BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase
MnmA [Candidatus Liberibacter asiaticus str. psy62]
         (408 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|254780151|ref|YP_003064564.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254039828|gb|ACT56624.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|255957544|dbj|BAH96607.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957840|dbj|BAH96814.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957850|dbj|BAH96823.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957860|dbj|BAH96832.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957870|dbj|BAH96841.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957880|dbj|BAH96850.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957890|dbj|BAH96859.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957900|dbj|BAH96868.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957910|dbj|BAH96877.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957920|dbj|BAH96886.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957930|dbj|BAH96895.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957940|dbj|BAH96904.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957950|dbj|BAH96913.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957960|dbj|BAH96922.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957970|dbj|BAH96931.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957980|dbj|BAH96940.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255957990|dbj|BAH96949.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958000|dbj|BAH96958.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958010|dbj|BAH96967.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958020|dbj|BAH96976.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958030|dbj|BAH96985.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958040|dbj|BAH96994.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958050|dbj|BAH97003.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958060|dbj|BAH97012.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958070|dbj|BAH97021.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958080|dbj|BAH97030.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958090|dbj|BAH97039.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958100|dbj|BAH97048.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958110|dbj|BAH97057.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|255958120|dbj|BAH97066.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Candidatus Liberibacter asiaticus]
 gi|283362130|dbj|BAI65917.1| predicted tRNA (5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Candidatus Liberibacter asiaticus]
 gi|283362140|dbj|BAI65926.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362150|dbj|BAI65935.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362160|dbj|BAI65944.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362170|dbj|BAI65953.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362180|dbj|BAI65962.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362190|dbj|BAI65971.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362200|dbj|BAI65980.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362210|dbj|BAI65989.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362220|dbj|BAI65998.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
 gi|283362230|dbj|BAI66007.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate) [Candidatus
           Liberibacter asiaticus]
          Length = 408

 Score =  830 bits (2144), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/408 (100%), Positives = 408/408 (100%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA
Sbjct: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC
Sbjct: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT
Sbjct: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA
Sbjct: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV
Sbjct: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA
Sbjct: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408
           SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
Sbjct: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408


>gi|140063954|gb|ABO82466.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Liberibacter asiaticus]
          Length = 408

 Score =  829 bits (2141), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/408 (99%), Positives = 408/408 (100%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVT+QLYNSRKA
Sbjct: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTVQLYNSRKA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC
Sbjct: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT
Sbjct: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA
Sbjct: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV
Sbjct: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
           HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA
Sbjct: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408
           SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
Sbjct: 361 SGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408


>gi|110808325|gb|ABG91067.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Liberibacter asiaticus]
          Length = 357

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/357 (99%), Positives = 357/357 (100%)

Query: 52  LQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAG 111
           +QLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAG
Sbjct: 1   VQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAG 60

Query: 112 ETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER 171
           ETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER
Sbjct: 61  ETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLER 120

Query: 172 DQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDV 231
           DQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDV
Sbjct: 121 DQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDV 180

Query: 232 VKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVI 291
           VKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVI
Sbjct: 181 VKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVI 240

Query: 292 VGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVD 351
           VGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVD
Sbjct: 241 VGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVD 300

Query: 352 FEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 408
           FEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM
Sbjct: 301 FEKSEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEFPYKM 357


>gi|315122753|ref|YP_004063242.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313496155|gb|ADR52754.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 398

