred             CCCCCCCCCCEEEEECCCHHHHHHHHH---HHHCCCEEEEEECCCCCCHHHHCCEEEEECCCCHHHHHHHHHHHCCCEEE
T ss_conf             688999999899998978999999999---99879989999799998367626636983688999999999984999999


Q ss_pred             CCHHH
Q ss_conf             17078
Q gi|254780151|r   90 FDYEE   94 (408)
Q Consensus        90 ~d~~~   94 (408)
                      ..++.
T Consensus        80 ~~~e~   84 (391)
T 1kjq_A           80 PEIEA   84 (391)
T ss_dssp             ECSSC
T ss_pred             ECCCC
T ss_conf             27774


No 131
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9
Probab=51.82  E-value=11  Score=16.67  Aligned_cols=57  Identities=18%  Similarity=0.227  Sum_probs=37.4

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             33889999609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ..|||+|.=-|-+-+.++ ..|.++|++|+.+-.                   |.+.++++++.+++....-|..+.
T Consensus         3 ~~m~ViI~G~G~~G~~la-~~L~~~g~~v~vId~-------------------d~~~~~~~~~~~~~~vi~gd~~~~   59 (140)
T 1lss_A            3 HGMYIIIAGIGRVGYTLA-KSLSEKGHDIVLIDI-------------------DKDICKKASAEIDALVINGDCTKI   59 (140)
T ss_dssp             --CEEEEECCSHHHHHHH-HHHHHTTCEEEEEES-------------------CHHHHHHHHHHCSSEEEESCTTSH
T ss_pred             CCCEEEEECCCHHHHHHH-HHHHHCCCCEEEEEE-------------------CHHHHHHHHHCCCCEEEECCCCHH
T ss_conf             899999999899999999-999977995899850-------------------156655445314745998876157


No 132
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus}
Probab=51.13  E-value=11  Score=16.59  Aligned_cols=29  Identities=31%  Similarity=0.597  Sum_probs=23.9

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             889999609857999999998869849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |||+ =.=||+--.+||+.|.++|++|+=+
T Consensus         1 MkVv-IIGaG~aGL~aA~~Lak~G~~V~vl   29 (421)
T 3nrn_A            1 MRAV-VVGAGLGGLLAGAFLARNGHEIIVL   29 (421)
T ss_dssp             CEEE-EESCSHHHHHHHHHHHHTTCEEEEE
T ss_pred             CEEE-EECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             9299-9997599999999999789979998


No 133
>2hpi_A DNA polymerase III alpha subunit; POL-beta-like nucleotidyltransferase fold; HET: DNA; 3.00A {Thermus aquaticus} PDB: 2hpm_A* 3e0d_A*
Probab=51.04  E-value=10  Score=16.93  Aligned_cols=22  Identities=36%  Similarity=0.638  Sum_probs=16.3

Q ss_pred             HHHHHHHCCCCCCEECCC--CCCC
Q ss_conf             888887401687645225--3110
Q gi|254780151|r  127 SDLLSVTRQLGADVLATG--HYIR  148 (408)
Q Consensus       127 ~~l~~~a~~~g~~~iATG--HYar  148 (408)
                      ..|++.|+++|...|||+  ||..
T Consensus       194 ~~li~lA~~~~iplVATndvhYl~  217 (1220)
T 2hpi_A          194 QVLKEFARKYGLGMVATNDGHYVR  217 (1220)
T ss_dssp             HHHHHHHHHTTCCEEECCCBSBSS
T ss_pred             HHHHHHHHHHCCCEEEECCCCCCC
T ss_conf             999999998499999979874077


No 134
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase, RV2981C, structural genomics, TB structural genomics consortium, TBSGC; 2.10A {Mycobacterium tuberculosis}
Probab=50.94  E-value=9.2  Score=17.27  Aligned_cols=38  Identities=32%  Similarity=0.464  Sum_probs=25.4

Q ss_pred             CCCCCCCCEEEEEECCCHH--------HHHHHH-HHHHCCCEEEEEEE
Q ss_conf             7888633889999609857--------999999-99886984999998
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVD--------SSVVAA-LLKRDGYDVIGVTL   52 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVD--------Ssvaa~-lL~~~G~~V~g~~m   52 (408)
                      -+..+|+|||+|.+ ||.=        |+.+++ -|.+.||+|+.+++
T Consensus         4 ~~~~~~K~kI~vl~-GG~S~E~eVSl~S~~~v~~~L~~~~y~v~~i~i   50 (373)
T 3lwb_A            4 NDRRDRRVRVAVVF-GGRSNEHAISCVSAGSILRNLDSRRFDVIAVGI   50 (373)
T ss_dssp             ---CTTCEEEEEEE-EC-----CHHHHHHHHHHHHSCTTTEEEEEEEE
T ss_pred             CCCCCCCCEEEEEE-CCCCCHHHHHHHHHHHHHHHHCCCCCEEEEEEE
T ss_conf             66678987799996-867740699999999999975550886999998


No 135
>1zun_B Sulfate adenylate transferase, subunit 1/adenylylsulfate kinase; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae PV} SCOP: b.43.3.1 b.44.1.1 c.37.1.8
Probab=50.35  E-value=12  Score=16.51  Aligned_cols=22  Identities=27%  Similarity=0.448  Sum_probs=16.4

Q ss_pred             EEEEECCCHH---HHHHHHHHHHCC
Q ss_conf             9999609857---999999998869
Q gi|254780151|r   23 VVVAMSGGVD---SSVVAALLKRDG   44 (408)
Q Consensus        23 V~va~SGGVD---Ssvaa~lL~~~G   44 (408)
                      |=++.-|=||   |++...||...|
T Consensus        25 i~i~t~GHVD~GKSTL~g~Ll~~~~   49 (434)
T 1zun_B           25 LRFLTCGNVDDGKSTLIGRLLHDSK   49 (434)
T ss_dssp             EEEEEECCTTSSHHHHHHHHHHHTT
T ss_pred             EEEEEEECCCCCHHHHHHHHHHHCC
T ss_conf             0699997248859999999998769


No 136
>3o1l_A Formyltetrahydrofolate deformylase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 2.20A {Pseudomonas syringae PV}
Probab=50.12  E-value=12  Score=16.48  Aligned_cols=62  Identities=6%  Similarity=-0.017  Sum_probs=34.8

Q ss_pred             CCCHHHHHHHHHHHHCCCEEEE-----------EEEECCCCCCCCCCCCCCCCHHHHH-HHHHHHHHCCCCEEECCHHHH
Q ss_conf             0985799999999886984999-----------9987047876655557788189999-999999980995898170788
Q gi|254780151|r   28 SGGVDSSVVAALLKRDGYDVIG-----------VTLQLYNSRKASKRKGSCCAGQDVY-DARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        28 SGGVDSsvaa~lL~~~G~~V~g-----------~~m~~~~~~~~~~~~~~c~~~~d~~-~a~~va~~LgI~~~~~d~~~~   95 (408)
                      .=|+=++|+-+|.+. |.+.+-           +|||.-...    .... +..++++ ....+++.++..+.+.+..+.
T Consensus        32 ~~GIVa~Vs~~L~~~-g~NI~e~~qf~D~~~~~FFmR~~f~~----~~~~-~~~~~l~~~f~~la~~~~m~~~i~~~~~~  105 (302)
T 3o1l_A           32 RVGIVAKVSNFLASH-NGWITEASHHSDNLSGWFFMRHEIRA----DTLP-FDLDGFREAFTPIAEEFSMDWRITDSAQK  105 (302)
T ss_dssp             CTTHHHHHHHHHHHT-TCCEEEEEEEEETTTTEEEEEEEEEG----GGSS-SCHHHHHHHHHHHHHHHTCEEEEEETTSC
T ss_pred             CCCHHHHHHHHHHHC-CCCEEECCCCCCCCCCCEEEEEEEEC----CCCC-CCHHHHHHHHHHHHHHCCCEEEECCCCCC
T ss_conf             987399999999978-99882733544899992899999970----8987-79999999876665430401443255668


No 137
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*
Probab=49.24  E-value=12  Score=16.39  Aligned_cols=58  Identities=10%  Similarity=0.122  Sum_probs=35.7

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             88999-9609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      +||+| |=||-+-+.++-.|| ++||+|+++. ++-.            ...+.   ..-....++.+...|+.+.
T Consensus        12 ~KIlVtGatG~iG~~l~~~Ll-~~g~~V~~l~-R~~~------------~~~~~---~~~l~~~~~~~~~~d~~~~   70 (318)
T 2r6j_A           12 SKILIFGGTGYIGNHMVKGSL-KLGHPTYVFT-RPNS------------SKTTL---LDEFQSLGAIIVKGELDEH   70 (318)
T ss_dssp             CCEEEETTTSTTHHHHHHHHH-HTTCCEEEEE-CTTC------------SCHHH---HHHHHHTTCEEEECCTTCH
T ss_pred             CEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE-CCCC------------CCHHH---HHHHHCCCCEEEEEECCCC
T ss_conf             839998999689999999999-7869799997-8974------------23667---7764118818999114430


No 138
>1qzu_A Hypothetical protein MDS018; alpha-beta sandwich, lyase; HET: FMN; 2.91A {Homo sapiens} SCOP: c.34.1.1
Probab=49.11  E-value=11  Score=16.78  Aligned_cols=33  Identities=30%  Similarity=0.464  Sum_probs=23.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHH----HHHCCCEEEEEE
Q ss_conf             338899996098579999999----988698499999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAAL----LKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~l----L~~~G~~V~g~~   51 (408)
                      ++.+|+++.||++-.-=+..|    +++.|++|..+.
T Consensus        18 ~k~~ILl~vtGsIAayk~~~lv~~L~~~~g~~V~vv~   54 (206)
T 1qzu_A           18 RKFHVLVGVTGSVAALKLPLLVSKLLDIPGLEVAVVT   54 (206)
T ss_dssp             SSEEEEEEECSSGGGGTHHHHHHHHC---CEEEEEEE
T ss_pred             CCCEEEEEEECHHHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             8866999970489999899999999865697899998


No 139
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1
Probab=48.53  E-value=12  Score=16.32  Aligned_cols=59  Identities=19%  Similarity=0.238  Sum_probs=36.3

Q ss_pred             CEEEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             889999609857999999-99886984999998704787665555778818999999999998099589817
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      |||++.-|  .+.++.++ .|.++||+|.+|+-+  . +.    ++...   -...+++.|++.|||++..+
T Consensus         1 Mki~~~g~--~~~~~~~l~~L~~~~~~i~~V~t~--~-d~----~~~~~---~~~~v~~~a~~~~i~~~~~~   60 (660)
T 1z7e_A            1 MKTVVFAY--HDMGCLGIEALLAAGYEISAIFTH--T-DN----PGEKA---FYGSVARLAAERGIPVYAPD   60 (660)
T ss_dssp             CEEEEEEC--HHHHHHHHHHHHHTTCEEEEEECC--C-C---------------CCHHHHHHHHTCCEECCS
T ss_pred             CEEEEEEC--CHHHHHHHHHHHHCCCCEEEEECC--C-CC----CCCCC---CCCHHHHHHHHCCCCEECCC
T ss_conf             95999907--689999999999789978999838--9-99----97767---88879999998799788469


No 140
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus}
Probab=48.19  E-value=13  Score=16.28  Aligned_cols=56  Identities=23%  Similarity=0.235  Sum_probs=32.4

Q ss_pred             CEEEEEECCCHHHHHHHHHH--HH--CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             88999960985799999999--88--6984999998704787665555778818999999999998099589817078
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL--KR--DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL--~~--~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      |||+|-.||+ -|.+.+.+-  +.  -++++.+|.-   +..+        +  .    ....+...+++....+...
T Consensus         2 mkiavl~SG~-Gsnl~ali~~~~~~~~~~~I~~Vit---n~~~--------~--~----~l~~~~~~~~~~~~~~~~~   61 (216)
T 2ywr_A            2 LKIGVLVSGR-GSNLQAIIDAIESGKVNASIELVIS---DNPK--------A--Y----AIERCKKHNVECKVIQRKE   61 (216)
T ss_dssp             EEEEEEECSC-CHHHHHHHHHHHTTSSCEEEEEEEE---SCTT--------C--H----HHHHHHHHTCCEEECCGGG
T ss_pred             CEEEEEEECC-CHHHHHHHHHHHCCCCCCEEEEEEE---ECCC--------H--H----HHHHHHCCCCCEEEEECCC
T ss_conf             6899999179-5679999999873999988999998---0885--------0--7----7766451486303542145


No 141
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1
Probab=47.89  E-value=11  Score=16.76  Aligned_cols=29  Identities=28%  Similarity=0.589  Sum_probs=21.6

Q ss_pred             CEEEEEECCCHHH--HHHHHHHHHCCCEEEE
Q ss_conf             8899996098579--9999999886984999
Q gi|254780151|r   21 MRVVVAMSGGVDS--SVVAALLKRDGYDVIG   49 (408)
Q Consensus        21 ~kV~va~SGGVDS--svaa~lL~~~G~~V~g   49 (408)
                      |.-+||+.||.-|  |.++-+|++.|+.|+-
T Consensus         1 M~~iIgitG~igSGKStv~~~l~~~G~~vid   31 (206)
T 1jjv_A            1 MTYIVGLTGGIGSGKTTIANLFTDLGVPLVD   31 (206)
T ss_dssp             CCEEEEEECSTTSCHHHHHHHHHTTTCCEEE
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHCCCEEEE
T ss_conf             9889998899876699999999988996997


No 142
>3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens}
Probab=47.82  E-value=5.7  Score=18.74  Aligned_cols=22  Identities=14%  Similarity=0.188  Sum_probs=10.7

Q ss_pred             CCCEEECCHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             99589817078866322441126787088612
Q gi|254780151|r   84 NVSHYVFDYEERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        84 gI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                      |-++.++|.+..          ++|..|.-|+
T Consensus        15 ~~~~~iiDVR~~----------~ey~~ghipg   36 (127)
T 3i2v_A           15 GAFHLLLDVRPQ----------VEVDICRLPH   36 (127)
T ss_dssp             TCCCEEEECSCH----------HHHHHCCCTT
T ss_pred             CCCEEEEECCCH----------HHHHCCCCCC
T ss_conf             988399989988----------9966277888


No 143
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe}
Probab=47.22  E-value=13  Score=16.18  Aligned_cols=71  Identities=14%  Similarity=0.230  Sum_probs=34.0

Q ss_pred             CCEECCCCCCCCCCCCCEEEEEEEECCCCCCEEEEEE-EC---------CE--EEEEECCCCCCCCC-------CEEEEE
Q ss_conf             2230377655544568718999980178870089998-29---------97--99997597200069-------638999
Q gi|254780151|r  307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-ND---------DG--VYVDFEKSEVGVAS-------GQACVF  367 (408)
Q Consensus       307 d~nWi~~~~~~~~~~~~~~~~vkiR~~~~pvp~~i~~-~~---------~~--~~V~f~eP~~aiAP-------GQ~~Vf  367 (408)
                      .+.|+...   .....+..+.+.+.....++..++.. ..         +.  +.+.|.++...+..       |++...
T Consensus       501 ~i~~l~~~---~~i~~G~~~~lhigt~~~~~~ik~~~~~~k~~~~l~~~~~a~v~i~~~~~~~pl~~~~~~~~lGRfiLR  577 (592)
T 3mca_A          501 EIQTFDIH---GPILSGSTLVLHLGRTVTSVSLKIVTVNNKRSRHIASRKRALVRISFLDGLFPLCLAEECPALGRFILR  577 (592)
T ss_dssp             EEEECSCS---SCEETTEEEEEECSSCEEEEEEEEEESSSSCCSEECSSCEEEEEEEESSSCEEECCTTTCHHHHEEEEE
T ss_pred             EEEEECCC---CCCCCCCEEEEEEECCEEEEEEEEEEECCCCCCCCCCCCEEEEEEEECCCCCEEEECCCCCCCCEEEEE
T ss_conf             99996899---873799878999802189999999850577766367998489999965787206772358888749999


Q ss_pred             ECCCCCCCEEEEEEEECC
Q ss_conf             738886658887689714
Q gi|254780151|r  368 YTSDSNEARVLGGGIISG  385 (408)
Q Consensus       368 Y~~D~~~~~vLGGGiI~~  385 (408)
                      ..+     +-+|.|+|+.
T Consensus       578 ~~g-----~Tia~G~V~~  590 (592)
T 3mca_A          578 RSG-----DTVAAGIVKE  590 (592)
T ss_dssp             SSS-----SEEEEEEEEE
T ss_pred             ECC-----EEEEEEEEEE
T ss_conf             899-----0799999988


No 144
>3l3b_A ES1 family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography, isoprenoid biosynthesis; 1.90A {Ehrlichia chaffeensis}
Probab=46.73  E-value=13  Score=16.13  Aligned_cols=33  Identities=18%  Similarity=0.298  Sum_probs=27.8

Q ss_pred             CCCEEEEEECC-C-------HHHHHHHHHHHHCCCEEEEEE
Q ss_conf             33889999609-8-------579999999988698499999
Q gi|254780151|r   19 KDMRVVVAMSG-G-------VDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va~SG-G-------VDSsvaa~lL~~~G~~V~g~~   51 (408)
                      .-|+++|-||| |       ..+.++...|.++|++|+.+-
T Consensus        22 ~~m~~aviLsGcG~~DGsEi~Eav~~l~~L~raG~~v~~~a   62 (242)
T 3l3b_A           22 MALNSAVILAGCGHMDGSEIREAVLVMLELDRHNVNFKCFA   62 (242)
T ss_dssp             --CEEEEECCCSSTTTSCCHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             10446999808978674229799999999998899799994


No 145
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A
Probab=46.20  E-value=13  Score=16.27  Aligned_cols=84  Identities=12%  Similarity=0.077  Sum_probs=51.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCC--CCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             33889999609857999999998869849999987047876655557--7881899999999999809958981707886
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG--SCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~--~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      ..|||+|-=|||-.-++|-.|.+..  .|.-+|.--.+.+.......  ......|.+.....|+..+|.+-++--+.-.
T Consensus         2 ~~MkvLviGsGgREhAia~~l~~s~--~~~~v~~~pgN~g~~~~~~~~~~~~~~~d~~~i~~~~~~~~idlvivgpe~pL   79 (431)
T 3mjf_A            2 NAMNILIIGNGGREHALGWKAAQSP--LADKIYVAPGNAGTALEPTLENVDIAATDIAGLLAFAQSHDIGLTIVGPEAPL   79 (431)
T ss_dssp             -CEEEEEEECSHHHHHHHHHHTTCT--TEEEEEEEECCHHHHHCTTCEECCCCTTCHHHHHHHHHHTTEEEEEECSHHHH
T ss_pred             CCCEEEEECCCHHHHHHHHHHHHCC--CCCEEEEECCCHHHHHHCCCEEECCCCCCHHHHHHHHHHCCCCEEEECCCHHH
T ss_conf             9778999897899999999997598--98979996897266530665452468669999999999829998998974898


Q ss_pred             HHHCCCCC
Q ss_conf             63224411
Q gi|254780151|r   97 RNAVIVPF  104 (408)
Q Consensus        97 ~~~V~~~~  104 (408)
                      ...+.|.|
T Consensus        80 ~~Gl~D~l   87 (431)
T 3mjf_A           80 VIGVVDAF   87 (431)
T ss_dssp             HTTHHHHH
T ss_pred             HHHHHHHH
T ss_conf             87799999


No 146
>3fdf_A FR253; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, unknown function; 3.20A {Drosophila melanogaster} PDB: 3fmv_A
Probab=45.51  E-value=14  Score=16.00  Aligned_cols=34  Identities=26%  Similarity=0.509  Sum_probs=26.5

Q ss_pred             CCCCCEEEEEECCCHHHHHHHH-HHHHCCCEEEEE
Q ss_conf             8633889999609857999999-998869849999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAA-LLKRDGYDVIGV   50 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~-lL~~~G~~V~g~   50 (408)
                      ++.++|++|-=|.-.--|+.|. +|+++||+|..+
T Consensus         3 ~~~~L~~avVCaSN~NRSMEAH~~L~~~Gf~V~Sf   37 (195)
T 3fdf_A            3 DPSKLAVAVVCSSNMNRSMEAHNFLAKKGFNVRSY   37 (195)
T ss_dssp             --CCCEEEEECSSSSSHHHHHHHHHHHTTCEEEEE
T ss_pred             CCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEE
T ss_conf             88776699983788752889999999879954740


No 147
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B*
Probab=44.23  E-value=11  Score=16.73  Aligned_cols=32  Identities=25%  Similarity=0.320  Sum_probs=27.5

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             38899996098579999999988698499999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      .|||.|-=+|..-+++|+.|..+.|++|.-+.
T Consensus         2 ~MkI~ViGaG~~G~~~A~~la~~~G~~V~l~~   33 (404)
T 3c7a_A            2 TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLT   33 (404)
T ss_dssp             CEEEEEECCSHHHHHHHHHHTTSTTEEEEEEC
T ss_pred             CCEEEEECCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             97799987198999999999966998589996


No 148
>2p0y_A Hypothetical protein LP_0780; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 3.00A {Lactobacillus plantarum}
Probab=43.52  E-value=15  Score=15.79  Aligned_cols=35  Identities=23%  Similarity=0.406  Sum_probs=27.2

Q ss_pred             EEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCC
Q ss_conf             899996098579999999988698499999870478
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS   57 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~   57 (408)
                      +=+|.+|||+-++..+.-|++...+++.+. -.+|+
T Consensus        11 p~Iv~l~GGtG~~~ll~gL~~~~~~lt~IV-n~~Dd   45 (341)
T 2p0y_A           11 PKIVVIGGGTGLPVVLNGLRKQAVDITAVV-TVADD   45 (341)
T ss_dssp             CEEEEECCGGGHHHHHHHHHHSSSEEEEEC-C----
T ss_pred             CEEEEECCCCCHHHHHHHHHHCCCCEEEEE-ECCCC
T ss_conf             749998896138999999864899859999-88638


No 149
>2bw0_A 10-FTHFDH, 10-formyltetrahydrofolate dehydrogenase; nucleotide biosynthesis, oxidoreductase; 1.7A {Homo sapiens} SCOP: b.46.1.1 c.65.1.1 PDB: 2cfi_A* 1s3i_A
Probab=43.16  E-value=15  Score=15.76  Aligned_cols=61  Identities=16%  Similarity=0.184  Sum_probs=36.2

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             88633889999609857999999-99886984999998704787665555778818999999999998099589817
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      ...+.|||+..=|+  +-++.++ -|.+.|++|.+|+-+   .+.    ++.-      ..+...|+..|||++..+
T Consensus        18 ~~~~~mkIvf~G~~--~f~~~~l~~L~~~~~~i~~V~T~---pdk----~~~~------~~v~~~a~~~~ipv~~~~   79 (329)
T 2bw0_A           18 LYFQSMKIAVIGQS--LFGQEVYCHLRKEGHEVVGVFTV---PDK----DGKA------DPLGLEAEKDGVPVFKYS   79 (329)
T ss_dssp             ---CCCEEEEECCH--HHHHHHHHHHHHTTCEEEEEEEC---CCC----SSCC------CHHHHHHHHHTCCEEECS
T ss_pred             HHHHCCEEEEECCC--HHHHHHHHHHHHCCCCEEEEEEC---CCC----CCCC------CHHHHHHHHHCCCEECCC
T ss_conf             43223089999697--99999999999888978999908---998----8898------969999998199886443


No 150
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str}
Probab=43.00  E-value=15  Score=15.74  Aligned_cols=91  Identities=15%  Similarity=0.256  Sum_probs=52.5