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/392 (83%), Positives = 360/392 (91%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD DKNPKDMRVVVAMSGGVDSS+VAALLKRDGYDV+GVTLQLYN  K SKRKGSCC
Sbjct: 1   MNSLDFDKNPKDMRVVVAMSGGVDSSIVAALLKRDGYDVVGVTLQLYNGGKESKRKGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQDVYDARRVCD I+V HYVFDYEERF NAVIVPFA++Y AGETPLPCVDCNRTVKF D
Sbjct: 61  AGQDVYDARRVCDAIDVPHYVFDYEERFHNAVIVPFANAYIAGETPLPCVDCNRTVKFLD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLSV R+LGADVLATGHYIRSR +VG DG RRRIMCRP+D ERDQSYFLFATTQQQLCDL
Sbjct: 121 LLSVMRRLGADVLATGHYIRSRFHVGADGVRRRIMCRPVDSERDQSYFLFATTQQQLCDL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+MKKESVRDLAREM L++ADKSDSQDICFVQ+GKYFD+VK++++ I+LEG+IVHL
Sbjct: 181 RFPLGEMKKESVRDLAREMKLEVADKSDSQDICFVQKGKYFDIVKKLSSDISLEGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQ+LGRHNGIINYTIGQRRGLG+A  +PLFVVYLDK  SRVIVGPRE+LEV RIYLREI
Sbjct: 241 SGQVLGRHNGIINYTIGQRRGLGIAASDPLFVVYLDKQGSRVIVGPREALEVRRIYLREI 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG FED VVDGFKCF KIRSSQDPV VFV+R+D GVYVDFE SE GVA+GQACVFY
Sbjct: 301 NWLGDGSFEDVVVDGFKCFAKIRSSQDPVSVFVKRDDSGVYVDFENSEEGVAAGQACVFY 360

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           +SDSN+AR+LGGG IS SKRSD VE+SL S++
Sbjct: 361 SSDSNDARILGGGFISCSKRSDKVEKSLFSIM 392


>gi|222086955|ref|YP_002545489.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Agrobacterium radiobacter K84]
 gi|254811443|sp|B9J9F7|MNMA_AGRRK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|221724403|gb|ACM27559.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Agrobacterium radiobacter K84]
          Length = 399

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 240/393 (61%), Positives = 298/393 (75%), Gaps = 1/393 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P+D RVVVAMSGGVDSSVVA +LKR GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEDTRVVVAMSGGVDSSVVAGILKRQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     D   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSADHPGRRALYRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K   R LA EMGL +A K+DSQDICFV QGKY DV+ ++    AL G+IVHL
Sbjct: 181 RFPLGGMPKAETRALAEEMGLVVAKKADSQDICFVPQGKYSDVIAKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI++YTIGQRRG+GVA G+PL+VV+LD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGRHEGILHYTIGQRRGIGVATGDPLYVVFLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD  L E A  +GF C+ K+RS++ P P  ++ + DG+YVD    E GVA GQAC  
Sbjct: 301 NWLGDEPLLEAASGEGFACYAKVRSTRPPEPAVLRADKDGIYVDLTIGEAGVAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y++  ++ARV GGG I  S+R    E SL +++
Sbjct: 361 YSAPGDDARVYGGGFIERSEREPMAEASLKALL 393


>gi|222149632|ref|YP_002550589.1| tRNA-specific 2-thiouridylase MnmA [Agrobacterium vitis S4]
 gi|221736614|gb|ACM37577.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Agrobacterium vitis S4]
          Length = 402

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 295/392 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P+D RVVVAMSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 5   VNTLDFDKRPEDTRVVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCC 64

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR+ VI PF  SY AGETP+PCV CN+TVKF+D
Sbjct: 65  AGQDIDDARRVCETLGIPHYVLDYEQRFRDTVINPFMDSYIAGETPIPCVACNQTVKFAD 124

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR     +    R + RP+D ERDQSYFLFATTQ+Q+  L
Sbjct: 125 LLATARELGADALATGHYIRSRATPLPNDPGHRALFRPIDSERDQSYFLFATTQEQIDYL 184

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA +MGL +A K+DSQDICFV QGKY D++ ++    AL GDIVHL
Sbjct: 185 RFPLGGLSKAETRKLAEDMGLVVAQKADSQDICFVPQGKYADIINKLKPNAALSGDIVHL 244