Q ss_pred             HHHHHHHH--CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH----HHHHHHCCCCCHHHH
Q ss_conf             99999988--698499999870478766555577881899999999999809958981707----886632244112678
Q gi|254780151|r   35 VVAALLKR--DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE----ERFRNAVIVPFASSY  108 (408)
Q Consensus        35 vaa~lL~~--~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~----~~f~~~V~~~~~~~y  108 (408)
                      +|.+.+++  +|-.|+=|-|-+.                 ..+++.+.+++++.+..+|..    +-...+||+|-+.-|
T Consensus        25 la~~~~~q~~~Ga~IIEVnvG~~-----------------~~va~~l~k~~~~~v~~~Di~P~~ids~~dDv~ep~L~iY   87 (153)
T 2k4m_A           25 LAVYIIRCSGPGTRVVEVGAGRF-----------------LYVSDYIRKHSKVDLVLTDIKPSHGGIVRDDITSPRMEIY   87 (153)
T ss_dssp             HHHHHHHHSCSSSEEEEETCTTC-----------------CHHHHHHHHHSCCEEEEECSSCSSTTEECCCSSSCCHHHH
T ss_pred             HHHHHHHHCCCCCEEEEECCCCC-----------------CCHHHHHHHHHCCEEEEECCCCCCCCCCCCHHCCCHHHHH
T ss_conf             99999982689986899748986-----------------2069999997096699950785556776401017134763


Q ss_pred             HCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             708861200001541105888887401687645225
Q gi|254780151|r  109 AAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       109 ~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                      .. .---=-+.+.+.. |..++..|++.|++.|+.-
T Consensus        88 ~G-~~lInSI~~~~E~-~~~il~LakkyGA~vIil~  121 (153)
T 2k4m_A           88 RG-AALIYSIRPPAEI-HSSLMRVADAVGARLIIKP  121 (153)
T ss_dssp             TT-EEEEEEESCCTTT-HHHHHHHHHHHTCEEEEEC
T ss_pred             CC-CCEEEECCCCHHH-HHHHHHHHHHHCCCEEEEE
T ss_conf             69-7846633898788-8999999998499399995


No 151
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 2.30A {Agrobacterium tumefaciens str}
Probab=42.63  E-value=15  Score=15.70  Aligned_cols=39  Identities=13%  Similarity=0.224  Sum_probs=26.7

Q ss_pred             CCCCCCCCCCE-EEEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             46788863388-999960985799999999886984999998
Q gi|254780151|r   12 LDLDKNPKDMR-VVVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        12 ~~~~~~~k~~k-V~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      |.|++. +++. ++.|=|+|+-.++|..|+ ++|++|+...-
T Consensus         1 M~M~r~-~gK~alITGas~GIG~aiA~~la-~~Ga~Vvi~~~   40 (259)
T 3edm_A            1 MSLQRF-TNRTIVVAGAGRDIGRACAIRFA-QEGANVVLTYN   40 (259)
T ss_dssp             ---CTT-TTCEEEEETTTSHHHHHHHHHHH-HTTCEEEEEEC
T ss_pred             CCCCCC-CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEEC
T ss_conf             998775-99989993798689999999999-87999999848


No 152
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron}
Probab=42.62  E-value=15  Score=15.70  Aligned_cols=27  Identities=30%  Similarity=0.585  Sum_probs=21.5

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             9996098579999999988698499999
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +-|=|+|+-.++|-.|+ ++|++|+.+.
T Consensus        12 ITGas~GIG~aia~~la-~~G~~Vi~~~   38 (250)
T 3nyw_A           12 ITGASQGIGAVIAAGLA-TDGYRVVLIA   38 (250)
T ss_dssp             EESTTSHHHHHHHHHHH-HHTCEEEEEE
T ss_pred             EECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             95697399999999999-8799899998


No 153
>2x7v_A Probable endonuclease 4; DNA repair protein, metal-binding, hydrolase, DNA damage, DN; 2.30A {Thermotoga maritima MSB8} PDB: 2x7w_A*
Probab=42.54  E-value=11  Score=16.73  Aligned_cols=103  Identities=10%  Similarity=0.024  Sum_probs=56.6

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCC
Q ss_conf             99609857999999998869849999987047876655557788189999999999980995898170788663224411
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPF  104 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~  104 (408)
                      +-+|+|++-+  +.-+++-|++.+=+|+.+   ....  ...-.++++.+..++.|++.|++...+-...-|.       
T Consensus         8 ~~~~~~l~~~--~~~~~e~G~~~~qif~~~---p~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~y~-------   73 (287)
T 2x7v_A            8 MPISKGFDRV--PQDTVNIGGNSFQIFPHN---ARSW--SAKLPSDEAATKFKREMKKHGIDWENAFCHSGYL-------   73 (287)
T ss_dssp             CCCTTCGGGH--HHHHHHTTCSEEEECSCC---CSSS--CCCCCCHHHHHHHHHHHHHHTCCGGGEEEECCTT-------
T ss_pred             ECCCCCHHHH--HHHHHHCCCCEEEEECCC---CCCC--CCCCCCHHHHHHHHHHHHHCCCCCEEEEECCCCH-------
T ss_conf             3233129999--999997499999996799---8788--8899999999999999998599842787426314-------


Q ss_pred             HHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             26787088612000015411058888874016876452253
Q gi|254780151|r  105 ASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       105 ~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                          ..=..|+|-++=-..-.+...++.|.++|++.+.+-.
T Consensus        74 ----~nl~~~d~~~r~~~i~~l~~~i~~a~~LGa~~vv~h~  110 (287)
T 2x7v_A           74 ----INLASPKDDIWQKSVELLKKEVEICRKLGIRYLNIHP  110 (287)
T ss_dssp             ----CCTTCSSHHHHHHHHHHHHHHHHHHHHHTCCEEEECC
T ss_pred             ----HHHCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             ----6305999999999999999999999980998053068


No 154
>3loq_A Universal stress protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: AMP; 2.32A {Archaeoglobus fulgidus}
Probab=42.00  E-value=16  Score=15.63  Aligned_cols=34  Identities=6%  Similarity=-0.078  Sum_probs=24.7

Q ss_pred             CCEEEEEECCCHHHHH----HHHHHHHCCCEEEEEEEE
Q ss_conf             3889999609857999----999998869849999987
Q gi|254780151|r   20 DMRVVVAMSGGVDSSV----VAALLKRDGYDVIGVTLQ   53 (408)
Q Consensus        20 ~~kV~va~SGGVDSsv----aa~lL~~~G~~V~g~~m~   53 (408)
                      .+||+|+..+.--|--    |+.|.+..+.+++.+|+.
T Consensus        22 ~~~ILvp~D~S~~s~~al~~A~~la~~~~~~i~llhvi   59 (294)
T 3loq_A           22 SNAMLLPTDLSENSFKVLEYLGDFKKVGVEEIGVLFVI   59 (294)
T ss_dssp             TCEEEEECCSCTGGGGGGGGHHHHHHTTCCEEEEECCE
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEEEEE
T ss_conf             99799996899899999999999998769989999998


No 155
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A*
Probab=41.27  E-value=16  Score=15.56  Aligned_cols=29  Identities=28%  Similarity=0.410  Sum_probs=23.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             889999609857999999998869849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |||+|-=.|++-+.++++ |.++|++|+-+
T Consensus         1 MkI~IiGaGaiG~~~a~~-L~~~G~~V~l~   29 (291)
T 1ks9_A            1 MKITVLGCGALGQLWLTA-LCKQGHEVQGW   29 (291)
T ss_dssp             CEEEEECCSHHHHHHHHH-HHHTTCEEEEE
T ss_pred             CEEEEECCCHHHHHHHHH-HHHCCCCEEEE
T ss_conf             989999957999999999-99789937999


No 156
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}
Probab=40.90  E-value=16  Score=15.52  Aligned_cols=53  Identities=15%  Similarity=0.186  Sum_probs=32.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             88999960985799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      +||+|.=+|=+-|.++..|| ++||+|+++. +.-               +..   . --+..++.....|..+
T Consensus         6 ~~vlItGaGfIGs~lv~~Ll-~~G~~V~~l~-R~~---------------~~~---~-~l~~~~~~~~~~d~~~   58 (286)
T 3ius_A            6 GTLLSFGHGYTARVLSRALA-PQGWRIIGTS-RNP---------------DQM---E-AIRASGAEPLLWPGEE   58 (286)
T ss_dssp             CEEEEETCCHHHHHHHHHHG-GGTCEEEEEE-SCG---------------GGH---H-HHHHTTEEEEESSSSC
T ss_pred             CEEEEECCCHHHHHHHHHHH-HCCCEEEEEE-CCH---------------HHH---H-HHHHCCCEEEECCCCC
T ss_conf             83899896199999999999-7899899994-883---------------655---7-8875696799646200


No 157
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A*
Probab=40.84  E-value=10  Score=16.90  Aligned_cols=16  Identities=6%  Similarity=0.023  Sum_probs=6.0

Q ss_pred             CEEECCCCCCHHHHHH
Q ss_conf             3011127751034553
Q gi|254780151|r  219 DICFVQQGKYFDVVKR  234 (408)
Q Consensus       219 gICFi~~~~~~~Fl~~  234 (408)
                      -+|+++......++++
T Consensus       161 ~~~al~~~~r~~y~~~  176 (252)
T 2gb4_A          161 ALVAINPGDHDRYADI  176 (252)
T ss_dssp             STTTSCGGGHHHHHHH
T ss_pred             EEEECCHHHHHHHHHH
T ss_conf             7763585777899999


No 158
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative; 2.19A {Bacteroides fragilis nctc 9343}
Probab=40.54  E-value=16  Score=15.48  Aligned_cols=56  Identities=16%  Similarity=0.358  Sum_probs=41.0

Q ss_pred             CCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             678886338899996098579999999988698499999870478766555577881899999999999809958
Q gi|254780151|r   13 DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        13 ~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      .|.++.+++||.+-=.|=.-++++..|++ +||+|++++-    .+              .+.++++++.+|+..
T Consensus         3 ~m~~~~~~~~I~iIG~G~mG~~la~~L~~-~g~~v~~v~~----r~--------------~~~~~~l~~~~~~~~   58 (266)
T 3d1l_A            3 AMKRSIEDTPIVLIGAGNLATNLAKALYR-KGFRIVQVYS----RT--------------EESARELAQKVEAEY   58 (266)
T ss_dssp             ----CGGGCCEEEECCSHHHHHHHHHHHH-HTCCEEEEEC----SS--------------HHHHHHHHHHTTCEE
T ss_pred             HHHHHCCCCEEEEECCCHHHHHHHHHHHH-CCCCEEEEEC----CC--------------HHHHHHHHHHCCCEE
T ss_conf             43430799919998330999999999998-8996799978----99--------------999999998769838


No 159
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A*
Probab=40.44  E-value=16  Score=15.47  Aligned_cols=32  Identities=22%  Similarity=0.517  Sum_probs=23.9

Q ss_pred             CCCCCEEEEEECCCHHHHHHHHHHHHCCC-EEEE
Q ss_conf             86338899996098579999999988698-4999
Q gi|254780151|r   17 NPKDMRVVVAMSGGVDSSVVAALLKRDGY-DVIG   49 (408)
Q Consensus        17 ~~k~~kV~va~SGGVDSsvaa~lL~~~G~-~V~g   49 (408)
                      +|.++||+| +=||+==..||+.|+++|+ +|+=
T Consensus         5 ~~~~k~V~I-IGaG~aGL~aA~~L~~~G~~~V~V   37 (516)
T 1rsg_A            5 SPAKKKVII-IGAGIAGLKAASTLHQNGIQDCLV   37 (516)
T ss_dssp             -CEEEEEEE-ECCBHHHHHHHHHHHHTTCCSEEE
T ss_pred             CCCCCCEEE-ECCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             999798899-897889999999998679997899


No 160
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodanese, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A*
Probab=40.37  E-value=16  Score=15.46  Aligned_cols=25  Identities=12%  Similarity=0.295  Sum_probs=16.7

Q ss_pred             CCCCEEEEEECCCCCCCEEEEEEEECC
Q ss_conf             069638999738886658887689714
Q gi|254780151|r  359 VASGQACVFYTSDSNEARVLGGGIISG  385 (408)
Q Consensus       359 iAPGQ~~VfY~~D~~~~~vLGGGiI~~  385 (408)
                      -++|-.-++++.+.  .++||.=+|-.
T Consensus       408 ~~~~~~Kli~d~~t--~~iLGaq~vG~  432 (588)
T 3ics_A          408 ATPVLIKLIFNKDS--GKIYGAQTLGR  432 (588)
T ss_dssp             CCEEEEEEEECTTT--CBEEEEEEEES
T ss_pred             CCCEEEEEEEECCC--CEEEEEEEECC
T ss_conf             99789999996899--96999999858


No 161
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B}
Probab=40.33  E-value=16  Score=15.46  Aligned_cols=29  Identities=31%  Similarity=0.460  Sum_probs=22.9

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             88999-9609857999999998869849999
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      .+|+| |=||=+-|.++..||+ +||+|+|+
T Consensus         6 ~tVLITG~tGfIG~~lv~~Ll~-~g~~V~~~   35 (341)
T 3enk_A            6 GTILVTGGAGYIGSHTAVELLA-HGYDVVIA   35 (341)
T ss_dssp             CEEEEETTTSHHHHHHHHHHHH-TTCEEEEE
T ss_pred             CCEEEECCCCHHHHHHHHHHHH-CCCEEEEE
T ss_conf             8199977874899999999997-83989999


No 162
>2o2z_A Hypothetical protein; NP_244435.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: NAD; 2.60A {Bacillus halodurans} PDB: 2hzb_A
Probab=40.13  E-value=17  Score=15.44  Aligned_cols=37  Identities=19%  Similarity=0.252  Sum_probs=28.4

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCC
Q ss_conf             88999960985799999999886984999998704787
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR   58 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~   58 (408)
                      +|=+|.+|||+-++..+.-|++...+++.+. -.+|+.
T Consensus         4 ~~~Iv~l~GGtG~~~ll~gL~~~~~~lt~IV-n~~Ddg   40 (323)
T 2o2z_A            4 KKNVIVFGGGTGLSVLLRGLKTFPVSITAIV-TVADDG   40 (323)
T ss_dssp             CEEEEEEECSHHHHHHHHHHTTSSEEEEEEE-CCCCCS
T ss_pred             CCCEEEECCCHHHHHHHHHHHHCCCCEEEEE-ECCCCC
T ss_conf             7868998783018999999975899859999-887387


No 163
>2ppv_A Uncharacterized protein; putative phosphotransferase, structural genomics, joint CENT structural genomics, JCSG; 2.00A {Staphylococcus epidermidis atcc 12228}
Probab=40.11  E-value=17  Score=15.44  Aligned_cols=37  Identities=30%  Similarity=0.425  Sum_probs=27.2

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCC
Q ss_conf             338899996098579999999988698499999870478
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS   57 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~   57 (408)
                      ++|| +|.+|||+-++-.+.-|++...+++.+. -.+|+
T Consensus         3 ~~~k-Iv~lsGGtG~~~ll~gL~~~~~~lt~IV-n~~DD   39 (332)
T 2ppv_A            3 KQMN-VVLIGGGTGLSVLARGLREFPIDITAIV-TVADN   39 (332)
T ss_dssp             CCEE-EEEEECHHHHHHHHHHHTTSSEEEEEEE-CCCCC
T ss_pred             CCCC-EEEECCHHHHHHHHHHHHHCCCCEEEEE-ECCCC
T ss_conf             7673-8998680228999999975899839999-89618


No 164
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthase, two rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} PDB: 2bis_A*
Probab=39.70  E-value=17  Score=15.39  Aligned_cols=33  Identities=24%  Similarity=0.416  Sum_probs=23.0

Q ss_pred             CCCEEEEEE-------CCCHHHHHH--HHHHHHCCCEEEEEE
Q ss_conf             338899996-------098579999--999988698499999
Q gi|254780151|r   19 KDMRVVVAM-------SGGVDSSVV--AALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~va~-------SGGVDSsva--a~lL~~~G~~V~g~~   51 (408)
                      .+|||++-=       |||+--.+.  |.-|+++||+|+=++
T Consensus         1 ~~MkIl~~~~~~~P~~~GG~~~~~~~La~~L~~~Gh~V~vvt   42 (439)
T 3fro_A            1 RHMKVLLLGFEFLPVKVGGLAEALTAISEALASLGHEVLVFT   42 (439)
T ss_dssp             CCCEEEEECSCCTTSCSSSHHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             970999988867985678799999999999997699899991


No 165
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structural genomics; 2.00A {Ralstonia solanacearum MOLK2}
Probab=38.86  E-value=17  Score=15.30  Aligned_cols=29  Identities=21%  Similarity=0.242  Sum_probs=23.3

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             889999609857999999998869849999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +||+|-=.|++-|.+|+.| +++|++|+-+
T Consensus         4 ~KI~IiGaGaiG~~~A~~L-~~~G~~Vtlv   32 (335)
T 3ghy_A            4 TRICIVGAGAVGGYLGARL-ALAGEAINVL   32 (335)
T ss_dssp             CCEEEESCCHHHHHHHHHH-HHTTCCEEEE
T ss_pred             CEEEEECCCHHHHHHHHHH-HHCCCCEEEE
T ss_conf             8899988779999999999-9689908999


No 166
>2h9a_B CO dehydrogenase/acetyl-COA synthase, iron- sulfur protein; heterodimer, beta-alpha-barrels, oxidoreductase; HET: B12; 1.90A {Carboxydothermus hydrogenoformans}
Probab=38.27  E-value=18  Score=15.24  Aligned_cols=106  Identities=13%  Similarity=0.180  Sum_probs=63.1

Q ss_pred             HHHHHH-HHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH-HHHHHHCCCCCHHHH
Q ss_conf             579999-999988698499999870478766555577881899999999999809958981707-886632244112678
Q gi|254780151|r   31 VDSSVV-AALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE-ERFRNAVIVPFASSY  108 (408)
Q Consensus        31 VDSsva-a~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~-~~f~~~V~~~~~~~y  108 (408)
                      +|..++ |..+.+.|-|.+.+-..--+.+     ...-+.++.++-++.|.+.+.+|+-+...+ +.+.-.|++--++. 
T Consensus        73 ~~d~v~~Ak~~ve~GADiIdIg~~StrPg-----~~~vs~eee~~rV~~V~~~v~~pl~i~~~~~d~~d~~v~~~al~~-  146 (310)
T 2h9a_B           73 INDPVAWAKKCVEYGADIVALRLVSAHPD-----GQNRSGAELAEVCKAVADAIDVPLMIIGCGVEEKDAEIFPVIGEA-  146 (310)
T ss_dssp             TTCHHHHHHHHHHTTCSEEEEECGGGCTT-----TTCCCHHHHHHHHHHHHHHCSSCEEEECCSCHHHHHHHHHHHHHH-
T ss_pred             HHHHHHHHHHHHHCCCCEEEECCCCCCCC-----CCCCCHHHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHHHHHH-
T ss_conf             77699999999972998899715118999-----887899999999999999868980742342446649999999997-


Q ss_pred             HCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             708861200001541105888887401687645225
Q gi|254780151|r  109 AAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus       109 ~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                      .+|.  +|.+.-=..--+..+.+.|.+.|+..++..
T Consensus       147 ~~~~--~~li~~~~~~n~~~m~~~a~~~~~pvi~~~  180 (310)
T 2h9a_B          147 LSGR--NCLLSSATKDNYKPIVATCMVHGHSVVASA  180 (310)
T ss_dssp             TTTS--CCEEEEECTTTHHHHHHHHHHHTCEEEEEC
T ss_pred             HCCC--CCCCCCCCCCCHHHHHHHHHHCCCCEEEEC
T ss_conf             3510--356233540014899999998299899987


No 167
>1bxb_A Xylose isomerase; xylose metabolism; 2.20A {Thermus thermophilus HB8} SCOP: c.1.15.3 PDB: 1bxc_A
Probab=38.20  E-value=12  Score=16.42  Aligned_cols=99  Identities=16%  Similarity=0.189  Sum_probs=55.0

Q ss_pred             HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC
Q ss_conf             57999999998869849999987047876655557788189999999999980995898170788663224411267870
Q gi|254780151|r   31 VDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA  110 (408)
Q Consensus        31 VDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~  110 (408)
                      +|-..++..|.+-|++=+++|    +.+-.......--+++.+...++.++..||.+-.++. .-|.+       ..|+.
T Consensus        33 ~~~~~~~~~~~~lG~~~v~fH----d~Dl~P~~~~~~e~~~~~~~lk~~l~~~Gl~~~~~t~-nlf~~-------p~y~~  100 (387)
T 1bxb_A           33 LDPVYVVHKLAELGAYGVNLH----DEDLIPRGTPPQERDQIVRRFKKALDETGLKVPMVTA-NLFSD-------PAFKD  100 (387)
T ss_dssp             CCHHHHHHHHHHHTCSEEEEE----HHHHSCTTCCTTHHHHHHHHHHHHHHHHTCBCCEEEC-CCSSS-------GGGGG
T ss_pred             CCHHHHHHHHHHCCCCEEECC----CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCEEEECC-CCCCC-------HHHHC
T ss_conf             789999999983499778326----6655888999899999999999999963991124236-54457-------31314


Q ss_pred             CCC--CCCEECCCCEEEHHHHHHHHCCCCCCEE
Q ss_conf             886--1200001541105888887401687645
Q gi|254780151|r  111 GET--PLPCVDCNRTVKFSDLLSVTRQLGADVL  141 (408)
Q Consensus       111 G~T--PNPc~~CN~~iKF~~l~~~a~~~g~~~i  141 (408)
                      |--  |+|.++.-..=....-++.+.++|++.+
T Consensus       101 Gs~tnPDp~vR~~Ai~~~k~aId~a~~LGa~~~  133 (387)
T 1bxb_A          101 GAFTSPDPWVRAYALRKSLETMDLGAELGAEIY  133 (387)
T ss_dssp             CSTTCSSHHHHHHHHHHHHHHHHHHHHHTCCEE
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEE
T ss_conf             877897989999999999999999999589869


No 168
>1snn_A DHBP synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, isomerase; HET: 5RP; 1.55A {Methanocaldococcus jannaschii} SCOP: d.115.1.2 PDB: 1pvy_A* 1pvw_A
Probab=37.86  E-value=18  Score=15.20  Aligned_cols=66  Identities=20%  Similarity=0.315  Sum_probs=37.0

Q ss_pred             CCCCEECCCCCCCEEEECCCCCCCEEEEEE------CCCCCCCCEEEEEEECCHH-HCEEECCCCC-CCHHHHHHHHHHC
Q ss_conf             687645225311025412678773168853------1578787318986302022-1003342568-9978989999741
Q gi|254780151|r  136 LGADVLATGHYIRSRLYVGDDGKRRRIMCR------PMDLERDQSYFLFATTQQQ-LCDLRFPLGD-MKKESVRDLAREM  207 (408)
Q Consensus       136 ~g~~~iATGHYar~~~~~~~~~~~~~~L~r------~~D~~KDQSYfL~~l~~~~-L~~~~FPlg~-~~K~eVR~~A~~~  207 (408)
                      ..-||+--||--   .....++.   +|.|      +.|..|     |+++++-. +.-++=+=|+ +.+++.+++|+++
T Consensus       138 ~~~df~~PGHVf---pL~a~~gG---vl~R~GHTEaaVdL~~-----lAGl~P~avi~Eil~~dG~m~~~~~~~~fA~~~  206 (227)
T 1snn_A          138 FGKEFRSPGSVT---LLRAAEGL---VKNRQGHTEMTVALAE-----LANLVPITTICEMMGDDGNAMSKNETKRYAEKH  206 (227)
T ss_dssp             HHHHEEEEEEEE---EEECCTTG---GGTCCSHHHHHHHHHH-----HTTSCSEEEEEEEBCTTSSBCCHHHHHHHHHHH
T ss_pred             CHHHCCCCCEEC---CCCCCCCC---CCCCCCHHHHHHHHHH-----HCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHC
T ss_conf             874668997079---55315688---7447877999999999-----829986499999856998736889999999984


Q ss_pred             CCCCC
Q ss_conf             25435
Q gi|254780151|r  208 GLDIA  212 (408)
Q Consensus       208 gl~~a  212 (408)
                      +|+.-
T Consensus       207 ~l~~i  211 (227)
T 1snn_A          207 NLIYL  211 (227)
T ss_dssp             TCCEE
T ss_pred             CCCEE
T ss_conf             99799


No 169
>2nmm_A 14 kDa phosphohistidine phosphatase; NESG Q9H0Y3 human phosphohistidine phosphatase, structural genomics, PSI-2, protein structure initiative; 2.70A {Homo sapiens} SCOP: d.322.1.1
Probab=37.56  E-value=13  Score=16.22  Aligned_cols=11  Identities=55%  Similarity=0.812  Sum_probs=7.7

Q ss_pred             EEEEEEEECCC
Q ss_conf             88876897145
Q gi|254780151|r  376 RVLGGGIISGS  386 (408)
Q Consensus       376 ~vLGGGiI~~t  386 (408)
                      +|||||.|.-.
T Consensus        82 ~clGGGRI~h~   92 (135)
T 2nmm_A           82 ECLGGGRISHQ   92 (135)
T ss_dssp             EEEEEEEEEEE
T ss_pred             EEECCEEEEEC
T ss_conf             98516689887


No 170
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A
Probab=37.52  E-value=18  Score=15.16  Aligned_cols=88  Identities=17%  Similarity=0.206  Sum_probs=44.6

Q ss_pred             EEEECCCHHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH--------
Q ss_conf             999609857999999998869849999-98704787665555778818999999999998099589817078--------
Q gi|254780151|r   24 VVAMSGGVDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE--------   94 (408)
Q Consensus        24 ~va~SGGVDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~--------   94 (408)
                      ++|=-|-=-|++|..|.++-+-+++.+ -|+.+-+-+.....   ++.         .+.-+||||.+|+.+        
T Consensus        10 I~GpTasGKt~la~~lA~~~~~eIIsaDS~QvYr~l~IgTaK---pt~---------~e~~~i~Hhlid~~~p~~~~sv~   77 (323)
T 3crm_A           10 LMGPTAAGKTDLAMALADALPCELISVDSALIYRGMDIGTAK---PSR---------ELLARYPHRLIDIRDPAESYSAA   77 (323)
T ss_dssp             EECCTTSCHHHHHHHHHHHSCEEEEEECTTTTBTTCCTTTTC---CCH---------HHHHHSCEETSSCBCTTSCCCHH
T ss_pred             EECCCCCCHHHHHHHHHHHCCCEEEEEEHHHHCCCCCEEECC---CCH---------HHHHCCCEEEECCCCCCCCEEHH
T ss_conf             989771169999999999879979951248772999668889---999---------99918997344433877677099


Q ss_pred             HHHHHCCCCCHHHHHCCCCCCCEECCCCE
Q ss_conf             86632244112678708861200001541
Q gi|254780151|r   95 RFRNAVIVPFASSYAAGETPLPCVDCNRT  123 (408)
Q Consensus        95 ~f~~~V~~~~~~~y~~G~TPNPc~~CN~~  123 (408)
                      +|.+.+..-.-+-.++|.+|-=|-.++-+
T Consensus        78 ~f~~~a~~~i~~i~~~gk~PIiVGGTglY  106 (323)
T 3crm_A           78 EFRADALAAMAKATARGRIPLLVGGTMLY  106 (323)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEESCHHH
T ss_pred             HHHHHHHHHHHHHHHCCCCEEEECCCHHH
T ss_conf             99999999999998359940897561399


No 171
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold domains, structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus HB8}
Probab=37.29  E-value=18  Score=15.14  Aligned_cols=53  Identities=19%  Similarity=0.301  Sum_probs=34.6

Q ss_pred             CEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             8899-99609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   21 MRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        21 ~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      |||+ .|=|+|+-.++|-.|   +|++|+.+-     .           .   .+..+.++++++......|++++
T Consensus         1 MkvlITGas~GIG~a~a~~l---~G~~V~l~~-----r-----------~---~~~l~~l~~~~~~~~~~~Dv~d~   54 (207)
T 2yut_A            1 MRVLITGATGGLGGAFARAL---KGHDLLLSG-----R-----------R---AGALAELAREVGARALPADLADE   54 (207)
T ss_dssp             CEEEEETTTSHHHHHHHHHT---TTSEEEEEC-----S-----------C---HHHHHHHHHHHTCEECCCCTTSH
T ss_pred             CEEEEECCCCHHHHHHHHHH---CCCEEEEEE-----C-----------C---HHHHHHHHHHCCCEEEEEECCCH
T ss_conf             98999878869999999997---799899998-----7-----------8---99999999972997999427999


No 172
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 3.00A {Aquifex aeolicus VF5}
Probab=37.27  E-value=18  Score=15.21  Aligned_cols=60  Identities=15%  Similarity=0.132  Sum_probs=29.8

Q ss_pred             CCEEEEEEECCHHHCEEECCCCCCCHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHH
Q ss_conf             731898630202210033425689978989999741254355111023011127751034553
Q gi|254780151|r  172 DQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKR  234 (408)
Q Consensus       172 DQSYfL~~l~~~~L~~~~FPlg~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~  234 (408)
                      |-..++..=.+.+++|++=  .+++.+++..+-.. -++..+|.+--+.+..-+++..++.++
T Consensus       125 d~vi~v~a~~~~r~~Rl~~--R~~s~e~~~~ri~~-Q~~~~~k~~~AD~vI~N~~~le~l~~~  184 (204)
T 2if2_A          125 DKLIVVYAPYEVCKERAIK--RGMSEEDFERRWKK-QMPIEEKVKYADYVIDNSGSIEETYKQ  184 (204)
T ss_dssp             SEEEEECCCHHHHHHHHHH--TCCCHHHHHHHHTT-SCCHHHHGGGCSEECCCSSCHHHHHHH
T ss_pred             CEEEEEECCHHHHHHHHHC--CCCCHHHHHHHHHH-CCCHHHHHHHCCEEEECCCCHHHHHHH
T ss_conf             8899997864899999871--43899999999995-799899998599999899999999999


No 173
>3cf4_A Acetyl-COA decarbonylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductase; 2.00A {Methanosarcina barkeri}
Probab=37.10  E-value=13  Score=16.18  Aligned_cols=96  Identities=14%  Similarity=0.272  Sum_probs=46.1

Q ss_pred             CCEEEEEECCCHHHHHHHHH--HHH----CCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             38899996098579999999--988----698499999870478766555577881899999999999809958981707
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAAL--LKR----DGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~l--L~~----~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      ..+|.+..+|=--+..+..+  +.+    .|.+|.|+                ||+-.|+.....+-...++++..=++.
T Consensus       240 ~d~vNIlVhGHnp~l~~~ive~~~~~~gA~GI~v~Gi----------------CCTg~Eml~r~~~~~~~~~~~~~G~~~  303 (807)
T 3cf4_A          240 KSKPFLCVIGHNVAGVTYMMDYMEDNNLTDKMEIAGL----------------CCTAIDLTRYKEADRRPPYAKVIGSMS  303 (807)
T ss_dssp             TTSCEEEEESSCCHHHHHHHHHHHHTTCTTTSEEEEE----------------SHHHHHHTTTTCTTCCCCCSEEEESGG
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHHCCCCCCEEEEE----------------ECCHHHHHHCCCCCCCCCCCCCCCCHH
T ss_conf             8985799979984479999999976556788679998----------------172787875247740014663337199


Q ss_pred             HHHH---HHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             8866---322441126787088612000015411058888874016876452253
Q gi|254780151|r   94 ERFR---NAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus        94 ~~f~---~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      .+-+   ..++|-++-          |+-|   | +..+.+.|++++...|+|--
T Consensus       304 ~qe~vi~TGavDa~Vv----------D~QC---i-~P~l~~~A~~~~tkvItTs~  344 (807)
T 3cf4_A          304 KELKVIRSGMPDVIVV----------DEQC---V-RGDIVPEAQKLKIPVIASNP  344 (807)
T ss_dssp             GHHHHHHHTCCSEEEE----------CSSS---C-CTTHHHHHHHTTCCEEECST
T ss_pred             HHHHHHHCCCCCEEEE----------ECCC---C-CCCCHHHHHHHCCEEEEECC
T ss_conf             9999986599754998----------6546---7-87619999972983998251


No 174
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM- barrel, rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A*
Probab=36.58  E-value=19  Score=15.06  Aligned_cols=73  Identities=7%  Similarity=0.120  Sum_probs=43.1

Q ss_pred             CCCEEEEEECCC----HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             338899996098----5799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   19 KDMRVVVAMSGG----VDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        19 k~~kV~va~SGG----VDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      ++.||+++--||    +-..+.|.+|...||+|+=+-..              ...+++   ...+.+.+...-.+...-
T Consensus         2 ~k~kVvi~~~~~D~H~lG~~~va~~l~~~G~~V~~LG~~--------------~p~e~i---v~~~~~~~~d~V~iS~~~   64 (137)
T 1ccw_A            2 EKKTIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVL--------------SPQELF---IKAAIETKADAILVSSLY   64 (137)
T ss_dssp             CCCEEEEEEETTCCCCHHHHHHHHHHHHTTCEEEEEEEE--------------ECHHHH---HHHHHHHTCSEEEEEECS
T ss_pred             CCCEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEECCCC--------------CCHHHH---HHHHHHHCCCEEEEEECC
T ss_conf             998799994698745899999999999879879977866--------------699999---999998399878876113


Q ss_pred             HHHHHCCCCCHHHH
Q ss_conf             86632244112678
Q gi|254780151|r   95 RFRNAVIVPFASSY  108 (408)
Q Consensus        95 ~f~~~V~~~~~~~y  108 (408)
                      ......+..+++..
T Consensus        65 ~~~~~~~~~~i~~L   78 (137)
T 1ccw_A           65 GQGEIDCKGLRQKC   78 (137)
T ss_dssp             STHHHHHTTHHHHH
T ss_pred             CCCHHHHHHHHHHH
T ss_conf             44557799999999


No 175
>2hw4_A 14 kDa phosphohistidine phosphatase; PHPT1, human, structural genomics, structural genomics consortium, SGC, hydrolase; 1.90A {Homo sapiens} SCOP: d.322.1.1 PDB: 2ai6_A 2ozw_A 2ozx_A
Probab=36.21  E-value=14  Score=15.98  Aligned_cols=11  Identities=55%  Similarity=0.812  Sum_probs=8.9

Q ss_pred             EEEEEEEECCC
Q ss_conf             88876897145
Q gi|254780151|r  376 RVLGGGIISGS  386 (408)
Q Consensus       376 ~vLGGGiI~~t  386 (408)
                      +|||||.|.-.
T Consensus        91 eclGGGRI~hd  101 (144)
T 2hw4_A           91 ECLGGGRISHQ  101 (144)
T ss_dssp             EEEEEEEEEEE
T ss_pred             EEECCEEEEEC
T ss_conf             98626178888


No 176
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A*
Probab=36.08  E-value=19  Score=15.01  Aligned_cols=37  Identities=27%  Similarity=0.375  Sum_probs=25.9

Q ss_pred             CCCCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             788863388999-96098579999999988698499999
Q gi|254780151|r   14 LDKNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        14 ~~~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |+.+-+.++++| |=|+|+-.++|-.|+ ++|++|+.+.
T Consensus         1 M~~~L~GK~alITGas~GIG~aia~~la-~~Ga~V~~~~   38 (244)
T 3d3w_A            1 MELFLAGRRVLVTGAGKGIGRGTVQALH-ATGARVVAVS   38 (244)
T ss_dssp             CCCCCTTCEEEEESTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             9898699989993897599999999999-8799999997


No 177
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2
Probab=35.88  E-value=19  Score=14.98  Aligned_cols=37  Identities=14%  Similarity=0.181  Sum_probs=25.5

Q ss_pred             CCCCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             788863388999-96098579999999988698499999
Q gi|254780151|r   14 LDKNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        14 ~~~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |..+-+++.|+| |=|+|+-.++|-.|+ ++|++|+.+.
T Consensus         8 ~~m~l~gK~alVTGas~GIG~aia~~la-~~Ga~V~i~~   45 (265)
T 1h5q_A            8 FTISFVNKTIIVTGGNRGIGLAFTRAVA-AAGANVAVIY   45 (265)
T ss_dssp             EEECCTTEEEEEETTTSHHHHHHHHHHH-HTTEEEEEEE
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             9737899979992888789999999999-8799899997


No 178
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A*
Probab=35.74  E-value=19  Score=14.97  Aligned_cols=55  Identities=20%  Similarity=0.128  Sum_probs=32.7

Q ss_pred             CEEEEEECCCHHHHHHHHHH--H--HCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             88999960985799999999--8--8698499999870478766555577881899999999999809958981707
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALL--K--RDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL--~--~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      |||+|-.||+ .|.+.+.+-  +  +-++++.+|.-   +..+        +      .....|+..+++.......
T Consensus         1 Mki~il~SG~-Gsnl~~li~~~~~~~l~~~I~~Vis---n~~~--------~------~~l~~~~~~~~~~~~~~~~   59 (212)
T 1jkx_A            1 MNIVVLISGN-GSNLQAIIDACKTNKIKGTVRAVFS---NKAD--------A------FGLERARQAGIATHTLIAS   59 (212)
T ss_dssp             CEEEEEESSC-CHHHHHHHHHHHTTSSSSEEEEEEE---SCTT--------C------HHHHHHHHTTCEEEECCGG
T ss_pred             CEEEEEEECC-CHHHHHHHHHHHCCCCCCEEEEEEE---CCCC--------C------CHHHHHHHCCCCCCCCCCC
T ss_conf             9699998278-0789999998871999987999994---7987--------5------3013544313122001123


No 179
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase; 2.09A {Bartonella henselae str} PDB: 3enn_A 3emk_A
Probab=35.23  E-value=20  Score=14.92  Aligned_cols=57  Identities=11%  Similarity=0.184  Sum_probs=34.5

Q ss_pred             CCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE--ECCHHHH
Q ss_conf             3388999-960985799999999886984999998704787665555778818999999999998099589--8170788
Q gi|254780151|r   19 KDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHY--VFDYEER   95 (408)
Q Consensus        19 k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~--~~d~~~~   95 (408)
                      +++.++| |=|+|+-.++|..|+ ++|++|+.+.. .               +   +.++++++.+|-...  ..|++++
T Consensus        26 ~gK~alVTGas~GIG~aia~~la-~~Ga~V~i~~r-~---------------~---~~l~~~~~~~g~~~~~~~~Dv~~~   85 (266)
T 3grp_A           26 TGRKALVTGATGGIGEAIARCFH-AQGAIVGLHGT-R---------------E---DKLKEIAADLGKDVFVFSANLSDR   85 (266)
T ss_dssp             TTCEEEESSTTSHHHHHHHHHHH-HTTCEEEEEES-C---------------H---HHHHHHHHHHCSSEEEEECCTTSH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEEC-C---------------H---HHHHHHHHHHCCCEEEEEECCCCH
T ss_conf             99989993878689999999999-87999999979-9---------------9---999999998399779999017999


No 180
>3gjz_A Microcin immunity protein MCCF; niaid structural genomic centers for infectious diseases, csgid, immune system, structural genomics; 2.10A {Bacillus anthracis str}
Probab=34.98  E-value=20  Score=14.89  Aligned_cols=39  Identities=18%  Similarity=0.250  Sum_probs=25.7

Q ss_pred             CCCCCCCCC-CCCEEE-EEECCCHHHH------HHHHHHHHCCCEEE
Q ss_conf             434678886-338899-9960985799------99999988698499
Q gi|254780151|r   10 NSLDLDKNP-KDMRVV-VAMSGGVDSS------VVAALLKRDGYDVI   48 (408)
Q Consensus        10 ~~~~~~~~~-k~~kV~-va~SGGVDSs------vaa~lL~~~G~~V~   48 (408)
                      |+|-+.+.- +..+|. ||-|+|+...      .+...|++.||+|+
T Consensus         2 ~~m~~P~~Lk~GD~I~viAPSs~~~~~~~~~~~~~~~~L~~~G~~v~   48 (336)
T 3gjz_A            2 NAMPLPKSLKYGDTIGIYSPSSPVTYTSPKRFERAKSYLLQKGFHIL   48 (336)
T ss_dssp             CCCCCCCCCCTTCEEEEECSSCCHHHHCHHHHHHHHHHHHHTTCEEE
T ss_pred             CCCCCCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHHHCCCEEE
T ss_conf             98988999998699999958986655499999999999986899998


No 181
>2hh8_A Hypothetical protein YDFO; structure, autostructure, NESG, PSI-2, northeast structural genomics consortium, protein structure initiative; NMR {Escherichia coli} SCOP: d.358.1.1
Probab=34.77  E-value=20  Score=14.86  Aligned_cols=87  Identities=7%  Similarity=0.101  Sum_probs=50.0

Q ss_pred             EHHHHHHHHCCCCC----CEECCCCCCCEEEECCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCC-CHHH
Q ss_conf             05888887401687----645225311025412678773168853157878731898630202210033425689-9789
Q gi|254780151|r  125 KFSDLLSVTRQLGA----DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM-KKES  199 (408)
Q Consensus       125 KF~~l~~~a~~~g~----~~iATGHYar~~~~~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~-~K~e  199 (408)
                      .|+.|+...+++|.    .+|+||+|   .. .+.++.  ....++.                   +..+|+..- .+..
T Consensus        24 dFp~~~~elk~~GV~~Y~y~V~~G~~---~y-~~~dg~--~V~~~~~-------------------~~~i~Va~~~n~~~   78 (149)
T 2hh8_A           24 NYQWFYSELKRHNVSHYIYYLATENV---HI-VLKNDN--TVLLKGL-------------------KNIVSVKFSKDRHL   78 (149)
T ss_dssp             CCHHHHHHHHHHCSSEEEEETTTTEE---EE-ECSSSC--EEEEECS-------------------TTCCCCCSCCCHHH
T ss_pred             CCHHHHHHHHHHCCEEEEEEECCCCE---EE-EECCCC--EEEEECC-------------------CCEEEECCCCCHHH
T ss_conf             93899999997196257999048989---99-926999--9997357-------------------75088537689899


Q ss_pred             HHHHHHHCCCCCCCHHHCCCEEECCCCCCHHHHHHCCCCCCCCCCEECCCCC
Q ss_conf             8999974125435511102301112775103455307664346711037743
Q gi|254780151|r  200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ  251 (408)
Q Consensus       200 VR~~A~~~gl~~a~K~eSqgICFi~~~~~~~Fl~~~~~~~~~~G~ivd~~G~  251 (408)
                      ++...++.              .-|..+|.+|++..-. ..--+.++|..+.
T Consensus        79 i~~aik~~--------------QaG~~~F~~F~~~~a~-AGV~~w~vdl~~~  115 (149)
T 2hh8_A           79 IETTSNKL--------------KSREITFQEYRRNLAK-AGVFRWVTNIHEQ  115 (149)
T ss_dssp             HHHHHHHH--------------HHTCCCHHHHHHHHHH-TTCCEEEEETTTT
T ss_pred             HHHHHHHH--------------HCCCCCHHHHHHHHHH-CCCEEEEEECCCC
T ss_conf             99999998--------------7499759999999986-7926999981287


No 182
>3n7t_A Macrophage binding protein; seattle structural genomics center for infectious disease, S macrophage, pathogenic fungus, coccidioidomycosis; 2.10A {Coccidioides immitis}
Probab=34.11  E-value=20  Score=14.79  Aligned_cols=39  Identities=13%  Similarity=0.125  Sum_probs=29.6

Q ss_pred             CCCCCCCCEEEEEECCCH---------------HHHHHHHHHHHCCCEEEEEEE
Q ss_conf             788863388999960985---------------799999999886984999998
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGV---------------DSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGV---------------DSsvaa~lL~~~G~~V~g~~m   52 (408)
                      ..++|+.+||++.+|.--               .-+.....|+++||+|.=+.-
T Consensus         3 ~~~~p~~kkvLivvts~~~~~~~~g~~TG~~l~E~~~P~~~l~~aG~eV~iASp   56 (247)
T 3n7t_A            3 GSMAPLPRKALLAITSAHPPFWPDGKRTGLFFSEALHPFNELTAAGFEVDVASE   56 (247)
T ss_dssp             ----CCCSEEEEECCCCCCBCSTTSCBCCBCHHHHHHHHHHHHHTTCEEEEEES
T ss_pred             CCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             887998862899995788666789985545799999999999977996999768


No 183
>3h9n_A Ribosome maturation factor RIMM; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.70A {Haemophilus influenzae}
Probab=34.01  E-value=20  Score=14.78  Aligned_cols=56  Identities=13%  Similarity=0.118  Sum_probs=35.3

Q ss_pred             CCEECCCCCEEEEECCCEEEEECCC-------------CCCCCCCCCCCEEEECCCCCCEEEEECCCCC
Q ss_conf             7110377432233578315310233-------------4335657786137631755312565235554
Q gi|254780151|r  243 GDIVHLNGQILGRHNGIINYTIGQR-------------RGLGVAMGEPLFVVYLDKNSSRVIVGPRESL  298 (408)
Q Consensus       243 G~ivd~~G~viG~H~G~~~yTIGQR-------------kGL~i~~~eP~YVv~id~~~N~ViVg~~~~L  298 (408)
                      -.++|.+|+.+|.-..+..+.-+.=             +-+=+|.-...||.++|.+++.|+|-+-+.|
T Consensus       103 ~~V~d~~g~~lG~V~~v~~~~a~dll~V~~~~~~~~~~ke~LIPfv~~~~V~~ID~~~k~I~v~~peGl  171 (177)
T 3h9n_A          103 CTVVNLEGYTMGTVTEMMETGSNDVLVVKANTKDAFGKQERLIPFLYEQVVKRVDLTTKTIEVDWDAGF  171 (177)
T ss_dssp             CEEEETTCCEEEEEEEEEESSSCEEEEEECCTTCTTCCSEEEEECCBTTTEEEEEGGGTEEEECCCSST
T ss_pred             CEEEECCCCCCEEEEEECCCCCCEEEEEEECCCCCCCCCEEEEECCCCCCCEEEECCCCEEEEECCCCH
T ss_conf             499966896057993981069923999992886677983899733752575079778999999898036


No 184
>2qk4_A Trifunctional purine biosynthetic protein adenosine-3; purine synthesis, enzyme, protein-ATP complex, structural genomics; HET: ATP; 2.45A {Homo sapiens}
Probab=33.94  E-value=20  Score=14.77  Aligned_cols=84  Identities=18%  Similarity=0.203  Sum_probs=52.0

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCC--CCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             63388999960985799999999886984999998704787665555--7788189999999999980995898170788
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK--GSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~--~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ...+||+|-=|||-.-+.|-.|.+  ...|.-+++-..+........  .......|.+...+.|+...|.+-++--+..
T Consensus        22 ~~~~KILviGsGgREhAia~~l~~--s~~~~~v~~~pgN~g~~~~~~~~~~~i~~~d~~~i~~~~~~~~iDlvivGpE~p   99 (452)
T 2qk4_A           22 SMAARVLIIGSGGREHTLAWKLAQ--SHHVKQVLVAPGNAGTACSEKISNTAISISDHTALAQFCKEKKIEFVVVGPEAP   99 (452)
T ss_dssp             CCSEEEEEEECSHHHHHHHHHHTT--CTTEEEEEEEECCGGGSBSSSEEECCCCSSCHHHHHHHHHHHTCCEEEECSSHH
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHH--CCCCCEEEEECCCHHHHCCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEECCCHH
T ss_conf             368779999978899999999985--989888999789879850043123465867999999999985999999897389