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI++YTIGQR+GLGVA GEPL+VVYLD  S RVIVGPRE+LE  R+YLR+I
Sbjct: 245 DGRVLGQHEGILHYTIGQRKGLGVATGEPLYVVYLDARSRRVIVGPREALETRRVYLRDI 304

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ED    GF CF K+RS++ P P  +  ++ G+YVD +  E GVA GQACV Y
Sbjct: 305 NWLGDRAIEDEASGGFACFAKVRSTRPPAPAHLHADETGIYVDLDMGEAGVAPGQACVLY 364

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           + +  +ARV GGG I  S+R    E  L +++
Sbjct: 365 SGEGADARVYGGGFIERSERQAEAETFLKALL 396


>gi|190893264|ref|YP_001979806.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Rhizobium etli CIAT 652]
 gi|229486418|sp|B3PYW4|MNMA_RHIE6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|190698543|gb|ACE92628.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Rhizobium etli CIAT 652]
          Length = 408

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 235/396 (59%), Positives = 296/396 (74%), Gaps = 1/396 (0%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R G
Sbjct: 7   APPLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAG 66

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           SCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVK
Sbjct: 67  SCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVK 126

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F+DLL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+
Sbjct: 127 FADLLATAKELGADALATGHYIRSRPNPSPEHPGRRALFRPADADRDQSYFLFATTQEQI 186

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+I
Sbjct: 187 DYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEI 246

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           VHL+G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YL
Sbjct: 247 VHLDGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYL 306

Query: 306 REINWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           R++NWLGD  L E A  +GF C+ K+RS++ P P  +  +  G YVD    E G+A GQA
Sbjct: 307 RDVNWLGDETLGEAASGEGFACYAKVRSTRAPAPAVLHVDATGTYVDLTVGEAGIAPGQA 366

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           C  Y++  ++ARV GGG I  S+R  A E SL +++
Sbjct: 367 CALYSAPGDDARVFGGGFIERSEREPAAEASLKALL 402


>gi|327192984|gb|EGE59899.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase protein
           [Rhizobium etli CNPAF512]
          Length = 399

 Score =  505 bits (1301), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 234/393 (59%), Positives = 295/393 (75%), Gaps = 1/393 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSPEHPGRRALFRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD  L E A  DGF C+ K+RS++ P P  +  +  G YVD    E G+A GQAC  
Sbjct: 301 NWLGDETLAEAASGDGFACYAKVRSTRAPAPAVLHVDATGTYVDLTVGEAGIAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y++  ++ARV GGG I  S+R  A E SL +++
Sbjct: 361 YSAPGDDARVFGGGFIERSEREPAAEASLKALL 393


>gi|86359043|ref|YP_470935.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli CFN 42]
 gi|123510891|sp|Q2K4M8|MNMA_RHIEC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|86283145|gb|ABC92208.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferaseprotein
           [Rhizobium etli CFN 42]
          Length = 408

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/396 (58%), Positives = 295/396 (74%), Gaps = 1/396 (0%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R G
Sbjct: 7   APPLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAG 66

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           SCCAGQD+ DAR VC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVK
Sbjct: 67  SCCAGQDIDDARHVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVK 126

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F+DLL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+
Sbjct: 127 FADLLATAKELGADALATGHYIRSRPNPSSEHPGRRALFRPADADRDQSYFLFATTQEQI 186

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+I
Sbjct: 187 DYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEI 246

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           VHL+G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YL
Sbjct: 247 VHLDGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYL 306

Query: 306 REINWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           R++NWLGD  L E A  +GF C+ K+RS++ P P  +  +  G YVD    E G+A GQA
Sbjct: 307 RDVNWLGDETLAEAASGEGFACYAKVRSTRAPAPAVLHVDATGTYVDLTIGEAGIAPGQA 366

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           C  Y++  ++ARV GGG I  S+R  + E SL +++
Sbjct: 367 CALYSAPGDDARVFGGGFIERSEREPSAEASLKALL 402