Q ss_pred             HHHHCCCC
Q ss_conf             66322441
Q gi|254780151|r   96 FRNAVIVP  103 (408)
Q Consensus        96 f~~~V~~~  103 (408)
                      -...+.+.
T Consensus       100 L~~Gl~D~  107 (452)
T 2qk4_A          100 LAAGIVGN  107 (452)
T ss_dssp             HHTTHHHH
T ss_pred             HHHHHHHH
T ss_conf             89889999


No 185
>3dtt_A NADP oxidoreductase; YP_830112.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP}
Probab=33.70  E-value=21  Score=14.75  Aligned_cols=32  Identities=25%  Similarity=0.249  Sum_probs=24.3

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             633889999609857999999998869849999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      -++|||.|-=.|-+-+.+|..|. ++||+|+..
T Consensus        17 ~~~MkIaVIG~G~mG~~lA~~La-~aGh~V~v~   48 (245)
T 3dtt_A           17 FQGMKIAVLGTGTVGRTMAGALA-DLGHEVTIG   48 (245)
T ss_dssp             --CCEEEEECCSHHHHHHHHHHH-HTTCEEEEE
T ss_pred             CCCCEEEEECCCHHHHHHHHHHH-HCCCEEEEE
T ss_conf             58998999996799999999999-879979998


No 186
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A
Probab=33.65  E-value=21  Score=14.74  Aligned_cols=32  Identities=19%  Similarity=0.365  Sum_probs=25.2

Q ss_pred             CEEEEEECC-----CH---HHHHHHHHHHHCCCEEEEEEE
Q ss_conf             889999609-----85---799999999886984999998
Q gi|254780151|r   21 MRVVVAMSG-----GV---DSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        21 ~kV~va~SG-----GV---DSsvaa~lL~~~G~~V~g~~m   52 (408)
                      +||+|-|||     |.   .-.+....|+++|++|.-+-.
T Consensus         7 KKvaviLsg~g~~DG~E~~E~~~p~~~L~raG~~V~~~sp   46 (232)
T 1vhq_A            7 KKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFAP   46 (232)
T ss_dssp             CEEEEECCSBSTTTSBCHHHHHHHHHHHHHTTCEEEEEEC
T ss_pred             CEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEEC
T ss_conf             7599996688787750298999999999988997999957


No 187
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A
Probab=33.04  E-value=21  Score=14.67  Aligned_cols=40  Identities=38%  Similarity=0.502  Sum_probs=31.2

Q ss_pred             CCCCCCCCCCCEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             3467888633889999-6098579999999988698499999
Q gi|254780151|r   11 SLDLDKNPKDMRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        11 ~~~~~~~~k~~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +|+|.--|+.++|+|- -+|=+-|.++..||+ +||+|+|+.
T Consensus         2 ~~~~~~~~~gk~VLVTG~tGfIGs~l~~~Ll~-~G~~V~~~v   42 (342)
T 1y1p_A            2 KIDNAVLPEGSLVLVTGANGFVASHVVEQLLE-HGYKVRGTA   42 (342)
T ss_dssp             CSTTCSSCTTCEEEEETTTSHHHHHHHHHHHH-TTCEEEEEE
T ss_pred             CCCCCCCCCCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             88889899959999989978999999999997-859899996


No 188
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A*
Probab=32.63  E-value=21  Score=14.63  Aligned_cols=57  Identities=18%  Similarity=0.124  Sum_probs=36.6

Q ss_pred             CCCCCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC---EEECCH
Q ss_conf             86338899-99609857999999998869849999987047876655557788189999999999980995---898170
Q gi|254780151|r   17 NPKDMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS---HYVFDY   92 (408)
Q Consensus        17 ~~k~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~---~~~~d~   92 (408)
                      +|. +||+ ||=..|--+    ..|.+.|.+|+|+-.                +++-++.|++.+...+++   +...|+
T Consensus        20 ~pg-~rVLDiGCGtG~~~----~~la~~~~~v~gvD~----------------S~~ml~~A~~~~~~~~~~~~~~~~~d~   78 (239)
T 1xxl_A           20 RAE-HRVLDIGAGAGHTA----LAFSPYVQECIGVDA----------------TKEMVEVASSFAQEKGVENVRFQQGTA   78 (239)
T ss_dssp             CTT-CEEEEESCTTSHHH----HHHGGGSSEEEEEES----------------CHHHHHHHHHHHHHHTCCSEEEEECBT
T ss_pred             CCC-CEEEEECCCCCHHH----HHHHHCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             998-98999588685999----999970997999979----------------999999999865430565400010222


Q ss_pred             HH
Q ss_conf             78
Q gi|254780151|r   93 EE   94 (408)
Q Consensus        93 ~~   94 (408)
                      .+
T Consensus        79 ~~   80 (239)
T 1xxl_A           79 ES   80 (239)
T ss_dssp             TB
T ss_pred             CC
T ss_conf             35


No 189
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A
Probab=32.51  E-value=16  Score=15.56  Aligned_cols=32  Identities=22%  Similarity=0.322  Sum_probs=23.8

Q ss_pred             CCCHHHHHHHHHHCCCCCCCHHHCCCEEECCC
Q ss_conf             89978989999741254355111023011127
Q gi|254780151|r  194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQ  225 (408)
Q Consensus       194 ~~~K~eVR~~A~~~gl~~a~K~eSqgICFi~~  225 (408)
                      +++.+|++++-.++|+....-.-+.+.|||.=
T Consensus        16 ~~t~~~l~~lF~~~G~~~~~~~~~kg~afV~f   47 (88)
T 1wg1_A           16 DSNCQEVHDLLKDYDLKYCYVDRNKRTAFVTL   47 (88)
T ss_dssp             SCCHHHHHHHTCSSCCCCEEEEGGGTEEEECC
T ss_pred             CCCHHHHHHHHHHCCCCEEEECCCCCEEEEEE
T ss_conf             99999999999745984499667685599998


No 190
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme A kinase, structural genomics, joint center for structural genomics, JCSG; HET: ADP COD; 2.60A {Thermotoga maritima}
Probab=32.22  E-value=22  Score=14.58  Aligned_cols=29  Identities=28%  Similarity=0.535  Sum_probs=20.2

Q ss_pred             CEEEEEECCCHHH--HHHHHHHHH-CCCEEEE
Q ss_conf             8899996098579--999999988-6984999
Q gi|254780151|r   21 MRVVVAMSGGVDS--SVVAALLKR-DGYDVIG   49 (408)
Q Consensus        21 ~kV~va~SGGVDS--svaa~lL~~-~G~~V~g   49 (408)
                      -..+||+.||.-|  |.++.+|++ .|+.|+-
T Consensus        11 ~~mIIgiTG~igSGKStv~~~l~~~~g~~vid   42 (192)
T 2grj_A           11 HHMVIGVTGKIGTGKSTVCEILKNKYGAHVVN   42 (192)
T ss_dssp             CEEEEEEECSTTSSHHHHHHHHHHHHCCEEEE
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHCCCEEEE
T ss_conf             77799987898788999999998853998997


No 191
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP, oxidoreductase, PSI; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A
Probab=32.06  E-value=9.5  Score=17.16  Aligned_cols=116  Identities=16%  Similarity=0.170  Sum_probs=61.5

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEE
Q ss_conf             99999999980995898170788663224411267870886120000154110588888740168764522531102541
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLY  152 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~  152 (408)
                      .+.-++.|+.+||.+..+.+.+.-.                            -..+++..++++.|-=.+|-+.+.-..
T Consensus        50 v~~k~k~~~~~Gi~~~~~~l~~~~~----------------------------e~el~~~I~~lN~d~~v~GIlvqlPlP  101 (281)
T 2c2x_A           50 VRGKHADCAKVGITSIRRDLPADIS----------------------------TATLNETIDELNANPDCTGYIVQLPLP  101 (281)
T ss_dssp             HHHHHHHHHHHTCEEEEEEECTTCC----------------------------HHHHHHHHHHHHHCTTCCEEEECSCCC
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCC----------------------------HHHHHHHHHHHHCCCCCCEEEEECCCC
T ss_conf             9999999998599799852688778----------------------------999999999982898655378853586


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCC---CHHHHHHHHHHCCCCCCCHHHCCCEEECCCCC
Q ss_conf             2678773168853157878731898630202210033425689---97898999974125435511102301112775
Q gi|254780151|r  153 VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM---KKESVRDLAREMGLDIADKSDSQDICFVQQGK  227 (408)
Q Consensus       153 ~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~---~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~  227 (408)
                         ++-....++.+.++.||    .=+++..-+.++..---.+   |-.-|.++.+.++++...    ..++-||++.
T Consensus       102 ---~~~~~~~i~~~I~p~KD----VDGl~~~N~g~l~~~~~~~~PcT~~ai~~lL~~~~i~l~G----k~vvViGrS~  168 (281)
T 2c2x_A          102 ---KHLDENAALERVDPAKD----ADGLHPTNLGRLVLGTPAPLPCTPRGIVHLLRRYDISIAG----AHVVVIGRGV  168 (281)
T ss_dssp             ---TTSCHHHHHHHSCGGGB----TTSCCHHHHHHHHHTCCCCCCHHHHHHHHHHHHTTCCCTT----CEEEEECCCT
T ss_pred             ---CCCCCHHHEEECCCCCC----CCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCC----CEEEEEECCC
T ss_conf             ---54444120220273336----5655624663102467666885089999999996988768----6689980587


No 192
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A
Probab=31.72  E-value=22  Score=14.53  Aligned_cols=67  Identities=15%  Similarity=0.197  Sum_probs=37.4

Q ss_pred             CCCEEEEEECCCHHHHHH-----HHHHHHCCCEEEEEEEECCCCCCCCCCC-CCCCCHHHHHHHHHHHHHCCC
Q ss_conf             338899996098579999-----9999886984999998704787665555-778818999999999998099
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVV-----AALLKRDGYDVIGVTLQLYNSRKASKRK-GSCCAGQDVYDARRVCDTINV   85 (408)
Q Consensus        19 k~~kV~va~SGGVDSsva-----a~lL~~~G~~V~g~~m~~~~~~~~~~~~-~~c~~~~d~~~a~~va~~LgI   85 (408)
                      +..+.+|.+-||-.|+..     +..|.++||.|+.+-++.+...+..... ..-..++...+...+.++|++
T Consensus        21 ~~~~~vvllhg~~g~~~~~~~~~~~~l~~~g~~vi~~D~~G~G~S~~~~~~~~~~~~~~~~~~~~~~~~~l~~   93 (254)
T 2ocg_A           21 EGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKF   93 (254)
T ss_dssp             CCSEEEEEECCTTCCHHHHCHHHHHHSCTTTEEEEEECCTTSTTCCSSCCCCCTTHHHHHHHHHHHHHHHTTC
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCC
T ss_conf             9998189989998765778999999999789989996689977778865334345899999999999997499


No 193
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2
Probab=31.65  E-value=22  Score=14.52  Aligned_cols=30  Identities=27%  Similarity=0.480  Sum_probs=23.5

Q ss_pred             EE-EEEECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             89-99960985799999999886984999998
Q gi|254780151|r   22 RV-VVAMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        22 kV-~va~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      .+ +.|-||-|-|.++-.|++ +|++|+++--
T Consensus         3 ~~LVTGatGfiG~~L~~~Ll~-~g~~V~~~dr   33 (372)
T 1db3_A            3 VALITGVTGQDGSYLAEFLLE-KGYEVHGIKR   33 (372)
T ss_dssp             EEEEETTTSHHHHHHHHHHHH-TTCEEEEECC
T ss_pred             EEEEECCCCHHHHHHHHHHHH-CCCEEEEEEC
T ss_conf             899948887899999999997-8598999978


No 194
>3mc3_A DSRE/DSRF-like family protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.49A {Sulfolobus solfataricus}
Probab=31.59  E-value=22  Score=14.51  Aligned_cols=41  Identities=7%  Similarity=0.254  Sum_probs=27.4

Q ss_pred             CCCCCCCCEEEEEECCCHHH---HHHHHHH----HHCCCEEEEEEEECC
Q ss_conf             78886338899996098579---9999999----886984999998704
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDS---SVVAALL----KRDGYDVIGVTLQLY   55 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDS---svaa~lL----~~~G~~V~g~~m~~~   55 (408)
                      -....+++||+|-++.|-++   +..+..+    .+.|++|. +|+-.+
T Consensus         9 ~~e~~~~~~i~Iivt~Gp~d~~ra~~af~lA~~A~~~G~eV~-iFl~~~   56 (134)
T 3mc3_A            9 GQEEEQXXXILIVVTHGPEDLDRTYAPLFMASISASMEYETS-VFFMIX   56 (134)
T ss_dssp             -----CCCEEEEEECCCGGGTHHHHHHHHHHHHHHHTTCEEE-EEECTT
T ss_pred             CCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHHHHCCCEEE-EEEEEC
T ss_conf             432136636999994699987999999999999997899299-999606


No 195
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str}
Probab=30.98  E-value=23  Score=14.44  Aligned_cols=57  Identities=19%  Similarity=0.196  Sum_probs=35.2

Q ss_pred             CCCCEEEEEECC-CHHHHHHHHHHHHCC-CEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             633889999609-857999999998869-84999998704787665555778818999999999998099589817078
Q gi|254780151|r   18 PKDMRVVVAMSG-GVDSSVVAALLKRDG-YDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        18 ~k~~kV~va~SG-GVDSsvaa~lL~~~G-~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      .+.+||+=-=+| |..|    ..|.+.| .+|+|+-+                ++.-++.|++.+..-++.+...|..+
T Consensus        43 ~~g~~VLDiGcG~G~~~----~~l~~~g~~~v~giD~----------------S~~~i~~a~~~~~~~~~~~~~~d~~~  101 (253)
T 3g5l_A           43 FNQKTVLDLGCGFGWHC----IYAAEHGAKKVLGIDL----------------SERMLTEAKRKTTSPVVCYEQKAIED  101 (253)
T ss_dssp             CTTCEEEEETCTTCHHH----HHHHHTTCSEEEEEES----------------CHHHHHHHHHHCCCTTEEEEECCGGG
T ss_pred             CCCCEEEEECCCCCHHH----HHHHHCCCCEEEEEEC----------------CCHHHHHHHHHHCCCCCCCCCCCCCC
T ss_conf             89698999837784999----9999649998999948----------------50656899874034443222222245


No 196
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2
Probab=30.87  E-value=23  Score=14.43  Aligned_cols=63  Identities=14%  Similarity=0.160  Sum_probs=36.3

Q ss_pred             CCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEE--ECCH
Q ss_conf             8863388999-960985799999999886984999998704787665555778818999999999998099589--8170
Q gi|254780151|r   16 KNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHY--VFDY   92 (408)
Q Consensus        16 ~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~--~~d~   92 (408)
                      +.-+++.++| |=|+|+-.++|-.|+ ++|++|+.+..                .++.++.+.+-++..|...+  ..|+
T Consensus         3 ~~l~gKvalITGas~GIG~aia~~la-~~Ga~V~~~~r----------------~~~~l~~~~~~l~~~g~~~~~~~~Dv   65 (262)
T 1zem_A            3 KKFNGKVCLVTGAGGNIGLATALRLA-EEGTAIALLDM----------------NREALEKAEASVREKGVEARSYVCDV   65 (262)
T ss_dssp             CTTTTCEEEEETTTSHHHHHHHHHHH-HTTCEEEEEES----------------CHHHHHHHHHHHHTTTSCEEEEECCT
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEEC----------------CHHHHHHHHHHHHHCCCCEEEEECCC
T ss_conf             65283989993878789999999999-87998999989----------------98999999999985299389998238


Q ss_pred             HHH
Q ss_conf             788
Q gi|254780151|r   93 EER   95 (408)
Q Consensus        93 ~~~   95 (408)
                      +++
T Consensus        66 ~~~   68 (262)
T 1zem_A           66 TSE   68 (262)
T ss_dssp             TCH
T ss_pred             CCH
T ss_conf             999


No 197
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP}
Probab=30.68  E-value=23  Score=14.41  Aligned_cols=30  Identities=30%  Similarity=0.566  Sum_probs=23.1

Q ss_pred             CEEEE--EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             88999--96098579999999988698499999
Q gi|254780151|r   21 MRVVV--AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~v--a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      |||++  |=|+|+-.++|-.|+ ++|++|+.+.
T Consensus         1 mKVvlVTGas~GIG~aiA~~la-~~Ga~V~i~~   32 (255)
T 2dkn_A            1 MSVIAITGSASGIGAALKELLA-RAGHTVIGID   32 (255)
T ss_dssp             -CEEEEETTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             9499994887799999999999-8799999997


No 198
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*
Probab=30.14  E-value=24  Score=14.35  Aligned_cols=32  Identities=16%  Similarity=0.346  Sum_probs=25.3

Q ss_pred             CCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             388999-960985799999999886984999998
Q gi|254780151|r   20 DMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        20 ~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      .+||+| |=||++-+.++..||+ +||+|+++.=
T Consensus         3 ~kkIlV~GatG~iG~~l~~~ll~-~g~~V~~~~R   35 (206)
T 1hdo_A            3 VKKIAIFGATGQTGLTTLAQAVQ-AGYEVTVLVR   35 (206)
T ss_dssp             CCEEEEESTTSHHHHHHHHHHHH-TTCEEEEEES
T ss_pred             CCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEEC
T ss_conf             88899999986899999999997-8698999984


No 199
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis}
Probab=29.59  E-value=24  Score=14.28  Aligned_cols=32  Identities=16%  Similarity=0.278  Sum_probs=22.3

Q ss_pred             CCEEEEE---ECCCHHHHH--HHHHHHHCCCEEEEEE
Q ss_conf             3889999---609857999--9999988698499999
Q gi|254780151|r   20 DMRVVVA---MSGGVDSSV--VAALLKRDGYDVIGVT   51 (408)
Q Consensus        20 ~~kV~va---~SGGVDSsv--aa~lL~~~G~~V~g~~   51 (408)
                      +|||++-   -.||+--.+  .|.-|.++||+|+-++
T Consensus        15 kMKI~iv~~P~~GG~~~~~~~La~~L~~~Gh~V~vit   51 (394)
T 2jjm_A           15 KLKIGITCYPSVGGSGVVGTELGKQLAERGHEIHFIT   51 (394)
T ss_dssp             CCEEEEECCC--CHHHHHHHHHHHHHHHTTCEEEEEC
T ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             4779998999999599999999999997799899994


No 200
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT}
Probab=29.48  E-value=24  Score=14.27  Aligned_cols=30  Identities=20%  Similarity=0.412  Sum_probs=22.6

Q ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8899996098579999999988698499999
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +||+|.=+|=+-+.++..|++ +||+|+++.
T Consensus         4 ~kiLItGaG~iG~~l~~~L~~-~g~~V~~~~   33 (286)
T 3gpi_A            4 SKILIAGCGDLGLELARRLTA-QGHEVTGLR   33 (286)
T ss_dssp             CCEEEECCSHHHHHHHHHHHH-TTCCEEEEE
T ss_pred             CEEEEECCCHHHHHHHHHHHH-CCCEEEEEE
T ss_conf             879998945999999999997-859899997


No 201
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural genomics, joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413}
Probab=28.80  E-value=25  Score=14.19  Aligned_cols=56  Identities=18%  Similarity=0.195  Sum_probs=35.0

Q ss_pred             CCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             38899-99609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   20 DMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        20 ~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ..+|+ ||---|..+    ..|.+.|++|+|+=+                ++..++.|++.+...+|.++..|+.+.
T Consensus        57 ~~~vLDvGCG~G~~~----~~la~~g~~v~gvD~----------------s~~~i~~Ar~~~~~~~~~~~~~d~~~~  113 (245)
T 3ggd_A           57 ELPLIDFACGNGTQT----KFLSQFFPRVIGLDV----------------SKSALEIAAKENTAANISYRLLDGLVP  113 (245)
T ss_dssp             TSCEEEETCTTSHHH----HHHHHHSSCEEEEES----------------CHHHHHHHHHHSCCTTEEEEECCTTCH
T ss_pred             CCEEEEECCCCCHHH----HHHHCCCCEEEEEEC----------------CHHHHHHHHHHCCCCCEEEEEEECCCC
T ss_conf             985899758797879----997637845998509----------------999999999867467506999501365


No 202
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis}
Probab=28.60  E-value=25  Score=14.17  Aligned_cols=98  Identities=14%  Similarity=0.156  Sum_probs=57.3

Q ss_pred             EEEEEECCCHHHHHHHHH--HHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHH
Q ss_conf             899996098579999999--988698499999870478766555577881899999999999809958981707886632
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAAL--LKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNA   99 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~l--L~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~   99 (408)
                      .-++++|.|. +++++.+  |.+.|-+|+..-               ++......-.++.+..+||....+|..+.    
T Consensus        97 ~~a~~~sSGm-aAI~~~l~~l~~~Gd~iv~~~---------------~~Yggt~~~~~~~l~~~gi~~~~vd~~d~----  156 (414)
T 3ndn_A           97 PAAFATASGM-AAVFTSLGALLGAGDRLVAAR---------------SLFGSCFVVCSEILPRWGVQTVFVDGDDL----  156 (414)
T ss_dssp             SEEEEESSHH-HHHHHHHHTTCCTTCEEEEES---------------CCCHHHHHHHHTHHHHTTCEEEEECTTCH----
T ss_pred             CEEEEECCHH-HHHHHHHHHHCCCCCEEEEEC---------------CCHHHHHHHHHHHCCCCCEEEEEECCCCH----
T ss_conf             8399945899-999999998606899899826---------------86134599986421067759998679876----


Q ss_pred             CCCCCHHHHHCCCCCCCEE-C----CCCEEE---HHHHHHHHCCCCCCEECCCC
Q ss_conf             2441126787088612000-0----154110---58888874016876452253
Q gi|254780151|r  100 VIVPFASSYAAGETPLPCV-D----CNRTVK---FSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       100 V~~~~~~~y~~G~TPNPc~-~----CN~~iK---F~~l~~~a~~~g~~~iATGH  145 (408)
                            +..++-.+||..+ .    .|+.++   +.++.+.|++.|+-.|.--.
T Consensus       157 ------~~~~~~i~~~t~lI~~EspsNP~l~v~Di~~i~~iA~~~g~~~vVDNT  204 (414)
T 3ndn_A          157 ------SQWERALSVPTQAVFFETPSNPMQSLVDIAAVTELAHAAGAKVVLDNV  204 (414)
T ss_dssp             ------HHHHHHTSSCCSEEEEESSCTTTCCCCCHHHHHHHHHHTTCEEEEECT
T ss_pred             ------HHHHHHHCCCCEEEEECCCCCCCEECCCHHHHHHHHHHCCCEEEEECC
T ss_conf             ------789976341445999458889742126709999999981997999788


No 203
>2o7s_A DHQ-SDH, bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase; NADPH, dehydroshikimate, bifunctional enzyme, oxidoreductase; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A*
Probab=28.59  E-value=25  Score=14.17  Aligned_cols=35  Identities=14%  Similarity=0.271  Sum_probs=17.3

Q ss_pred             CEEEEEECCC-HHHHHHHH-HHHHCCCEEEEEEEECC
Q ss_conf             8899996098-57999999-99886984999998704
Q gi|254780151|r   21 MRVVVAMSGG-VDSSVVAA-LLKRDGYDVIGVTLQLY   55 (408)
Q Consensus        21 ~kV~va~SGG-VDSsvaa~-lL~~~G~~V~g~~m~~~   55 (408)
                      ..|.|-+.|- .|..+..+ .+++.|-|++=+-+.+|
T Consensus         5 ~~icvpl~~~~~~e~~~~~~~~~~~gaD~vElR~D~l   41 (523)
T 2o7s_A            5 SLICAPVMADSIDKMVIETSKAHELGADLVEIRLDWL   41 (523)
T ss_dssp             CEEEEEECCSSHHHHHHHHHHHHHHTCSEEEEEGGGC
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHCCCCEEEEEEECC
T ss_conf             8899995889999999999997644999899985023


No 204
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, PSI-2; 2.30A {Staphylococcus aureus subsp}
Probab=28.42  E-value=25  Score=14.15  Aligned_cols=30  Identities=13%  Similarity=0.177  Sum_probs=24.0

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             3889999609857999999998869849999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      .|||+|-=.|.+-|.+|++|. ++|++|+.+
T Consensus         2 ~MkI~IiGaGaiG~~~a~~L~-~~G~~Vtl~   31 (294)
T 3g17_A            2 SLSVAIIGPGAVGTTIAYELQ-QSLPHTTLI   31 (294)
T ss_dssp             -CCEEEECCSHHHHHHHHHHH-HHCTTCEEE
T ss_pred             CCEEEEECCCHHHHHHHHHHH-HCCCCEEEE
T ss_conf             998999996899999999999-559927999


No 205
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1, methyltransferase domain, structural genomics; HET: PGE GOL; 2.00A {Clostridium acetobutylicum}
Probab=28.18  E-value=25  Score=14.12  Aligned_cols=59  Identities=17%  Similarity=0.291  Sum_probs=37.9

Q ss_pred             CCCCCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCC--CCEEECCHH
Q ss_conf             86338899-996098579999999988698499999870478766555577881899999999999809--958981707
Q gi|254780151|r   17 NPKDMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTIN--VSHYVFDYE   93 (408)
Q Consensus        17 ~~k~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~Lg--I~~~~~d~~   93 (408)
                      .+++++|+ +|---|..|   ..++.+.|++|+|+=.                +++.++.|++.++..+  +.+...|+.
T Consensus        21 ~~~~~~VLDiGcG~G~~~---~~~~~~~~~~v~gvD~----------------S~~~i~~a~~~~~~~~~~v~~~~~d~~   81 (209)
T 2p8j_A           21 SNLDKTVLDCGAGGDLPP---LSIFVEDGYKTYGIEI----------------SDLQLKKAENFSRENNFKLNISKGDIR   81 (209)
T ss_dssp             SSSCSEEEEESCCSSSCT---HHHHHHTTCEEEEEEC----------------CHHHHHHHHHHHHHHTCCCCEEECCTT
T ss_pred             CCCCCEEEEEECCCCHHH---HHHHHHCCCEEEEEEC----------------CHHHHHHHHHHHHCCCCEEEEECCEEE
T ss_conf             069898999727889999---9999858998999959----------------799999998622035743653002022


Q ss_pred             H
Q ss_conf             8
Q gi|254780151|r   94 E   94 (408)
Q Consensus        94 ~   94 (408)
                      +
T Consensus        82 ~   82 (209)
T 2p8j_A           82 K   82 (209)
T ss_dssp             S
T ss_pred             C
T ss_conf             3


No 206
>3nrb_A Formyltetrahydrofolate deformylase; N-terminal ACT domain, structural genomics, joint center for structural genomics, JCSG; HET: MSE FLC; 2.05A {Pseudomonas putida}
Probab=27.83  E-value=26  Score=14.08  Aligned_cols=70  Identities=14%  Similarity=0.210  Sum_probs=39.1

Q ss_pred             CCCEEEEEECC----CHHHHHHHHHHHHCCCEEEE-----------EEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             33889999609----85799999999886984999-----------9987047876655557788189999999999980
Q gi|254780151|r   19 KDMRVVVAMSG----GVDSSVVAALLKRDGYDVIG-----------VTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI   83 (408)
Q Consensus        19 k~~kV~va~SG----GVDSsvaa~lL~~~G~~V~g-----------~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~L   83 (408)
                      ++++.++-+|+    |+=++|+-+|.+ .|.+++-           +|||.-...+      .+.-++--+....+|+.+
T Consensus         4 ~~~~~ILt~~CpD~~GIVa~vs~~l~~-~g~NI~~~~q~~D~~~~~FFmRi~f~~~------~~~~~~l~~~~~~~a~~~   76 (287)
T 3nrb_A            4 KNNQYVLSLACQDAPGIVSEVSTFLFN-NGANIVEAEQFNDEDSSKFFMRVSVEIP------VAGVNDFNSAFGKVVEKY   76 (287)
T ss_dssp             CTTEEEEEEEEECCTTHHHHHHHHHHH-TTCEEEEEEEEEETTTTEEEEEEEEECC------C---CHHHHHHHHHHGGG
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHHHH-CCCCEEECCCCCCCCCCEEEEEEEEECC------CCCHHHHHHHHHHHHHHH
T ss_conf             887699999899988659999999997-8998827405348999808999999758------899899999999988652


Q ss_pred             CCCEEECCHHHH
Q ss_conf             995898170788
Q gi|254780151|r   84 NVSHYVFDYEER   95 (408)
Q Consensus        84 gI~~~~~d~~~~   95 (408)
                      +..+.+.+..+.
T Consensus        77 ~m~~~~~~~~~k   88 (287)
T 3nrb_A           77 NAEWWFRPRTDR   88 (287)
T ss_dssp             TCEEEEEETTCC
T ss_pred             CCEEEECCCCCC
T ss_conf             200233364568


No 207
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4}
Probab=27.78  E-value=26  Score=14.07  Aligned_cols=34  Identities=24%  Similarity=0.162  Sum_probs=24.4

Q ss_pred             CCCCCCEEEEEECCCHH-HHHHHHHHHHCCCEEEEE
Q ss_conf             88633889999609857-999999998869849999
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVD-SSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVD-Ssvaa~lL~~~G~~V~g~   50 (408)
                      ++-+.|||.+-=-||.- |++ |.+|+++|++|.|-
T Consensus        15 ~~~~g~~ih~iGigg~Gms~l-A~~l~~~G~~V~gs   49 (524)
T 3hn7_A           15 LYFQGMHIHILGICGTFMGSL-ALLARALGHTVTGS   49 (524)
T ss_dssp             ----CCEEEEETTTSHHHHHH-HHHHHHTTCEEEEE
T ss_pred             HCCCCCEEEEEEECHHHHHHH-HHHHHHCCCEEEEE
T ss_conf             005798899996688889999-99999688969999


No 208
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus HB8} PDB: 1x1e_A* 2ekq_A
Probab=27.50  E-value=26  Score=14.04  Aligned_cols=29  Identities=24%  Similarity=0.436  Sum_probs=21.2

Q ss_pred             EEE-EEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             899-996098579999999988698499999
Q gi|254780151|r   22 RVV-VAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        22 kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +++ .|=|+|+-.++|-.|+ ++|++|+.+.
T Consensus         4 ~alVTGas~GIG~a~a~~la-~~Ga~V~~~~   33 (239)
T 2ekp_A            4 KALVTGGSRGIGRAIAEALV-ARGYRVAIAS   33 (239)
T ss_dssp             EEEEETTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             EEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             89997796689999999999-8799999997


No 209
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2
Probab=27.31  E-value=12  Score=16.40  Aligned_cols=116  Identities=15%  Similarity=0.214  Sum_probs=67.8

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEE
Q ss_conf             99999999980995898170788663224411267870886120000154110588888740168764522531102541
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLY  152 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~  152 (408)
                      ++.-++.|+.+||.++.+.+.+.=                            .-.-|++..++++.|-=.+|=-.+.-. 
T Consensus        51 v~~K~k~a~~~Gi~~~~~~l~~~~----------------------------s~~el~~~I~~LN~D~~V~GIlVQlPL-  101 (288)
T 1b0a_A           51 VASKRKACEEVGFVSRSYDLPETT----------------------------SEAELLELIDTLNADNTIDGILVQLPL-  101 (288)
T ss_dssp             HHHHHHHHHHHTCEECCEEECTTC----------------------------CHHHHHHHHHHHHTCTTCCEEEECSSC-
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCC----------------------------CHHHHHHHHHHHHCCCCCCEEEEECCC-
T ss_conf             999999998659659999789999----------------------------999999999998479864548985699-


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEECCCCCC---CHHHHHHHHHHCCCCCCCHHHCCCEEECCCCC
Q ss_conf             2678773168853157878731898630202210033425689---97898999974125435511102301112775
Q gi|254780151|r  153 VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM---KKESVRDLAREMGLDIADKSDSQDICFVQQGK  227 (408)
Q Consensus       153 ~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~FPlg~~---~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~  227 (408)
                        .++-....++.+.++.||    .=+++..-+.++...--.+   |-.-|-++.+.++++..    -..+|-||+..
T Consensus       102 --P~~i~~~~i~~~I~p~KD----VDGl~~~n~g~l~~~~~~~~PcTp~av~~ll~~~~i~~~----Gk~vvViGrS~  169 (288)
T 1b0a_A          102 --PAGIDNVKVLERIHPDKD----VDGFHPYNVGRLCQRAPRLRPCTPRGIVTLLERYNIDTF----GLNAVVIGASN  169 (288)
T ss_dssp             --CTTSCHHHHHTTSCTTTC----TTCCSHHHHHHHHTTCCSSCCHHHHHHHHHHHHTTCCCT----TCEEEEECCCT
T ss_pred             --CCCCCHHHHHHCCCCCCC----HHCCCHHHHCEECCCCCCCCCCCHHHHHHHHHHHCCCCC----CCEEEEECCCC
T ss_conf             --864310332104687767----300671110201168764367778999999997334658----98789954555


No 210
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, protein structure initiative, midwest center for structural genomics; HET: MSE NAP; 2.79A {Bacillus subtilis}
Probab=27.23  E-value=26  Score=14.00  Aligned_cols=31  Identities=16%  Similarity=0.279  Sum_probs=24.6

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             33889999609857999999998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +.|||+| +-|+-=+..+|..|.++|++|.-.
T Consensus         6 ~GmkIaV-iGgd~r~~~la~~L~~~G~~V~v~   36 (300)
T 2rir_A            6 TGLKIAV-IGGDARQLEIIRKLTEQQADIYLV   36 (300)
T ss_dssp             CSCEEEE-ESBCHHHHHHHHHHHHTTCEEEEE
T ss_pred             CCCEEEE-ECCCHHHHHHHHHHHHCCCEEEEE
T ss_conf             7988999-888889999999999789959999


No 211
>2hig_A 6-phospho-1-fructokinase; transferase; 2.40A {Trypanosoma brucei} PDB: 3f5m_A*
Probab=27.12  E-value=26  Score=13.99  Aligned_cols=74  Identities=16%  Similarity=0.258  Sum_probs=45.8

Q ss_pred             CCCCCEEEEEECCC----HHHHHHHHH---HH-HCCCEEEEEEEECCCC---C--C---------------CCCCCCCCC
Q ss_conf             86338899996098----579999999---98-8698499999870478---7--6---------------655557788
Q gi|254780151|r   17 NPKDMRVVVAMSGG----VDSSVVAAL---LK-RDGYDVIGVTLQLYNS---R--K---------------ASKRKGSCC   68 (408)
Q Consensus        17 ~~k~~kV~va~SGG----VDSsvaa~l---L~-~~G~~V~g~~m~~~~~---~--~---------------~~~~~~~c~   68 (408)
                      .|+++||.|--|||    .-+++.+..   +. ..|.+|.|+.--+..-   +  .               -...-++|.
T Consensus        94 ~p~~~rIgIltsGGdaPGmNavIr~vv~~a~~~~~~~~V~Gi~~G~~GLi~~~~~~~~~L~~~~v~~i~~~GGtiLGTsR  173 (487)
T 2hig_A           94 NPTETTIGIVTCGGICPGLNDVIRSITLTGINVYNVKRVIGFRFGYWGLSKKGSQTAIELHRGRVTNIHHYGGTILGSSR  173 (487)
T ss_dssp             CGGGCEEEEEECSSCCTTHHHHHHHHHHHHHHHHCCSEEEECSTGGGGGSHHHHTTCEEECHHHHTTGGGSSSCSSCCCC
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCCEEEEECCHHHHHHCCCCCCCCCCCHHHHHHHHHCCCCEECCCC
T ss_conf             88885899988578847689999999999999659938999841148860599754101899998408856970612589


Q ss_pred             CHHHHHHHHHHHHHCCCCEEEC
Q ss_conf             1899999999999809958981
Q gi|254780151|r   69 AGQDVYDARRVCDTINVSHYVF   90 (408)
Q Consensus        69 ~~~d~~~a~~va~~LgI~~~~~   90 (408)
                      .+++.+.+.+..++++|...++
T Consensus       174 ~~e~~~~i~~~L~~~~Id~Liv  195 (487)
T 2hig_A          174 GPQDPKEMVDTLERLGVNILFT  195 (487)
T ss_dssp             SCCCHHHHHHHHHHHTCSEEEE
T ss_pred             CCCCHHHHHHHHHHHCCCEEEE
T ss_conf             9856999999999849987999


No 212
>1sau_A Sulfite reductase, desulfoviridin-type subunit gamma; orthogonal helical bundle, oxidoreductase; 1.12A {Archaeoglobus fulgidus dsm 4304} PDB: 2a5w_A
Probab=27.10  E-value=8.9  Score=17.36  Aligned_cols=44  Identities=16%  Similarity=0.228  Sum_probs=30.7

Q ss_pred             CHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC-CCCCC
Q ss_conf             189999999999980995898170788663224411267870-88612
Q gi|254780151|r   69 AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA-GETPL  115 (408)
Q Consensus        69 ~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~-G~TPN  115 (408)
                      |.+++  |+.+|+.+|+.-.-+.+.++-|+ |+..+-+-|.+ |..|+
T Consensus        25 W~e~v--A~~lA~~~~~~~e~I~Lt~~Hw~-vI~~lR~~y~~~~~~P~   69 (115)
T 1sau_A           25 WDEEV--AEALAKDTRFSPQPIELTEEHWK-IIRYLRDYFIKYGVAPP   69 (115)
T ss_dssp             CCHHH--HHHHHTCTTSCSSCCCCCHHHHH-HHHHHHHHHHHHSSCCC
T ss_pred             CCHHH--HHHHHHHCCCCCCCCCCCHHHHH-HHHHHHHHHHHHCCCCC
T ss_conf             79999--99999843566457602799999-99999999999689973


No 213
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.15A {Porphyromonas gingivalis W83}
Probab=27.02  E-value=26  Score=13.98  Aligned_cols=36  Identities=22%  Similarity=0.191  Sum_probs=26.3

Q ss_pred             CCCCCCCCEEEEEECCCHHHHHHHHHHHHCC------CEEEEE
Q ss_conf             7888633889999609857999999998869------849999
Q gi|254780151|r   14 LDKNPKDMRVVVAMSGGVDSSVVAALLKRDG------YDVIGV   50 (408)
Q Consensus        14 ~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G------~~V~g~   50 (408)
                      ..++.+.|||+|.=.|.+-|.+|++|.+ +|      ++|+-+
T Consensus         2 ~~~~~~~MkI~IlGaGaiG~~~a~~L~~-~g~~~~~~~~Vt~i   43 (317)
T 2qyt_A            2 NAMNQQPIKIAVFGLGGVGGYYGAMLAL-RAAATDGLLEVSWI   43 (317)
T ss_dssp             -----CCEEEEEECCSHHHHHHHHHHHH-HHHHTTSSEEEEEE
T ss_pred             CCCCCCCCEEEEECCCHHHHHHHHHHHH-CCCCCCCCEEEEEE
T ss_conf             9878999989999968999999999998-59988875167999


No 214
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A*
Probab=27.00  E-value=26  Score=13.98  Aligned_cols=90  Identities=14%  Similarity=0.229  Sum_probs=47.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH---HH--
Q ss_conf             9999609857999999998869849999-98704787665555778818999999999998099589817078---86--
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE---RF--   96 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~---~f--   96 (408)
                      +++|--|-=-|.+|.-|.++-+.+|+.+ -|+.|-+-+.....   .+         ..+.-|||||.+|+.+   +|  
T Consensus         6 ~i~G~TgsGKS~Lai~LA~~~~geIIsaDSmQvYkgldI~TaK---~t---------~~E~~~vpHhli~~~~~~~~~~v   73 (409)
T 3eph_A            6 VIAGTTGVGKSQLSIQLAQKFNGEVINSDSMQVYKDIPIITNK---HP---------LQEREGIPHHVMNHVDWSEEYYS   73 (409)
T ss_dssp             EEEECSSSSHHHHHHHHHHHHTEEEEECCTTTTBSSCTTTTTC---CC---------GGGTTTCCEESCSCBCTTSCCCH
T ss_pred             EEECCCHHHHHHHHHHHHHHCCCEEECCCHHHHHCCCCEEECC---CC---------HHHHHCCCEEEECCCCCCCCCCH
T ss_conf             9989760449999999999879989810188761999757789---99---------99991899603524489987379


Q ss_pred             ---HHHCCCCCHHHHHCCCCCCCEECCCCEE
Q ss_conf             ---6322441126787088612000015411
Q gi|254780151|r   97 ---RNAVIVPFASSYAAGETPLPCVDCNRTV  124 (408)
Q Consensus        97 ---~~~V~~~~~~~y~~G~TPNPc~~CN~~i  124 (408)
                         .+.+..-.-+-..+|.+|-=+-..+-+|
T Consensus        74 ~~F~~~a~~~i~~i~~rgk~PIiVGGT~~Yi  104 (409)
T 3eph_A           74 HRFETECMNAIEDIHRRGKIPIVVGGTHYYL  104 (409)
T ss_dssp             HHHHHHHHHHHHHHHTTTCEEEEECSCGGGG
T ss_pred             HHHHHHHHHHHHHHHHCCCCEEEECCCCHHH
T ss_conf             9999999999999986289659988821799


No 215
>2ppw_A Conserved domain protein; the putative RPIB, PSI-2, protein structure initiative, MCSG, structural genomics; HET: MSE; 2.01A {Streptococcus pneumoniae TIGR4}
Probab=26.92  E-value=27  Score=13.97  Aligned_cols=34  Identities=12%  Similarity=0.390  Sum_probs=22.7

Q ss_pred             CCCEEEEEE-CCCHHHH--HHHHH---HHHCCCEEEEEEE
Q ss_conf             338899996-0985799--99999---9886984999998
Q gi|254780151|r   19 KDMRVVVAM-SGGVDSS--VVAAL---LKRDGYDVIGVTL   52 (408)
Q Consensus        19 k~~kV~va~-SGGVDSs--vaa~l---L~~~G~~V~g~~m   52 (408)
                      +.|||+++. +.|.+..  +...|   |.++||+|+-+-|
T Consensus         2 ~~MKIal~~d~s~~~~n~~I~e~Lk~~l~~~G~eV~D~G~   41 (216)
T 2ppw_A            2 NAMKIALINENSQASKNHIIYDSLKEATDKKGYQLFNYGM   41 (216)
T ss_dssp             -CCEEEECCCTTTGGGHHHHHHHHHHHHHHHTCEEEECSC
T ss_pred             CCCEEEEECCCCCHHHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             9717998656501668999999999999867998996578


No 216
>3imf_A Short chain dehydrogenase; structural genomics, infectious diseases, center for structural genomics of infectious diseases, oxidoreductase; HET: MSE; 1.99A {Bacillus anthracis str}
Probab=26.45  E-value=27  Score=13.91  Aligned_cols=34  Identities=18%  Similarity=0.302  Sum_probs=24.0

Q ss_pred             CCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             863388999-96098579999999988698499999
Q gi|254780151|r   17 NPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        17 ~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +-|++.++| |=|+|+-.++|-.|+ ++|++|+...
T Consensus         3 sLk~KvalITGas~GIG~aia~~la-~~Ga~V~i~~   37 (257)
T 3imf_A            3 AMKEKVVIITGGSSGMGKGMATRFA-KEGARVVITG   37 (257)
T ss_dssp             TTTTCEEEETTTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             7584989993898789999999999-8799899997


No 217
>3nvq_A Semaphorin-7A; beta-propeller, signaling, signaling protein-protein binding; HET: NAG NDG; 2.40A {Homo sapiens}
Probab=26.09  E-value=27  Score=13.86  Aligned_cols=21  Identities=14%  Similarity=0.227  Sum_probs=11.9

Q ss_pred             CCCEEEECCCCCCEEEEECCC
Q ss_conf             861376317553125652355
Q gi|254780151|r  276 EPLFVVYLDKNSSRVIVGPRE  296 (408)
Q Consensus       276 eP~YVv~id~~~N~ViVg~~~  296 (408)
                      +|.--..++.+...++|+...
T Consensus       419 ~~I~~l~l~~~~~~LyV~s~~  439 (590)
T 3nvq_A          419 AAIQTMSLDAERRKLYVSSQW  439 (590)
T ss_dssp             CCCCEEEEETTTTEEEEECSS
T ss_pred             CCEEEEEECCCCCEEEEEECC
T ss_conf             610346983789889999897


No 218
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A*
Probab=26.09  E-value=27  Score=13.86  Aligned_cols=28  Identities=21%  Similarity=0.339  Sum_probs=21.4

Q ss_pred             CEEEEE-ECCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             889999-60985799999999886984999
Q gi|254780151|r   21 MRVVVA-MSGGVDSSVVAALLKRDGYDVIG   49 (408)
Q Consensus        21 ~kV~va-~SGGVDSsvaa~lL~~~G~~V~g   49 (408)
                      |||.|- =+|++-+++|. .|.++||+|+-
T Consensus         1 MkI~iigGaG~iG~alA~-~la~~G~~V~l   29 (212)
T 1jay_A            1 MRVALLGGTGNLGKGLAL-RLATLGHEIVV   29 (212)
T ss_dssp             CEEEEETTTSHHHHHHHH-HHHTTTCEEEE
T ss_pred             CEEEEEECCHHHHHHHHH-HHHHCCCEEEE
T ss_conf             979999484599999999-99988998999


No 219
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2
Probab=25.76  E-value=28  Score=13.82  Aligned_cols=64  Identities=11%  Similarity=0.064  Sum_probs=37.5

Q ss_pred             CCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             3388999-9609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   19 KDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        19 k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      ++.||+| |=+|-+-|.++..|++ +||+|+++. +.  ....        ..+ ..+...-....++.+...|+.+.
T Consensus         3 ~k~KILVtGatG~iG~~l~~~L~~-~g~~V~~l~-R~--~~~~--------~~~-~~~~~~~~~~~~v~~v~~D~~~~   67 (313)
T 1qyd_A            3 KKSRVLIVGGTGYIGKRIVNASIS-LGHPTYVLF-RP--EVVS--------NID-KVQMLLYFKQLGAKLIEASLDDH   67 (313)
T ss_dssp             CCCCEEEESTTSTTHHHHHHHHHH-TTCCEEEEC-CS--CCSS--------CHH-HHHHHHHHHTTTCEEECCCSSCH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHH-CCCEEEEEE-CC--CCCC--------CHH-HHHHHHHHCCCCCEEEEEECCCC
T ss_conf             999899989984899999999997-889699998-99--7435--------656-67777652048968999642110


No 220
>3bwx_A Alpha/beta hydrolase; YP_496220.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.50A {Novosphingobium aromaticivorans DSM12444}
Probab=25.65  E-value=28  Score=13.81  Aligned_cols=66  Identities=12%  Similarity=0.059  Sum_probs=36.0