>gi|218675488|ref|ZP_03525157.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli GR56]
          Length = 399

 Score =  502 bits (1293), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/393 (58%), Positives = 294/393 (74%), Gaps = 1/393 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSLEHPGRRALFRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGDGLFEDAVV-DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD    DA   +GF C+ K+RS++ P P  +  +  G YVD    E G+A GQAC  
Sbjct: 301 NWLGDETLADAASGEGFACYAKVRSTRAPAPAVLHVDSTGTYVDLTVGEAGIAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y++  ++ARV GGG I  S+R  + E SL +++
Sbjct: 361 YSAPGDDARVFGGGFIERSEREPSAEASLKALL 393


>gi|209550765|ref|YP_002282682.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226704775|sp|B5ZNK8|MNMA_RHILW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209536521|gb|ACI56456.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 399

 Score =  501 bits (1291), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 231/393 (58%), Positives = 294/393 (74%), Gaps = 1/393 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKQPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSPEHPGRRALYRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           NWLGD  L + A  DGF C+ K+RS++ P P  +  +  G YVD    E G+A GQAC  
Sbjct: 301 NWLGDETLAQAATGDGFACYAKVRSTRAPAPAVLHIDATGTYVDLTVGEAGIAPGQACAL 360

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y++  + ARV GGG I  S+R  + E SL +++
Sbjct: 361 YSAPGDNARVFGGGFIERSEREPSAEASLKALL 393


>gi|325063117|gb|ADY66807.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Agrobacterium sp. H13-3]
          Length = 402

 Score =  501 bits (1290), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 295/392 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P+D R+VVAMSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 5   VNTLDFDKRPEDTRIVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCC 64

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE RFR  VI PFA +YA GETP+PCV CN+TVKF+D
Sbjct: 65  AGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKFAD 124

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         RR + RP+D +RDQS+FLFATTQ+Q+  L
Sbjct: 125 LLATAQELGADALATGHYIRSRPNPVAGQPGRRALYRPIDSDRDQSWFLFATTQEQIDYL 184

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA +MGL +A K+DSQDICFV QGKY D++ ++    AL GDIVHL
Sbjct: 185 RFPLGGLSKAETRALAEDMGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIVHL 244

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH+GI++YTIGQRRG+GVA GEPL+VV+LD    RVIVGPRE+LE  R+YLR++
Sbjct: 245 DGRVLGRHDGIVHYTIGQRRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLRDM 304

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    GF CF K+RS++ P    +  +++G+YVD    E GVA GQACV Y
Sbjct: 305 NWLGDGALADEAGQGFACFAKVRSTRPPTEAMLHADENGIYVDLMTGEAGVAPGQACVLY 364

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           ++   +ARV GGG I  S+RS   E SL +++
Sbjct: 365 SAPGADARVYGGGFIERSERSVDAEASLKALL 396


>gi|24638313|sp|Q8U9M5|MNMA_AGRT5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 398

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 294/392 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P+D R+VVAMSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKRPEDTRIVVAMSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE RFR  VI PFA +YA GETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         RR + RP+D +RDQS+FLFATTQ+Q+  L
Sbjct: 121 LLATAQELGADALATGHYIRSRPNPVSGQPGRRALYRPIDSDRDQSWFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL GDIVHL
Sbjct: 181 RFPLGGLSKAETRALAEEMGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH+GI++YTIGQRRG+GVA GEPL+VV+LD    RVIVGPRE+LE  R+YLR++
Sbjct: 241 DGRVLGRHDGIVHYTIGQRRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLRDM 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG        GF CF K+RS++ P    +  +++G+YVD    E GVA GQACV Y
Sbjct: 301 NWLGDGALAADAGQGFTCFAKVRSTRPPTEAVLHADENGIYVDLMTGEAGVAPGQACVLY 360

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           ++   +ARV GGG I  S+RS   E SL +++
Sbjct: 361 SAPGPDARVYGGGFIDRSERSVDAEASLKALL 392


>gi|15966466|ref|NP_386819.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti 1021]
 gi|24638324|sp|Q92MB5|MNMA_RHIME RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|15075737|emb|CAC47292.1| Putative tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Sinorhizobium meliloti 1021]
          Length = 398

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/380 (61%), Positives = 287/380 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         +R + RP D ERDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPKPRYAGQRALYRPADAERDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RVIVGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDSRSRRVIVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E A   GF+CF K+RS++ P P  ++ + +G+YV+  + E GVA GQAC  Y
Sbjct: 301 NWLGDEELEAAAGQGFECFAKVRSTRRPAPAVLKSDAEGLYVELVEGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKR 388
           +    +ARV GGG I  S+R
Sbjct: 361 SGTGEDARVYGGGFIRRSER 380


>gi|307300497|ref|ZP_07580277.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti BL225C]
 gi|307318362|ref|ZP_07597797.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306896044|gb|EFN26795.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti AK83]
 gi|306904663|gb|EFN35247.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium meliloti BL225C]
          Length = 398

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 234/380 (61%), Positives = 287/380 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         +R + RP D ERDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPKPRYAGQRALYRPADAERDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RVIVGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVIVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E A   GF+CF K+RS++ P P  ++ + +G+YV+  + E GVA GQAC  Y
Sbjct: 301 NWLGDEELEAAAGQGFECFAKVRSTRRPAPAVLKSDAEGLYVELVEGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKR 388
           +    +ARV GGG I  S+R
Sbjct: 361 SGTGEDARVYGGGFIRRSER 380


>gi|116253697|ref|YP_769535.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|205816894|sp|Q1MC84|MNMA_RHIL3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|115258345|emb|CAK09447.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 408

 Score =  498 bits (1283), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/396 (58%), Positives = 292/396 (73%), Gaps = 1/396 (0%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R G
Sbjct: 7   APSLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAG 66

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           SCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVK
Sbjct: 67  SCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVK 126

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F+DLL+  ++LGAD LATGHYIRS      +   RR + RP D +RDQSYFLFATTQ+Q+
Sbjct: 127 FADLLATAKELGADALATGHYIRSGRNPSPENPGRRALFRPADADRDQSYFLFATTQEQI 186

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY DV+ ++    AL G+I
Sbjct: 187 DYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDVITKLKPNAALAGEI 246

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           VHL+G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR+YL
Sbjct: 247 VHLDGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHRVYL 306

Query: 306 REINWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           R++NWLGD  L E A   GF C+ K+RS++ P P  +  +  G YVD    E G+A GQA
Sbjct: 307 RDVNWLGDETLAEAAAGKGFACYAKVRSTRAPAPAVLHIDATGTYVDLTVGEAGIAPGQA 366

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           C  Y++  + ARV GGG I  S+R  + E  L +++
Sbjct: 367 CALYSAPGDNARVFGGGFIERSEREPSAEACLKALL 402


>gi|241206171|ref|YP_002977267.1| tRNA-specific 2-thiouridylase MnmA [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860061|gb|ACS57728.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 403

 Score =  498 bits (1282), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 233/396 (58%), Positives = 292/396 (73%), Gaps = 1/396 (0%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R G
Sbjct: 2   APSLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAG 61

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           SCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVK
Sbjct: 62  SCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVK 121

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F+DLL+  ++LGAD LATGHYIRS      D   RR + RP D +RDQSYFLFATTQ+Q+
Sbjct: 122 FADLLATAKELGADALATGHYIRSGRNPSPDNPGRRALFRPADADRDQSYFLFATTQEQI 181

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY DV+ ++    AL G+I
Sbjct: 182 DYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDVITKLKPNAALAGEI 241

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           VHL+G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR+YL
Sbjct: 242 VHLDGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHRVYL 301