Q ss_pred             CCEEEEEECCCHHHHHH----HHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             38899996098579999----99998869849999987047876655557788189999999999980995
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVV----AALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus        20 ~~kV~va~SGGVDSsva----a~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      ....+|.+-|.-+|+-.    +..| .+||.|+.+-++-+...+...........+...+...+.++||++
T Consensus        28 ~~p~vv~lHG~~~~~~~~~~~~~~L-~~~~~vi~~D~~G~G~S~~~~~~~~~~~~~~~~~l~~~~~~l~~~   97 (285)
T 3bwx_A           28 SRPPVLCLPGLTRNARDFEDLATRL-AGDWRVLCPEMRGRGDSDYAKDPMTYQPMQYLQDLEALLAQEGIE   97 (285)
T ss_dssp             TSCCEEEECCTTCCGGGGHHHHHHH-BBTBCEEEECCTTBTTSCCCSSGGGCSHHHHHHHHHHHHHHHTCC
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             9984999899988888999999998-279889998389998777887655567999999999999983999


No 221
>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3- epimerase, D-tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima}
Probab=25.62  E-value=28  Score=13.80  Aligned_cols=113  Identities=15%  Similarity=0.165  Sum_probs=60.2

Q ss_pred             CCCCCCCCCCCEEEEEEC--CCH-H-------HHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             346788863388999960--985-7-------999999998869849999987047876655557788189999999999
Q gi|254780151|r   11 SLDLDKNPKDMRVVVAMS--GGV-D-------SSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC   80 (408)
Q Consensus        11 ~~~~~~~~k~~kV~va~S--GGV-D-------Ssvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va   80 (408)
                      ++++--..++||.-...|  ++. |       -.=+..++++.||+-+-+.+  ++.           ...+++..++.+
T Consensus        11 ~~~~~~~~~~~k~~~~~~~~~~~~~~~~~~~~l~~~l~~ak~~Gfd~VEl~~--~~~-----------~~~~~~~lk~~l   77 (290)
T 2zvr_A           11 SSGLVPRGSHMKLSLVISTSDAAFDALAFKGDLRKGMELAKRVGYQAVEIAV--RDP-----------SIVDWNEVKILS   77 (290)
T ss_dssp             ----------CEEEEEECCCC-------CHHHHHHHHHHHHHHTCSEEEEEC--SCG-----------GGSCHHHHHHHH
T ss_pred             CCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHHCCCEEEECC--CCC-----------CCCCHHHHHHHH
T ss_conf             6687788777179997214777766433577999999999985999999788--894-----------617899999999


Q ss_pred             HHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCC
Q ss_conf             9809958981707886632244112678708861200001541105888887401687645225
Q gi|254780151|r   81 DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG  144 (408)
Q Consensus        81 ~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATG  144 (408)
                      +..|++.-.+.....+...-+.        =..|+|.++=...-.+...++.|..+|+..|..+
T Consensus        78 ~~~gL~v~s~~~~~~~~~~~~~--------~~~~d~~~r~~~i~~~~~~i~~a~~lG~~~i~~~  133 (290)
T 2zvr_A           78 EELNLPICAIGTGQAYLADGLS--------LTHPNDEIRKKAIERVVKHTEVAGMFGALVIIGL  133 (290)
T ss_dssp             HHHTCCEEEEECTHHHHTTCCC--------TTCSSHHHHHHHHHHHHHHHHHHHHHTCEEEESG
T ss_pred             HHCCCEEEEEECCCCCCCCCCC--------CCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEC
T ss_conf             9839908998456210247777--------7897999999999999999999997399379956


No 222
>2g0w_A LMO2234 protein; putative sugar isomerase, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE PG4; 1.70A {Listeria monocytogenes} SCOP: c.1.15.4
Probab=25.35  E-value=28  Score=13.77  Aligned_cols=86  Identities=20%  Similarity=0.270  Sum_probs=46.8

Q ss_pred             HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCC
Q ss_conf             99999886984999998704787665555778818999999999998099589817078866322441126787088612
Q gi|254780151|r   36 VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPL  115 (408)
Q Consensus        36 aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPN  115 (408)
                      ++.+.++.||+-+.+....+..  ....      ....++.++..+..||....++....|        .       .| 
T Consensus        41 ~l~~aae~GfdgVEl~~~~~~~--~~~~------~~~~~~l~~~l~~~GL~i~~i~~~~~~--------~-------~~-   96 (296)
T 2g0w_A           41 RVKVAAENGFDGIGLRAENYVD--ALAA------GLTDEDMLRILDEHNMKVTEVEYITQW--------G-------TA-   96 (296)
T ss_dssp             HHHHHHHTTCSEEEEEHHHHHH--HHHT------TCCHHHHHHHHHHTTCEEEEEECBCCC--------S-------ST-
T ss_pred             HHHHHHHHCCCEEEECCCCCCC--CCCC------CCCHHHHHHHHHHCCCEEEEEECCCCC--------C-------CC-
T ss_conf             9999999697999974532300--0446------899999999999719979998655455--------7-------87-


Q ss_pred             CEECCCCEEEHHHHHHHHCCCCCCEECCCC
Q ss_conf             000015411058888874016876452253
Q gi|254780151|r  116 PCVDCNRTVKFSDLLSVTRQLGADVLATGH  145 (408)
Q Consensus       116 Pc~~CN~~iKF~~l~~~a~~~g~~~iATGH  145 (408)
                      +...-...-.+...++.|.++|+..|.+|.
T Consensus        97 ~~~~~~~~~~~~~~i~~a~~lg~~~v~~~~  126 (296)
T 2g0w_A           97 EDRTAEQQKKEQTTFHMARLFGVKHINCGL  126 (296)
T ss_dssp             TTCCHHHHHHHHHHHHHHHHHTCCEEEECC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCEEEECC
T ss_conf             078999999999999999971999896479


No 223
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthesis, methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A
Probab=25.20  E-value=28  Score=13.75  Aligned_cols=32  Identities=31%  Similarity=0.683  Sum_probs=25.0

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             88999-960985799999999886984999998
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      |||+| |-||=+-|.++-.||++..++|+++-.
T Consensus         1 MKILVTG~sGfIGs~lv~~Ll~~g~~~V~~ld~   33 (345)
T 2bll_A            1 MRVLILGVNGFIGNHLTERLLREDHYEVYGLDI   33 (345)
T ss_dssp             CEEEEETCSSHHHHHHHHHHHHSTTCEEEEEES
T ss_pred             CEEEEECCCCHHHHHHHHHHHHCCCCEEEEEEC
T ss_conf             979998988789999999999779988999958


No 224
>1f60_A Elongation factor EEF1A; protein-protein complex, translation; 1.67A {Saccharomyces cerevisiae} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1g7c_A* 1ije_A* 1ijf_A* 2b7b_A* 2b7c_A
Probab=25.11  E-value=29  Score=13.74  Aligned_cols=24  Identities=29%  Similarity=0.430  Sum_probs=17.7

Q ss_pred             CEEEEEECCCHH---HHHHHHHHHHCC
Q ss_conf             889999609857---999999998869
Q gi|254780151|r   21 MRVVVAMSGGVD---SSVVAALLKRDG   44 (408)
Q Consensus        21 ~kV~va~SGGVD---Ssvaa~lL~~~G   44 (408)
                      ..|=|++-|-||   |++...||.+.|
T Consensus         6 ~~ini~~~GhvD~GKSTl~g~Ll~~~g   32 (458)
T 1f60_A            6 SHINVVVIGHVDSGKSTTTGHLIYKCG   32 (458)
T ss_dssp             EEEEEEEEECTTSCHHHHHHHHHHHHS
T ss_pred             CEEEEEEEECCCCCHHHHHHHHHHHCC
T ss_conf             713999995258888899999999759


No 225
>1bwv_A Rubisco, protein (ribulose bisphosphate carboxylase); carbon dioxide fixation, complex (rubisco/reaction intermediate); HET: KCX CAP; 2.40A {Galdieria partita} SCOP: c.1.14.1 d.58.9.1 PDB: 1iwa_A 1bxn_A
Probab=25.06  E-value=29  Score=13.74  Aligned_cols=36  Identities=25%  Similarity=0.304  Sum_probs=18.6

Q ss_pred             CCCCCCCCCCCCCCEEEEEE----CCCHHHHHHHH-HHHHC
Q ss_conf             44434678886338899996----09857999999-99886
Q gi|254780151|r    8 RLNSLDLDKNPKDMRVVVAM----SGGVDSSVVAA-LLKRD   43 (408)
Q Consensus         8 ~~~~~~~~~~~k~~kV~va~----SGGVDSsvaa~-lL~~~   43 (408)
                      ||.-.+-+-.||+.-|++++    --|||---||. +..||
T Consensus        30 ~~~y~~~~y~~~~~dila~f~~~p~~Gvdpe~aAa~iA~Eq   70 (493)
T 1bwv_A           30 KMGYWNPDYQVKDTDVLALFRVTPQPGVDPIEAAAAVAGES   70 (493)
T ss_dssp             CCCCBCTTCCCCTTCEEEEEEEEECTTCCHHHHHHHHHHHT
T ss_pred             HCCCCCCCCCCCCCEEEEEEEEECCCCCCHHHHHHHHHHCC
T ss_conf             45321899761786489999976799989999999986004


No 226
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1}
Probab=25.00  E-value=29  Score=13.73  Aligned_cols=32  Identities=13%  Similarity=0.137  Sum_probs=24.7

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             633889999609857999999998869849999
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      -+.|||.|-=.|-.-+++|..|+ ++||+|+..
T Consensus        17 ~~~MKIgIIG~G~mG~~lA~~L~-~~G~~V~v~   48 (209)
T 2raf_A           17 FQGMEITIFGKGNMGQAIGHNFE-IAGHEVTYY   48 (209)
T ss_dssp             ---CEEEEECCSHHHHHHHHHHH-HTTCEEEEE
T ss_pred             CCCCEEEEECCHHHHHHHHHHHH-HCCCEEEEE
T ss_conf             37888999884399999999999-779968994


No 227
>1muw_A Xylose isomerase; atomic resolution, disorder; 0.86A {Streptomyces olivochromogenes} SCOP: c.1.15.3 PDB: 1s5m_A* 1s5n_A* 2gyi_A* 1xyb_A* 1xyc_A* 1xya_A* 1xyl_A 1xym_A* 1dxi_A 3gnx_A* 1gw9_A* 1xib_A 1xic_A* 1xid_A* 1xie_A* 1xif_A* 1xig_A* 1xih_A* 1xii_A* 1xij_A ...
Probab=25.00  E-value=20  Score=14.91  Aligned_cols=100  Identities=12%  Similarity=0.075  Sum_probs=52.4

Q ss_pred             HHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHC
Q ss_conf             57999999998869849999987047876655557788189999999999980995898170788663224411267870
Q gi|254780151|r   31 VDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAA  110 (408)
Q Consensus        31 VDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~  110 (408)
                      .|..=++..|.+-|++=+++|    +.+-.......--+++.+...++..+..||.+-... .+.|.+.       .|+.
T Consensus        33 ~~~~d~~~~~~~lG~~~~~fH----d~D~~P~~~~~~e~~~~~~~ik~~l~~~Gl~~~~~T-~nlf~~p-------~~~~  100 (386)
T 1muw_A           33 LDPVETVQRLAELGAHGVTFH----DDDLIPFGSSDTERESHIKRFRQALDATGMTVPMAT-TNLFTHP-------VFKD  100 (386)
T ss_dssp             CCHHHHHHHHHHHTCCEEEEE----HHHHSCTTCCHHHHHHHHHHHHHHHHHHTCBCCEEE-CCCSSSG-------GGTT
T ss_pred             CCHHHHHHHHHHHCCCEEEEC----CCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCEEC-CCCCCCC-------CCCC
T ss_conf             898999999998199879737----775688899857779999999999996398421303-5324685-------5357


Q ss_pred             C--CCCCCEECCCCEEEHHHHHHHHCCCCCCEEC
Q ss_conf             8--8612000015411058888874016876452
Q gi|254780151|r  111 G--ETPLPCVDCNRTVKFSDLLSVTRQLGADVLA  142 (408)
Q Consensus       111 G--~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iA  142 (408)
                      |  ..|+|.++--..=+....++.|.++|+..+.
T Consensus       101 Ga~TspD~~vR~~Ai~~vk~aidiAa~LGa~~vv  134 (386)
T 1muw_A          101 GGFTANDRDVRRYALRKTIRNIDLAVELGAKTYV  134 (386)
T ss_dssp             CSTTCSSHHHHHHHHHHHHHHHHHHHHHTCSEEE
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCEEE
T ss_conf             8778959999999999999999999994998489


No 228
>3btn_A Antizyme inhibitor 1; TIM-like A/B barrel domain and A sheet domain, structural genomics, israel structural proteomics center, ISPC; 2.05A {Mus musculus}
Probab=24.94  E-value=29  Score=13.72  Aligned_cols=51  Identities=10%  Similarity=0.117  Sum_probs=24.6

Q ss_pred             HHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCE
Q ss_conf             9980995898170788663224411267870886120000154110588888740168764
Q gi|254780151|r   80 CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV  140 (408)
Q Consensus        80 a~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~  140 (408)
                      ...+|+-+.+....|-.         ...+.|..|...+ +|.-.|-...+++|.+.|...
T Consensus        80 l~~~G~G~DvaS~~El~---------~al~~G~~~~~Ii-f~gp~Ks~~~l~~A~~~Gv~~  130 (448)
T 3btn_A           80 LAALGTGFACSSKNEMA---------LVQELGVSPENII-FTSPCKQVSQIKYAAKVGVNI  130 (448)
T ss_dssp             HHHHTCEEEESSHHHHH---------HHHHTTCCGGGEE-ECCSSCCHHHHHHHHHHTCCE
T ss_pred             HHHCCCCEEEECHHHHH---------HHHHCCCCCCCEE-ECCCCCCHHHHHHHHHCCCCE
T ss_conf             99819939997999999---------9998696900299-908989999999999869975


No 229
>2qn6_A Translation initiation factor 2 gamma subunit; initiation of translation, GTP-binding, nucleotide-binding, protein biosynthesis; HET: GDP; 2.15A {Sulfolobus solfataricus P2} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 2aho_A 2qmu_A* 2plf_A* 3i1f_A* 3cw2_A 2pmd_A*
Probab=24.23  E-value=30  Score=13.63  Aligned_cols=51  Identities=18%  Similarity=0.242  Sum_probs=29.6

Q ss_pred             CCCCCEEEEE-EECCEEEEEECCCCCCCCCCE-EEEEECCCCCCCEEEEEEEEC
Q ss_conf             7887008999-829979999759720006963-899973888665888768971
Q gi|254780151|r  333 SQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQ-ACVFYTSDSNEARVLGGGIIS  384 (408)
Q Consensus       333 ~~~pvp~~i~-~~~~~~~V~f~eP~~aiAPGQ-~~VfY~~D~~~~~vLGGGiI~  384 (408)
                      ....++|++. ...+.+.+.|+.|.. +.+|. -.++=+......|-+|+|+|.
T Consensus       361 gt~~~~~~v~~~~~~~vei~l~~Pi~-~~~~~~~~~l~R~i~~~grtig~G~I~  413 (414)
T 2qn6_A          361 GSSTTLGIVTSVKKDEIEVELRRPVA-VWSNNIRTVISRQIAGRWRMIGWGLVE  413 (414)
T ss_dssp             TTEEEEEEEEEECSSEEEEEEEEEEE-CSSSSEEEEEEEEETTEEEEEEEEEEC
T ss_pred             CCCCEEEEEEECCCCEEEEEECCEEE-ECCCCEEEEEECCCCCCCEEEEEEEEE
T ss_conf             44110389997578579999883788-734997999886568895899999997


No 230
>1q77_A Hypothetical protein AQ_178; structural genomics, universal stress protein, PSI, protein structure initiative; 2.70A {Aquifex aeolicus} SCOP: c.26.2.4
Probab=24.11  E-value=30  Score=13.61  Aligned_cols=105  Identities=12%  Similarity=0.153  Sum_probs=55.7

Q ss_pred             CEEEEEECCCHHHHHHH----HHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHH
Q ss_conf             88999960985799999----99988698499999870478766555577881899999999999809958981707886
Q gi|254780151|r   21 MRVVVAMSGGVDSSVVA----ALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERF   96 (408)
Q Consensus        21 ~kV~va~SGGVDSsvaa----~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f   96 (408)
                      +||+|+..|--+|--|+    .+.+..|-+++-++.-                 ++...........+.+.. -+..+++
T Consensus         5 k~ILv~~D~s~~s~~al~~A~~la~~~~a~l~llhv~-----------------~~~~~~~~~~~~~~~~~~-~~~~e~~   66 (138)
T 1q77_A            5 KVLLVLTDAYSDCEKAITYAVNFSEKLGAELDILAVL-----------------EDVYNLERANVTFGLPFP-PEIKEES   66 (138)
T ss_dssp             EEEEEEESTTCCCHHHHHHHHHHHTTTCCEEEEEEEC-----------------HHHHHHHHHHHHHCCCCC-THHHHHH
T ss_pred             CEEEEEECCCHHHHHHHHHHHHHHHHCCCCEEEEEEC-----------------CCCCCCCCCCCCCCCCCC-HHHHHHH
T ss_conf             9999998099899999999999887739845999972-----------------462113210123577641-8899999


Q ss_pred             HH---HCCCCCHHHHHCCCCCCCEECCCCEEEH----HHHHHHHCCCCCCEECCCCCCC
Q ss_conf             63---2244112678708861200001541105----8888874016876452253110
Q gi|254780151|r   97 RN---AVIVPFASSYAAGETPLPCVDCNRTVKF----SDLLSVTRQLGADVLATGHYIR  148 (408)
Q Consensus        97 ~~---~V~~~~~~~y~~G~TPNPc~~CN~~iKF----~~l~~~a~~~g~~~iATGHYar  148 (408)
                      .+   +.++.+++.+.. ..+++.    .++.+    ..+.+++++.++|.|..|.+-+
T Consensus        67 ~~~~~~~l~~~~~~~~~-~~~~~~----~~v~~G~~~~~I~~~a~e~~~DlIVmG~~~~  120 (138)
T 1q77_A           67 KKRIERRLREVWEKLTG-STEIPG----VEYRIGPLSEEVKKFVEGKGYELVVWACYPS  120 (138)
T ss_dssp             HHHHHHHHHHHHHHHHS-CCCCCC----EEEECSCHHHHHHHHHTTSCCSEEEECSCCG
T ss_pred             HHHHHHHHHHHHHHHHC-CCCEEE----EECCCCCHHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             99999999999998423-562278----7313699899999999974999999928998


No 231
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A*
Probab=23.92  E-value=30  Score=13.59  Aligned_cols=100  Identities=14%  Similarity=0.167  Sum_probs=58.1

Q ss_pred             EEEEEECCCHHHHHHHH-HHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHC
Q ss_conf             89999609857999999-99886984999998704787665555778818999999999998099589817078866322
Q gi|254780151|r   22 RVVVAMSGGVDSSVVAA-LLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAV  100 (408)
Q Consensus        22 kV~va~SGGVDSsvaa~-lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~f~~~V  100 (408)
                      .-++++|.|.=-..++. .|.+.|-+|+.-.      +         ...-...-.......+||....+|..+.     
T Consensus        80 ~~a~~~sSGmaAi~~~l~~l~~~Gd~vv~~~------~---------~Yg~t~~~~~~~~~~~Gi~~~~~d~~d~-----  139 (398)
T 2rfv_A           80 EAGLATASGISAITTTLLTLCQQGDHIVSAS------A---------IYGCTHAFLSHSMPKFGINVRFVDAAKP-----  139 (398)
T ss_dssp             SEEEEESSHHHHHHHHHHHHCCTTCEEEEES------S---------SCHHHHHHHHTHHHHTTCEEEEECTTSH-----
T ss_pred             CCHHHHHHHHHHHHHHHHHHCCCCCEEEEEE------C---------CCCCHHHHHHHHCCCCCEEEECCCCCCH-----
T ss_conf             4156778999999999998446999899841------2---------3552136777541248647753799999-----


Q ss_pred             CCCCHHHHHCCCCCCCEECC-----CCEEE---HHHHHHHHCCCCCCEECCCCC
Q ss_conf             44112678708861200001-----54110---588888740168764522531
Q gi|254780151|r  101 IVPFASSYAAGETPLPCVDC-----NRTVK---FSDLLSVTRQLGADVLATGHY  146 (408)
Q Consensus       101 ~~~~~~~y~~G~TPNPc~~C-----N~~iK---F~~l~~~a~~~g~~~iATGHY  146 (408)
                           +++++..+||..+.+     |+.++   ..++.+.|++.|+-.|.-..+
T Consensus       140 -----~~~~~ai~~~Tklv~~Esp~NP~l~v~Di~~ia~ia~~~gi~~vVDNT~  188 (398)
T 2rfv_A          140 -----EEIRAAMRPETKVVYIETPANPTLSLVDIETVAGIAHQQGALLVVDNTF  188 (398)
T ss_dssp             -----HHHHHHCCTTEEEEEEESSBTTTTBCCCHHHHHHHHHHTTCEEEEECTT
T ss_pred             -----HHHHHHCCCCCCEEEEECCCCCCCCCCCCHHHHHHHHHCCCEEEECCCC
T ss_conf             -----9999847887708997079998756357689999974439879962763


No 232
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural genomics consortium, SGC; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2
Probab=23.85  E-value=30  Score=13.58  Aligned_cols=32  Identities=22%  Similarity=0.404  Sum_probs=22.9

Q ss_pred             CCCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             338899-996098579999999988698499999
Q gi|254780151|r   19 KDMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +++.++ .|=|+|+-.++|..|+ ++|++|+.+.
T Consensus         5 ~gK~alVTGas~GIG~aia~~la-~~Ga~V~~~~   37 (246)
T 2ag5_A            5 DGKVIILTAAAQGIGQAAALAFA-REGAKVIATD   37 (246)
T ss_dssp             TTCEEEESSTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             99889994878789999999999-8799999997


No 233
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A*
Probab=23.56  E-value=30  Score=13.54  Aligned_cols=26  Identities=27%  Similarity=0.428  Sum_probs=20.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             9999609857999999998869849999
Q gi|254780151|r   23 VVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        23 V~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      |+||  ||+=-+.+|+-|.++|++|+-+
T Consensus        21 vIIG--aGi~Gls~A~~La~~G~~V~li   46 (382)
T 1ryi_A           21 VVIG--GGIIGSAIAYYLAKENKNTALF   46 (382)
T ss_dssp             EEEC--CSHHHHHHHHHHHHTTCCEEEE
T ss_pred             EEEC--CCHHHHHHHHHHHHCCCCEEEE
T ss_conf             9999--3299999999999789938999


No 234
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A*
Probab=23.44  E-value=31  Score=13.53  Aligned_cols=35  Identities=17%  Similarity=0.302  Sum_probs=23.9

Q ss_pred             CCCCCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             8863388999-96098579999999988698499999
Q gi|254780151|r   16 KNPKDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        16 ~~~k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      .+-+++.++| |=|+|+-.++|-.| .++|++|+...
T Consensus         3 ~~L~gKvalITGas~GIG~aiA~~l-a~~Ga~V~~~~   38 (249)
T 2ew8_A            3 QRLKDKLAVITGGANGIGRAIAERF-AVEGADIAIAD   38 (249)
T ss_dssp             CTTTTCEEEEETTTSHHHHHHHHHH-HHTTCEEEEEE
T ss_pred             CCCCCCEEEEECCCCHHHHHHHHHH-HHCCCEEEEEE
T ss_conf             4328298999288868999999999-98799899997


No 235
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis}
Probab=23.41  E-value=31  Score=13.52  Aligned_cols=29  Identities=21%  Similarity=0.100  Sum_probs=23.1

Q ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             3889999609857999999998869849999
Q gi|254780151|r   20 DMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        20 ~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +|||+|-=.|.+-|.+|++| + ++++|+-+
T Consensus         2 ~MkI~IiGaGaiG~~~a~~L-~-~~~~V~l~   30 (307)
T 3ego_A            2 SLKIGIIGGGSVGLLCAYYL-S-LYHDVTVV   30 (307)
T ss_dssp             CCEEEEECCSHHHHHHHHHH-H-TTSEEEEE
T ss_pred             CCEEEEECCCHHHHHHHHHH-H-CCCCEEEE
T ss_conf             98899999659999999999-7-72987999


No 236
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3
Probab=23.36  E-value=31  Score=13.51  Aligned_cols=36  Identities=22%  Similarity=0.190  Sum_probs=30.9

Q ss_pred             CCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             888633889999609857999999998869849999
Q gi|254780151|r   15 DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        15 ~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      -..-++.||+|.=.-...-.+...+|.+.||+|.++
T Consensus         7 ~~~l~~l~vLvvdd~~~~~~~l~~~L~~~G~~v~~~   42 (196)
T 1qo0_D            7 LGSLRELQVLVLNPPGEVSDALVLQLIRIGCSVRQC   42 (196)
T ss_dssp             HHTGGGCEEEEESCTTHHHHHHHHHHHHHTCEEEEE
T ss_pred             HHHCCCCEEEEEECCHHHHHHHHHHHHHCCCEEECC
T ss_conf             764669869999579999999999999869988716


No 237
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1
Probab=23.36  E-value=31  Score=13.51  Aligned_cols=27  Identities=33%  Similarity=0.716  Sum_probs=16.4

Q ss_pred             EEEEEECCCHH---HHHHHHHHHHCCCEEEE
Q ss_conf             89999609857---99999999886984999
Q gi|254780151|r   22 RVVVAMSGGVD---SSVVAALLKRDGYDVIG   49 (408)
Q Consensus        22 kV~va~SGGVD---Ssvaa~lL~~~G~~V~g   49 (408)
                      -.+||++||.-   |+|| -+|++.|+.|+.
T Consensus         8 P~iIgItG~~GSGKsTva-~~l~~~g~~~~~   37 (203)
T 1uf9_A            8 PIIIGITGNIGSGKSTVA-ALLRSWGYPVLD   37 (203)
T ss_dssp             CEEEEEEECTTSCHHHHH-HHHHHTTCCEEE
T ss_pred             CEEEEEECCCCCCHHHHH-HHHHHCCCEEEE
T ss_conf             489999899877699999-999987993998


No 238
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; HET: MSE; 1.90A {Pseudomonas putida}
Probab=23.21  E-value=31  Score=13.50  Aligned_cols=37  Identities=22%  Similarity=0.305  Sum_probs=30.7

Q ss_pred             CCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEE
Q ss_conf             46788863388999960985799999999886984999
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIG   49 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g   49 (408)
                      |.+.+...+|||.+-=.|-.-|.+|..|+ ++||+|..
T Consensus         1 ~~~~~~~~~m~Ig~IG~G~mG~~ia~~L~-~~G~~V~v   37 (306)
T 3l6d_A            1 MSLSDESFEFDVSVIGLGAMGTIMAQVLL-KQGKRVAI   37 (306)
T ss_dssp             -CCCCCCCSCSEEEECCSHHHHHHHHHHH-HTTCCEEE
T ss_pred             CCCCCCCCCCCEEEEEHHHHHHHHHHHHH-HCCCEEEE
T ss_conf             99888888995899857999999999999-77996999


No 239
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoid, oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A*
Probab=23.15  E-value=31  Score=13.49  Aligned_cols=61  Identities=11%  Similarity=-0.043  Sum_probs=38.2

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             88999-9609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      .||+| |=+|-+-|.++-.||+ +|++|..+.- .-..           +.+..+ ...-.+.+|+.+...|+.+.
T Consensus        11 ~KVlV~GaTG~iG~~lv~~Ll~-~g~~V~vl~R-~~~~-----------~~~k~~-~~~~l~~~gv~~v~gD~~d~   72 (346)
T 3i6i_A           11 GRVLIAGATGFIGQFVATASLD-AHRPTYILAR-PGPR-----------SPSKAK-IFKALEDKGAIIVYGLINEQ   72 (346)
T ss_dssp             CCEEEECTTSHHHHHHHHHHHH-TTCCEEEEEC-SSCC-----------CHHHHH-HHHHHHHTTCEEEECCTTCH
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCCEEEEEC-CCCC-----------CHHHHH-HHHHHHHCCCEEEEEECCCC
T ss_conf             9199989896899999999996-8994899989-9987-----------755789-99887508938999305551


No 240
>3d33_A Domain of unknown function with AN immunoglobulin-like beta-sandwich fold; YP_001297618.1; HET: MSE; 1.70A {Bacteroides vulgatus atcc 8482}
Probab=23.11  E-value=31  Score=13.48  Aligned_cols=31  Identities=16%  Similarity=0.192  Sum_probs=18.5

Q ss_pred             EECCCCCCEEEEEEECCEEEEEECCCCCCCC
Q ss_conf             8017887008999829979999759720006
Q gi|254780151|r  330 IRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA  360 (408)
Q Consensus       330 iR~~~~pvp~~i~~~~~~~~V~f~eP~~aiA  360 (408)
                      .|+..+++|.++..+++.+.|+|.+|..-++
T Consensus        22 ~rs~~~~~Pi~a~Id~~~L~I~F~~~~~~vt   52 (108)
T 3d33_A           22 IRSAATNCPITVFTDGYLLTLKNASPDRDMT   52 (108)
T ss_dssp             ------CCSEEEEEETTEEEEEESSCCSEEE
T ss_pred             CEECCCCCCCEEEEECCEEEEEECCCCCCEE
T ss_conf             1633889995999979999999657899669


No 241
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, plasmid, aromatic hydroxylase, nicotine degradation, flavin mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2
Probab=22.73  E-value=32  Score=13.43  Aligned_cols=62  Identities=18%  Similarity=0.174  Sum_probs=35.5

Q ss_pred             CCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCC-CCCCC--CCCCHHHHHHHHHHHHHCCCCE
Q ss_conf             886338899996098579999999988698499999870478766-55557--7881899999999999809958
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKG--SCCAGQDVYDARRVCDTINVSH   87 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~-~~~~~--~c~~~~d~~~a~~va~~LgI~~   87 (408)
                      ++|+..||+| .=||.=-+.+|++|+++|++|+-+     +.... ....+  ...+.    .+.++-++||+++
T Consensus         1 m~p~~~~V~I-iGaG~aGl~~A~~L~~~G~~v~v~-----Er~~~~~~~~G~gi~l~~----~~~~~L~~lG~~~   65 (397)
T 2vou_A            1 MSPTTDRIAV-VGGSISGLTAALMLRDAGVDVDVY-----ERSPQPLSGFGTGIVVQP----ELVHYLLEQGVEL   65 (397)
T ss_dssp             -CCCCSEEEE-ECCSHHHHHHHHHHHHTTCEEEEE-----CSSSSSCCCCSCEEECCH----HHHHHHHHTTCCG
T ss_pred             CCCCCCEEEE-ECCCHHHHHHHHHHHHCCCCEEEE-----ECCCCCCCCCCEEEEECH----HHHHHHHHCCCCH
T ss_conf             9889981999-897889999999999789999999-----789998887703898698----9999999769953


No 242
>2l2q_A PTS system, cellobiose-specific IIB component (CE; cellobiose-specific phosphotransferase IIB component, struct genomics; NMR {Borrelia burgdorferi}
Probab=22.62  E-value=32  Score=13.42  Aligned_cols=75  Identities=7%  Similarity=0.159  Sum_probs=44.0

Q ss_pred             CCCCEEEEEECCCHHHHHHHHHHHH----CCC--EEEEEEEECCCCCCCCCCCC---CCCC-HHHHHHHHHHHHHCCCCE
Q ss_conf             6338899996098579999999988----698--49999987047876655557---7881-899999999999809958
Q gi|254780151|r   18 PKDMRVVVAMSGGVDSSVVAALLKR----DGY--DVIGVTLQLYNSRKASKRKG---SCCA-GQDVYDARRVCDTINVSH   87 (408)
Q Consensus        18 ~k~~kV~va~SGGVDSsvaa~lL~~----~G~--~V~g~~m~~~~~~~~~~~~~---~c~~-~~d~~~a~~va~~LgI~~   87 (408)
                      +.+|||++.=|||.-||+-+.-+++    +|.  +|.++-.--..  +..+...   ..+. .--.++.++.+...|||.
T Consensus         2 ~~~mkIlL~C~~G~STsllv~km~~~a~~~~~~~~I~A~~~~~~~--~~~~~~DviLL~PQv~y~~~~i~~~~~~~~ipV   79 (109)
T 2l2q_A            2 PGSMNILLVCGAGMSTSMLVQRIEKYAKSKNINATIEAIAETRLS--EVVDRFDVVLLAPQSRFNKKRLEEITKPKGIPI   79 (109)
T ss_dssp             CCCEEEEEESSSSCSSCHHHHHHHHHHHHHTCSEEEEEECSTTHH--HHTTTCSEEEECSCCSSHHHHHHHHHHHHTCCE
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEEHHHHH--HHHCCCCEEEECHHHHHHHHHHHHHHCCCCCCE
T ss_conf             975289888789757999999999999986997799997689998--662299899999738888999999841579829


Q ss_pred             EECCHHH
Q ss_conf             9817078
Q gi|254780151|r   88 YVFDYEE   94 (408)
Q Consensus        88 ~~~d~~~   94 (408)
                      .++|..+
T Consensus        80 ~~I~~~~   86 (109)
T 2l2q_A           80 EIINTID   86 (109)
T ss_dssp             EECCHHH
T ss_pred             EEECHHH
T ss_conf             9978575


No 243
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis}
Probab=22.58  E-value=32  Score=13.41  Aligned_cols=32  Identities=19%  Similarity=0.321  Sum_probs=22.2

Q ss_pred             CCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             3388999-96098579999999988698499999
Q gi|254780151|r   19 KDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +++.++| |=|+|+-.++|..|+ ++|++|+.+.
T Consensus        28 ~GKvalVTGas~GIG~aiA~~la-~~Ga~V~~~~   60 (277)
T 3gvc_A           28 AGKVAIVTGAGAGIGLAVARRLA-DEGCHVLCAD   60 (277)
T ss_dssp             TTCEEEETTTTSTHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             99989993878789999999999-8799999997


No 244
>3c5y_A Ribose/galactose isomerase; YP_001165900.1, putative ribose 5-phosphate isomerase, structural genomics; HET: MSE; 1.81A {Novosphingobium aromaticivorans DSM12444}
Probab=22.53  E-value=32  Score=13.40  Aligned_cols=34  Identities=18%  Similarity=0.292  Sum_probs=22.7

Q ss_pred             CCCEEEEEE-CCCHHHH--HHHHH---HHHCCCEEEEEEE
Q ss_conf             338899996-0985799--99999---9886984999998
Q gi|254780151|r   19 KDMRVVVAM-SGGVDSS--VVAAL---LKRDGYDVIGVTL   52 (408)
Q Consensus        19 k~~kV~va~-SGGVDSs--vaa~l---L~~~G~~V~g~~m   52 (408)
                      +.|||+++. +.|.+-.  +...|   |.++||+|+-+-|
T Consensus        18 ~~MKIAi~~dhs~a~kn~~I~~~Lk~~l~~~GheV~D~G~   57 (231)
T 3c5y_A           18 QGMKIALIIENSQAAKNAVVHEALTTVAEPLGHKVFNYGM   57 (231)
T ss_dssp             -CCEEEECCCGGGGGGHHHHHHHHHHHHGGGTCEEEECCC
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHHHHHHHCCCEEEECCC
T ss_conf             7867999646510446479999999999847998995688


No 245
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}
Probab=22.52  E-value=32  Score=13.40  Aligned_cols=42  Identities=26%  Similarity=0.457  Sum_probs=28.3

Q ss_pred             CCCCCCCCCCCCC-EEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             4434678886338-89999-6098579999999988698499999
Q gi|254780151|r    9 LNSLDLDKNPKDM-RVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus         9 ~~~~~~~~~~k~~-kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      -.++++..--..| ||+|- -||=+-|.++..|+ ++||+|+++.
T Consensus         9 ~~~~~~~~~~~~MkkVLVTGasGfiG~~lv~~L~-~~g~~V~~id   52 (333)
T 2q1w_A            9 HHSSGLVPRGSHMKKVFITGICGQIGSHIAELLL-ERGDKVVGID   52 (333)
T ss_dssp             ------------CCEEEEETTTSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             2125778898997879990788789999999999-7829899997


No 246
>3o2q_B RNA polymerase II subunit A C-terminal domain PHO SSU72; heat repeat, scaffold, phosphatase, polymerase II CTD, CIS-P hydrolase; HET: SEP; 2.40A {Homo sapiens} PDB: 3o2s_B
Probab=22.36  E-value=32  Score=13.38  Aligned_cols=35  Identities=26%  Similarity=0.393  Sum_probs=25.0

Q ss_pred             CCCCCCEEEEEECCCHHHHHHH-HHHHHCCCEEEEE
Q ss_conf             8863388999960985799999-9998869849999
Q gi|254780151|r   16 KNPKDMRVVVAMSGGVDSSVVA-ALLKRDGYDVIGV   50 (408)
Q Consensus        16 ~~~k~~kV~va~SGGVDSsvaa-~lL~~~G~~V~g~   50 (408)
                      ++...+|++|--|.-.--|+-| .+|+++||+|..+
T Consensus        21 mp~s~L~~avVCaSN~NRSMEAH~~L~k~G~~V~Sf   56 (214)
T 3o2q_B           21 MPSSPLRVAVVSSSNQNRSMEAHNILSKRGFSVRSF   56 (214)
T ss_dssp             -----CEEEEEESSSSSHHHHHHHHHHHTTCEEEEE
T ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCEEEE
T ss_conf             899887489985777644899999999879964730


No 247
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1}
Probab=22.35  E-value=25  Score=14.16  Aligned_cols=16  Identities=13%  Similarity=0.221  Sum_probs=12.8

Q ss_pred             CCEECCCCCEEEEECC
Q ss_conf             7110377432233578
Q gi|254780151|r  243 GDIVHLNGQILGRHNG  258 (408)
Q Consensus       243 G~ivd~~G~viG~H~G  258 (408)
                      |+++|.+|+++|=|.+
T Consensus       129 GPv~n~~G~VVGI~~~  144 (163)
T 2w5e_A          129 APVCDKYCRVLAVHQT  144 (163)
T ss_dssp             CEEECTTSCEEEEEEE
T ss_pred             CCEECCCCEEEEEECC
T ss_conf             8779679979999745


No 248
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus}
Probab=22.27  E-value=32  Score=13.37  Aligned_cols=96  Identities=17%  Similarity=0.190  Sum_probs=48.9

Q ss_pred             CCCCCEEEEEE--CCCHHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHH
Q ss_conf             86338899996--09857999999998869849999-9870478766555577881899999999999809958981707
Q gi|254780151|r   17 NPKDMRVVVAM--SGGVDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYE   93 (408)
Q Consensus        17 ~~k~~kV~va~--SGGVDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~   93 (408)
                      ..+++||++-+  .|-=-|++|..|.++-+.+++.+ -|+.+-+-+.....   ++.         .+.-+||||.+|+.
T Consensus        36 ~~~k~kvI~I~GpTasGKT~lAi~LA~~l~~eIIsaDS~QvYk~ldIgTaK---pt~---------~e~~~vpHhLid~v  103 (339)
T 3a8t_A           36 RHRKEKLLVLMGATGTGKSRLSIDLAAHFPLEVINSDKMQVYKGLDITTNK---ISV---------PDRGGVPHHLLGEV  103 (339)
T ss_dssp             --CCCEEEEEECSTTSSHHHHHHHHHTTSCEEEEECCSSTTBSSCTTTTTC---CCS---------GGGTTCCEESSSCB
T ss_pred             CCCCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEECCCHHHCCCCCEEECC---CCH---------HHHCCCCEEEEEEE
T ss_conf             457886799989884289999999999879979952306426999748899---999---------99838997999899


Q ss_pred             H----HH-----HHHCCCCCHHHHHCCCCCCCEECCCCEE
Q ss_conf             8----86-----6322441126787088612000015411
Q gi|254780151|r   94 E----RF-----RNAVIVPFASSYAAGETPLPCVDCNRTV  124 (408)
Q Consensus        94 ~----~f-----~~~V~~~~~~~y~~G~TPNPc~~CN~~i  124 (408)
                      +    +|     .+.+..-.-+-.++|.+|-=|-.++-++
T Consensus       104 ~p~~~~ysv~~f~~~A~~~I~~i~~rgkiPIlVGGTglYl  143 (339)
T 3a8t_A          104 DPARGELTPADFRSLAGKAVSEITGRRKLPVLVGGSNSFI  143 (339)
T ss_dssp             CGGGCCCCHHHHHHHHHHHHHHHHHTTCEEEEECCCHHHH
T ss_pred             ECCCCEEEHHHHHHHHHHHHHHHHHCCCCEEEECCCHHHH
T ss_conf             7376635599999999999999984899649975720788


No 249
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis}
Probab=21.78  E-value=19  Score=14.94  Aligned_cols=117  Identities=15%  Similarity=0.201  Sum_probs=66.9

Q ss_pred             HHHHHHHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHCCCCCCEECCCCCCCEEEE
Q ss_conf             99999999980995898170788663224411267870886120000154110588888740168764522531102541
Q gi|254780151|r   73 VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLY  152 (408)
Q Consensus        73 ~~~a~~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~~~g~~~iATGHYar~~~~  152 (408)
                      ++.-++.|+.+||.++.+.+.+.=.                            -.-|++..++++.|-=.+|--.+.-. 
T Consensus        52 v~~k~k~a~~~Gi~~~~~~l~~~~s----------------------------~~el~~~I~~LN~D~~V~GIivQlPl-  102 (285)
T 3l07_A           52 VASKEKACAQVGIDSQVITLPEHTT----------------------------ESELLELIDQLNNDSSVHAILVQLPL-  102 (285)
T ss_dssp             HHHHHHHHHHHTCEEEEEEECTTCC----------------------------HHHHHHHHHHHHTCTTCCEEEECSSC-
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCCC----------------------------HHHHHHHHHHHHCCCCCCEEEEECCC-
T ss_conf             9999999997488589997899988----------------------------99999999999646786779960676-


Q ss_pred             CCCCCCCEEEEEECCCCCCCCEEEEEEECCHHHCEEE-CCCCCC---CHHHHHHHHHHCCCCCCCHHHCCCEEECCCCCC
Q ss_conf             2678773168853157878731898630202210033-425689---978989999741254355111023011127751
Q gi|254780151|r  153 VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR-FPLGDM---KKESVRDLAREMGLDIADKSDSQDICFVQQGKY  228 (408)
Q Consensus       153 ~~~~~~~~~~L~r~~D~~KDQSYfL~~l~~~~L~~~~-FPlg~~---~K~eVR~~A~~~gl~~a~K~eSqgICFi~~~~~  228 (408)
                        .++-....++.+.++.||    .=+++...+.++. ..-..+   |-.-|.++.+.+|++...|.    +|-||+...
T Consensus       103 --P~~~~~~~i~~~I~p~KD----VDGl~~~n~g~l~~~~~~~~~PcTp~av~~lL~~~~i~l~Gk~----vvVvGrS~i  172 (285)
T 3l07_A          103 --PAHINKNNVIYSIKPEKD----VDGFHPTNVGRLQLRDKKCLESCTPKGIMTMLREYGIKTEGAY----AVVVGASNV  172 (285)
T ss_dssp             --CTTSCHHHHHHHSCGGGB----TTCCSHHHHHHHHHTCTTCCCCHHHHHHHHHHHHTTCCCTTCE----EEEECCCTT
T ss_pred             --CCCCCHHHHHHCCCCCCC----CCCCCHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCE----EEEECCCCC
T ss_conf             --556106889860495558----4546888874002477667889889999999999599867977----999889875


No 250
>2hfv_A Hypothetical protein RPA1041; NESG, GFT-alpha+beta, structural genomics, PSI-2, protein structure initiative; NMR {Pseudomonas aeruginosa} SCOP: d.58.5.5
Probab=21.73  E-value=33  Score=13.29  Aligned_cols=65  Identities=22%  Similarity=0.252  Sum_probs=43.8

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCC--------CCHHHHHHHHHHHHHCCCCEEE
Q ss_conf             3388999960985799999999886984999998704787665555778--------8189999999999980995898
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC--------CAGQDVYDARRVCDTINVSHYV   89 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c--------~~~~d~~~a~~va~~LgI~~~~   89 (408)
                      .-||-++--.--|.=+.+..||+.+|.+..-     .|.... ...++.        -.++|+..|+++-+..|+++..
T Consensus        21 ~~MkeL~rTnD~V~is~~~aLL~~aGI~~~V-----~De~mS-~leG~ig~~PrRimV~deD~~~Ar~IL~dag~~~~L   93 (97)
T 2hfv_A           21 GHLRELLRTNDAVLLSAVGALLDGADIGHLV-----LDQNMS-ILEGSLGVIPRRVLVHEDDLAGARRLLTDAGLAHEL   93 (97)
T ss_dssp             CSEEEEEEECCHHHHHHHHHHHHHTTCCEEC-----CSCCCC-SSSCCSSSSCEEEEEEGGGHHHHHHHHHHTTCCSSB
T ss_pred             EEEEEEEECCCHHHHHHHHHHHHHCCCCEEE-----ECCCHH-HHCCCCCCCCEEEEECHHHHHHHHHHHHHCCCHHHC
T ss_conf             2135554528999999999999768998798-----054003-323457766479998367899999999976980422


No 251
>1tks_A 3,4-dihydroxy-2-butanone 4-phosphate synthase; riboflavin biosynthesis, synthetic gene, isomerase; 1.60A {Candida albicans SC5314} SCOP: d.115.1.2 PDB: 1tku_A* 2ris_A 2riu_A*
Probab=21.57  E-value=33  Score=13.27  Aligned_cols=122  Identities=15%  Similarity=0.232  Sum_probs=53.8

Q ss_pred             HHHHHCCCCEEECCHHHHHHHHCCCCCHHHHHCCCCCCCEECCCCEEEHHHHHHHHC--CCCCCEECCCCCCCEEEECCC
Q ss_conf             999980995898170788663224411267870886120000154110588888740--168764522531102541267
Q gi|254780151|r   78 RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR--QLGADVLATGHYIRSRLYVGD  155 (408)
Q Consensus        78 ~va~~LgI~~~~~d~~~~f~~~V~~~~~~~y~~G~TPNPc~~CN~~iKF~~l~~~a~--~~g~~~iATGHYar~~~~~~~  155 (408)
                      ..|++||+|...-+-++.+.. -|.-.++ +..|.|.  -|..+-+.  ......|+  ...-||+--||-.   .....
T Consensus        65 ~~~~~L~lp~m~~~~~~~~~~-~f~v~vd-~~~g~~T--GISa~DRa--~Tir~la~~~~~~~df~~PGHv~---pl~a~  135 (204)
T 1tks_A           65 ERANQLELPPMLANRSDRHGT-AYTITCD-FAEGTTT--GISAHDRA--LTTRSLANPNSKPQDFIKPGHIL---PLRAV  135 (204)
T ss_dssp             HHHHHTTCCBSCC------CC-CBBCCEE-ESTTCSS--SCSHHHHH--HHHHHHHCTTCCGGGEEEEEEEE---EEEEC
T ss_pred             HHHHHCCCCCCCCCCCCCCCC-CEEEEEC-CCCCCCC--CCCHHHHH--HHHHHHHCCCCCHHHCCCCCCCC---CCEEC
T ss_conf             999226898645456787888-5354421-6678889--97899999--99999866799875631799867---01024


Q ss_pred             CCCC---EEEEEECCCCCCCCEEEEEEECCH-HHCEEEC-CCCC-CCHHHHHHHHHHCCCCCCC
Q ss_conf             8773---168853157878731898630202-2100334-2568-9978989999741254355
Q gi|254780151|r  156 DGKR---RRIMCRPMDLERDQSYFLFATTQQ-QLCDLRF-PLGD-MKKESVRDLAREMGLDIAD  213 (408)
Q Consensus       156 ~~~~---~~~L~r~~D~~KDQSYfL~~l~~~-~L~~~~F-Plg~-~~K~eVR~~A~~~gl~~a~  213 (408)
                      ++.-   ..+--.+.|..+     |+++.+- .+.-++= +=|. +.+++.+++|++++||+-+
T Consensus       136 ~ggvl~R~GHTEaavdL~~-----lAGl~P~avicEil~d~dG~~~~~~~~~~fA~~~~l~~i~  194 (204)
T 1tks_A          136 PGLLKKRRGHTEAAVQLST-----LAGLQPAGVICELVRDEDGLMMRLDDCIQFGKKHGIKIIN  194 (204)
T ss_dssp             TTGGGTCCCHHHHHHHHHH-----HTTSCSBEEEEEBBCTTTCCBCBHHHHHHHHHHHTCCEEE
T ss_pred             CCCCCCCCCHHHHHHHHHH-----HCCCCCEEEEEEEEECCCCCCCCHHHHHHHHHHCCCCEEE
T ss_conf             5777567888899999999-----8399961999999788998865889999999984996998


No 252
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2
Probab=21.40  E-value=33  Score=13.25  Aligned_cols=32  Identities=16%  Similarity=0.314  Sum_probs=23.1

Q ss_pred             CCCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             3388999-96098579999999988698499999
Q gi|254780151|r   19 KDMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        19 k~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +++.++| |=|+|+-.++|..|+ ++|++|+.+.
T Consensus         5 ~gKvalITGas~GIG~aiA~~la-~~Ga~V~i~~   37 (280)
T 1xkq_A            5 SNKTVIITGSSNGIGRTTAILFA-QEGANVTITG   37 (280)
T ss_dssp             TTCEEEETTCSSHHHHHHHHHHH-HTTCEEEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             99879993768699999999999-8799899998


No 253
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A
Probab=21.05  E-value=34  Score=13.20  Aligned_cols=58  Identities=21%  Similarity=0.290  Sum_probs=34.4

Q ss_pred             EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             9609857999999998869849999987047876655557788189999999999980995
Q gi|254780151|r   26 AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS   86 (408)
Q Consensus        26 a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~   86 (408)
                      ||+|+|-|-.+...++..-...+-|.+.+.|+.-...- .+-++.+|+  ...||++|||.
T Consensus         1 ~~~~~~~s~~~~~~~~~~~~~~~~v~v~~~d~~~~~~v-~~~tt~~el--~~~v~~~l~l~   58 (314)
T 1h4r_A            1 GMAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNC-EMKWKGKDL--FDLVCRTLGLR   58 (314)
T ss_dssp             --------------------CEEEEEEECSSCEEEEEE-ETTCBHHHH--HHHHHHHHTCC
T ss_pred             CCCCCCCCCCCHHHHHHCCCCEEEEEEEECCCEEEEEE-CCCCCHHHH--HHHHHHHCCCC
T ss_conf             99887553422345763589337999996796499998-999989999--99999875998


No 254
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductase; oxidoreductase; 1.99A {Streptomyces coelicolor A3}
Probab=21.04  E-value=34  Score=13.20  Aligned_cols=64  Identities=14%  Similarity=0.048  Sum_probs=33.8

Q ss_pred             CCEEEE-EECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHH-HHHHHHHCC
Q ss_conf             388999-96098579999999988698499999870478766555577881899999-999999809
Q gi|254780151|r   20 DMRVVV-AMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD-ARRVCDTIN   84 (408)
Q Consensus        20 ~~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~-a~~va~~Lg   84 (408)
                      ++.|+| |=|+|+-.++|-.|+ ++|++|+.+....-..+.......-...+++++. +.++.+++|
T Consensus        21 ~K~alITGas~GIG~aia~~la-~~Ga~V~~~~r~~~~~~~~~~~~~Dv~~~~~v~~~~~~~~~~~G   86 (253)
T 2nm0_A           21 SRSVLVTGGNRGIGLAIARAFA-DAGDKVAITYRSGEPPEGFLAVKCDITDTEQVEQAYKEIEETHG   86 (253)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHH-HTTCEEEEEESSSCCCTTSEEEECCTTSHHHHHHHHHHHHHHTC
T ss_pred             CCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEECCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             8989994788789999999999-87998999989832226828999238999999999999999739


No 255
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1
Probab=21.01  E-value=34  Score=13.19  Aligned_cols=33  Identities=9%  Similarity=0.032  Sum_probs=23.2

Q ss_pred             CCCHHHHHHHHHHCCCCCC-------CHHHCCCEEECCCC
Q ss_conf             8997898999974125435-------51110230111277
Q gi|254780151|r  194 DMKKESVRDLAREMGLDIA-------DKSDSQDICFVQQG  226 (408)
Q Consensus       194 ~~~K~eVR~~A~~~gl~~a-------~K~eSqgICFi~~~  226 (408)
                      +.+++||+++-+.+|....       ....+.|.|||.=.
T Consensus        26 ~~t~~dl~~~F~~~g~~~~~v~~~~~~~g~~~G~afV~f~   65 (98)
T 2cqp_A           26 TVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFE   65 (98)
T ss_dssp             TCCHHHHHHHTTTSCCCTTTCEEEECSSSCEEEEEEEEES
T ss_pred             CCCHHHHHHHHHHCCCEEEEEEEECCCCCCCCCEEEEEEC
T ss_conf             8989999999997298617999834898786527999989


No 256
>1sbo_A Putative anti-sigma factor antagonist TM1442; open sandwich, JCSG, structural genomics, joint center for structural genomics, PSI; NMR {Thermotoga maritima} SCOP: c.13.2.1 PDB: 1t6r_A* 1vc1_A
Probab=20.93  E-value=34  Score=13.18  Aligned_cols=83  Identities=16%  Similarity=0.145  Sum_probs=52.5

Q ss_pred             CCCCCCCCCCCCCEEEEEECCCHHHHHHHHHH-------HHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             44346788863388999960985799999999-------88698499999870478766555577881899999999999
Q gi|254780151|r    9 LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALL-------KRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD   81 (408)
Q Consensus         9 ~~~~~~~~~~k~~kV~va~SGGVDSsvaa~lL-------~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~   81 (408)
                      |+.|.++...++...++-++|-+|+..+..+-       .+.+...+-  +.+-+-.. -.    .+.-.-+..+.+.|+
T Consensus         1 m~~~~~~~~~~~~~~ii~l~G~l~~~~a~~l~~~l~~~~~~~~~~~vv--lD~~~v~~-iD----ssgl~~L~~~~~~~~   73 (110)
T 1sbo_A            1 MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIV--LDLSSVSY-MD----SAGLGTLVVILKDAK   73 (110)
T ss_dssp             CCSCEECCEECSSEEEEEEESCBSTTTTTHHHHHHHTHHHHCSCSEEE--EECTTCCC-BC----HHHHHHHHHHHHHHH
T ss_pred             CCCCEEEEEEECCEEEEEEEEEEEHHHHHHHHHHHHHHHHCCCCCEEE--EEECCCCC-CC----HHHHHHHHHHHHHHH
T ss_conf             997287899999999999999999689899999999998538997899--99469987-36----279999999999999


Q ss_pred             HCCCCEEECCHHHHHHH
Q ss_conf             80995898170788663
Q gi|254780151|r   82 TINVSHYVFDYEERFRN   98 (408)
Q Consensus        82 ~LgI~~~~~d~~~~f~~   98 (408)
                      ..|.++...+..++.++
T Consensus        74 ~~g~~l~l~~~~~~v~~   90 (110)
T 1sbo_A           74 INGKEFILSSLKESISR   90 (110)
T ss_dssp             HTTCEEEEESCCHHHHH
T ss_pred             HCCCEEEEEECCHHHHH
T ss_conf             78998999929989999


No 257
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3o8q_B*
Probab=20.90  E-value=34  Score=13.18  Aligned_cols=10  Identities=10%  Similarity=-0.028  Sum_probs=4.5

Q ss_pred             HHHHCCCCEE
Q ss_conf             9998099589
Q gi|254780151|r   79 VCDTINVSHY   88 (408)
Q Consensus        79 va~~LgI~~~   88 (408)
                      ..+++||++.
T Consensus        30 ~f~~~gi~~~   39 (281)
T 3o8q_A           30 FARQTQQSMI   39 (281)
T ss_dssp             HHHHTTCCEE
T ss_pred             HHHHCCCCCE
T ss_conf             9998699928


No 258
>2qmo_A Dethiobiotin synthetase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.47A {Helicobacter pylori 26695} PDB: 3mle_A*
Probab=20.90  E-value=34  Score=13.18  Aligned_cols=23  Identities=13%  Similarity=0.127  Sum_probs=13.8

Q ss_pred             CCCHH-HHHHHHH---HHHCCCEEEEE
Q ss_conf             09857-9999999---98869849999
Q gi|254780151|r   28 SGGVD-SSVVAAL---LKRDGYDVIGV   50 (408)
Q Consensus        28 SGGVD-Ssvaa~l---L~~~G~~V~g~   50 (408)
                      +.||- |++++.|   |+++|+.|..+
T Consensus        10 ~t~vGKT~vs~~L~~~L~~~G~~V~~~   36 (220)
T 2qmo_A           10 NTNAGKTTCARLLAQYCNACGVKTILL   36 (220)
T ss_dssp             STTSCHHHHHHHHHHHHHHTTCCEEEE
T ss_pred             CCCCCHHHHHHHHHHHHHHCCCEEEEE
T ss_conf             999879999999999999789969997


No 259
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A*
Probab=20.78  E-value=34  Score=13.16  Aligned_cols=31  Identities=19%  Similarity=0.552  Sum_probs=23.0

Q ss_pred             CEEEE--EECCCHHHHHHHHHHHHCCCEEEEEEE
Q ss_conf             88999--960985799999999886984999998
Q gi|254780151|r   21 MRVVV--AMSGGVDSSVVAALLKRDGYDVIGVTL   52 (408)
Q Consensus        21 ~kV~v--a~SGGVDSsvaa~lL~~~G~~V~g~~m   52 (408)
                      |||++  |=|+|+-.++|-.| .++|++|+.+..
T Consensus         1 mKVvlVTGas~GIG~aia~~l-a~~Ga~Vv~~~~   33 (257)
T 1fjh_A            1 MSIIVISGCATGIGAATRKVL-EAAGHQIVGIDI   33 (257)
T ss_dssp             CCEEEEETTTSHHHHHHHHHH-HHTTCEEEEEES
T ss_pred             CCEEEECCCCCHHHHHHHHHH-HHCCCEEEEEEC
T ss_conf             979999198789999999999-987999999968


No 260
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis}
Probab=20.75  E-value=34  Score=13.16  Aligned_cols=58  Identities=19%  Similarity=0.304  Sum_probs=37.1

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             3388999960985799999999886984999998704787665555778818999999999998099589817078
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      +++|+.|-=.|.+-...+..|.+-.+++|+++.    +.+              .+.++++|+++|||.-.-|+.+
T Consensus         4 ~kir~giIG~G~i~~~h~~~l~~~~~~~l~av~----d~~--------------~~~~~~~a~~~~~~~~~~~~~~   61 (330)
T 3e9m_A            4 DKIRYGIMSTAQIVPRFVAGLRESAQAEVRGIA----SRR--------------LENAQKMAKELAIPVAYGSYEE   61 (330)
T ss_dssp             CCEEEEECSCCTTHHHHHHHHHHSSSEEEEEEB----CSS--------------SHHHHHHHHHTTCCCCBSSHHH
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCCEEEEEE----CCC--------------HHHHHHHHHHCCCCEECCCHHH
T ss_conf             885899998839999999999748992899998----899--------------9999999998399804199999


No 261
>3cg0_A Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor; signal receiver domain; 2.15A {Desulfovibrio desulfuricans subsp}
Probab=20.72  E-value=35  Score=13.15  Aligned_cols=62  Identities=21%  Similarity=0.283  Sum_probs=34.8

Q ss_pred             CCCCCCCCCCEEEEEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECC
Q ss_conf             46788863388999960985799999999886984999998704787665555778818999999999998099589817
Q gi|254780151|r   12 LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFD   91 (408)
Q Consensus        12 ~~~~~~~k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d   91 (408)
                      |++..+++..||+|.=.--.--.....+|++.||+|+++.-                   +-++|...++.-...+-++|
T Consensus         1 ms~~~~~~~~~ILvVDD~~~~~~~l~~~L~~~G~~v~~~a~-------------------~~~eal~~~~~~~~dlvi~D   61 (140)
T 3cg0_A            1 MSLTASDDLPGVLIVEDGRLAAATLRIQLESLGYDVLGVFD-------------------NGEEAVRCAPDLRPDIALVD   61 (140)
T ss_dssp             -------CCCEEEEECCBHHHHHHHHHHHHHHTCEEEEEES-------------------SHHHHHHHHHHHCCSEEEEE
T ss_pred             CCCCCCCCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEC-------------------CHHHHHHHHHHCCCCEEEEE
T ss_conf             99998999998999979999999999999987998999978-------------------99999999982799889997


Q ss_pred             H
Q ss_conf             0
Q gi|254780151|r   92 Y   92 (408)
Q Consensus        92 ~   92 (408)
                      +
T Consensus        62 ~   62 (140)
T 3cg0_A           62 I   62 (140)
T ss_dssp             S
T ss_pred             C
T ss_conf             6


No 262
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding motif, oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2
Probab=20.52  E-value=35  Score=13.12  Aligned_cols=44  Identities=18%  Similarity=0.234  Sum_probs=32.6

Q ss_pred             CCCCCCCCCCCCCCE--EEEEECCCHHHHHHHHHHH--HCCCEEEEEE
Q ss_conf             444346788863388--9999609857999999998--8698499999
Q gi|254780151|r    8 RLNSLDLDKNPKDMR--VVVAMSGGVDSSVVAALLK--RDGYDVIGVT   51 (408)
Q Consensus         8 ~~~~~~~~~~~k~~k--V~va~SGGVDSsvaa~lL~--~~G~~V~g~~   51 (408)
                      ...+.++......||  ++.|=|+|+--++|-.|+.  ++|+.|+.+-
T Consensus         8 ~~~~~~l~~r~~~MktVlITGas~GIG~aia~~l~~la~~G~~V~~~~   55 (267)
T 1sny_A            8 HHHSSGLVPRGSHMNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTC   55 (267)
T ss_dssp             ------------CCSEEEESCCSSHHHHHHHHHHHTSSSCCSEEEEEE
T ss_pred             CCCCCCCCCCCCCCCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             655668888999999899918987899999999998886799999998


No 263
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferase; nucleoside modification, isopentenyl-tRNA transferase, MIAA, transferase/RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A
Probab=20.51  E-value=35  Score=13.12  Aligned_cols=58  Identities=14%  Similarity=0.211  Sum_probs=32.8

Q ss_pred             EEECCCHHHHHHHHHHHHCCCEEEEE-EEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHH
Q ss_conf             99609857999999998869849999-98704787665555778818999999999998099589817078
Q gi|254780151|r   25 VAMSGGVDSSVVAALLKRDGYDVIGV-TLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEE   94 (408)
Q Consensus        25 va~SGGVDSsvaa~lL~~~G~~V~g~-~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~   94 (408)
                      +|=-|-=-|++|..|.++-+.+++.+ -|+.+-+-+.....   ++.         .+.-+||||.+|+.+
T Consensus        16 ~GpTasGKs~La~~lA~~~~~eIIs~DS~QvYk~l~IgTaK---p~~---------~e~~~i~Hhlid~~~   74 (316)
T 3foz_A           16 MGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAK---PNA---------EELLAAPHRLLDIRD   74 (316)
T ss_dssp             ECCTTSCHHHHHHHHHHHSCEEEEECCTTTTBTTCCTTTTC---CCH---------HHHHHSCEETSSCBC
T ss_pred             ECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCEEECC---CCH---------HHHHCCCEEEECCCC
T ss_conf             89883279999999999869979940268761999877789---999---------999279977745668


No 264
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2
Probab=20.39  E-value=35  Score=13.11  Aligned_cols=30  Identities=20%  Similarity=0.231  Sum_probs=24.0

Q ss_pred             CEEEEE-ECCCHHHHHHHHHHHHCCCEEEEEE
Q ss_conf             889999-6098579999999988698499999
Q gi|254780151|r   21 MRVVVA-MSGGVDSSVVAALLKRDGYDVIGVT   51 (408)
Q Consensus        21 ~kV~va-~SGGVDSsvaa~lL~~~G~~V~g~~   51 (408)
                      +||+|. =||=+-|.++-.|+ ++||+|.++.
T Consensus         5 ~kILVtGatG~iG~~lv~~Ll-~~g~~V~~l~   35 (308)
T 1qyc_A            5 SRILLIGATGYIGRHVAKASL-DLGHPTFLLV   35 (308)
T ss_dssp             CCEEEESTTSTTHHHHHHHHH-HTTCCEEEEC
T ss_pred             CEEEEECCCCHHHHHHHHHHH-HCCCEEEEEE
T ss_conf             979998988389999999999-7889699998


No 265
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; IDP02274, hydrolase, lipopolysaccharide biosynthesis, magnesium, structural genomics; 1.95A {Yersinia pestis CO92}
Probab=20.38  E-value=35  Score=13.10  Aligned_cols=27  Identities=11%  Similarity=0.362  Sum_probs=14.1

Q ss_pred             CCCCH-HHHHHHHHHCCCCCCCHHHCCCEEECCC
Q ss_conf             68997-8989999741254355111023011127
Q gi|254780151|r  193 GDMKK-ESVRDLAREMGLDIADKSDSQDICFVQQ  225 (408)
Q Consensus       193 g~~~K-~eVR~~A~~~gl~~a~K~eSqgICFi~~  225 (408)
                      |...| +.++++.+++|+.      -..+||+|+
T Consensus       121 g~~dK~~~l~~l~~~~gi~------~~evayvGD  148 (211)
T 3ij5_A          121 GQSDKLVAYHELLATLQCQ------PEQVAYIGD  148 (211)
T ss_dssp             SCSSHHHHHHHHHHHHTCC------GGGEEEEEC
T ss_pred             CCCCCHHHHHHHHHHHCCC------CCEEEEECC
T ss_conf             6555199999999984878------533899748


No 266
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV}
Probab=20.31  E-value=35  Score=13.09  Aligned_cols=60  Identities=10%  Similarity=0.080  Sum_probs=33.0

Q ss_pred             EEEEE--ECCCHHHHH---HHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHC
Q ss_conf             89999--609857999---999998869849999987047876655557788189999999999980
Q gi|254780151|r   22 RVVVA--MSGGVDSSV---VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTI   83 (408)
Q Consensus        22 kV~va--~SGGVDSsv---aa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~L   83 (408)
                      .|+.+  +.||-++..   .|..|.+.||.|+.+-++-+..  .......+..+.+++++...++++
T Consensus         6 ~Vv~~HG~~~~~~~~~~~~la~~l~~~G~~v~~~d~~g~g~--s~~~~~~~~~~~~v~~~~~~~~~~   70 (176)
T 2qjw_A            6 HCILAHGFESGPDALKVTALAEVAERLGWTHERPDFTDLDA--RRDLGQLGDVRGRLQRLLEIARAA   70 (176)
T ss_dssp             EEEEECCTTCCTTSHHHHHHHHHHHHTTCEEECCCCHHHHT--CGGGCTTCCHHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCCCCHHHHHHHHHHHHCCCEEEEECCCCCCC--CCCCCCCCCHHHHHHHHHHHHHHC
T ss_conf             89998998889774799999999997899899935788899--999887799999999999999964


No 267
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A*
Probab=20.25  E-value=26  Score=14.08  Aligned_cols=29  Identities=24%  Similarity=0.257  Sum_probs=22.6

Q ss_pred             CEEEE-EECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             88999-9609857999999998869849999
Q gi|254780151|r   21 MRVVV-AMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        21 ~kV~v-a~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +||+| |=||-+-|.++-.|++ .|++|+.+
T Consensus         4 KkIlITG~tGfiG~~l~~~L~~-~g~~v~~~   33 (321)
T 1e6u_A            4 QRVFIAGHRGMVGSAIRRQLEQ-RGDVELVL   33 (321)
T ss_dssp             EEEEEETTTSHHHHHHHHHHTT-CTTEEEEC
T ss_pred             CEEEEECCCCHHHHHHHHHHHH-CCCEEEEE
T ss_conf             8699984874899999999997-84989996


No 268
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavoprotein, 3D-structure, oxidoreductase; HET: FAD; 2.80A {Streptomyces SP}
Probab=20.24  E-value=35  Score=13.08  Aligned_cols=31  Identities=29%  Similarity=0.491  Sum_probs=23.9

Q ss_pred             CCCEEEEEECCCHHHHHHHHHHHHCCCEEEEE
Q ss_conf             33889999609857999999998869849999
Q gi|254780151|r   19 KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGV   50 (408)
Q Consensus        19 k~~kV~va~SGGVDSsvaa~lL~~~G~~V~g~   50 (408)
                      +.+||+| .=||+=-.+||+.|+++|++|+=+
T Consensus        43 ~~k~VaI-IGAGisGL~aA~~L~~~G~~VtVl   73 (376)
T 2e1m_A           43 PPKRILI-VGAGIAGLVAGDLLTRAGHDVTIL   73 (376)
T ss_dssp             SCCEEEE-ECCBHHHHHHHHHHHHTSCEEEEE
T ss_pred             CCCEEEE-ECCCHHHHHHHHHHHHCCCCEEEE
T ss_conf             9997999-898889999999998689938999


No 269
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2
Probab=20.13  E-value=35  Score=13.07  Aligned_cols=56  Identities=20%  Similarity=0.347  Sum_probs=35.0

Q ss_pred             CCCEEE-EEECCCHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEECCHHHH
Q ss_conf             338899-99609857999999998869849999987047876655557788189999999999980995898170788
Q gi|254780151|r   19 KDMRVV-VAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER   95 (408)
Q Consensus        19 k~~kV~-va~SGGVDSsvaa~lL~~~G~~V~g~~m~~~~~~~~~~~~~~c~~~~d~~~a~~va~~LgI~~~~~d~~~~   95 (408)
                      +.+.++ .|=|+|+-.++|..|+ ++|++|+.....   .             +    +...++.++..++..|++++
T Consensus         5 ~GK~alITGas~GIG~aia~~la-~~Ga~V~~~~~~---~-------------~----~~~~~~~~~~~~~~~Dv~~~   61 (256)
T 2d1y_A            5 AGKGVLVTGGARGIGRAIAQAFA-REGALVALCDLR---P-------------E----GKEVAEAIGGAFFQVDLEDE   61 (256)
T ss_dssp             TTCEEEEETTTSHHHHHHHHHHH-HTTCEEEEEESS---T-------------T----HHHHHHHHTCEEEECCTTCH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHH-HCCCEEEEEECC---H-------------H----HHHHHHHCCCEEEEEECCCH
T ss_conf             99889993888689999999999-879999999688---7-------------8----99999876993999868999


Done!