Query: 306 REINWLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           R++NWLGD  L E A   GF C+ K+RS++ P P  +  +  G YVD    E G+A GQA
Sbjct: 302 RDVNWLGDETLAEAAAGKGFACYAKVRSTRAPAPAVLHIDAIGTYVDLTVGEAGIAPGQA 361

Query: 365 CVFYTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           C  Y++  + ARV GGG I  S+R  + E  L +++
Sbjct: 362 CALYSAPGDNARVFGGGFIERSEREPSAEACLKALL 397


>gi|227823283|ref|YP_002827255.1| tRNA-specific 2-thiouridylase MnmA [Sinorhizobium fredii NGR234]
 gi|254811457|sp|C3MI00|MNMA_RHISN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|227342284|gb|ACP26502.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium fredii NGR234]
          Length = 398

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 287/380 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR       + +R + RP D ERDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPKPRYQGQRALYRPTDAERDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGNLSKPETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALGGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RVIVGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGTHEGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVIVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   + A   GF CF K+RS++ P P  ++ + DG+YV+    E GVA GQAC  Y
Sbjct: 301 NWLGDEEIDAAASRGFACFAKVRSTRQPAPAEMKCDADGIYVELVDGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKR 388
           +    +ARV GGG I  S+R
Sbjct: 361 SGTGEDARVYGGGFIRKSER 380


>gi|150397798|ref|YP_001328265.1| tRNA-specific 2-thiouridylase MnmA [Sinorhizobium medicae WSM419]
 gi|205828972|sp|A6UCQ0|MNMA_SINMW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|150029313|gb|ABR61430.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sinorhizobium medicae WSM419]
          Length = 398

 Score =  492 bits (1267), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 232/380 (61%), Positives = 286/380 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD D+ P+D RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNSLDFDRKPEDTRVVVAMSGGVDSSVVAGLLKREGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+TI + HYV DYE RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETIGIPHYVLDYEARFRETVINPFAESYIAGETPIPCVACNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR         +R + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPSPMPRYPGQRALYRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D+V ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKSETRALAEEMGLVVAKKADSQDICFVPQGKYSDIVSKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI++YTIGQRRG+GVA GEPL+VVYLD  S RV+VGP+E+LE  R+YLR++
Sbjct: 241 DGRVLGAHEGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVVVGPKEALETRRVYLRDV 300

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E A   GF+CF K+RS++ P P  +  + +G+YV+  + E GVA GQAC  Y
Sbjct: 301 NWLGDEELEAAARSGFECFAKVRSTRRPAPAVLSCDAEGLYVELVEGEAGVAPGQACALY 360

Query: 369 TSDSNEARVLGGGIISGSKR 388
           +    +ARV GGG I  S+R
Sbjct: 361 SGIGEDARVYGGGFIRRSER 380


>gi|319408925|emb|CBI82582.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella schoenbuchensis R1]
          Length = 409

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 292/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P++ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R GSCC
Sbjct: 3   LNSLDLPGQPENSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGVATHRVGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARR+ +T+N+ HYV DYEERFR AVI PF  SY  GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIEDARRIAETLNIPHYVLDYEERFREAVIDPFTESYTHGETPVPCVACNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR          R + RP+D ERDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSR-----SCGAHRALFRPLDAERDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +ADK DSQDICFV QGKY DV+ ++       G I+H+
Sbjct: 178 RFPLGDLPKARVREIAAEMGFVVADKHDSQDICFVPQGKYSDVITKLRPESTNPGIIMHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NGQILG H+GIINYT+GQRRG+G+A GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 NGQILGEHSGIINYTVGQRRGIGIATGEALYVVYLDAENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++   +G    VKIRS++ P P  +   +    VD  +SE GVA GQACVFY
Sbjct: 298 NWLGDEQLDNFPPNGIDVVVKIRSTRPPRPARLHYQNGVFSVDLLESESGVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +SNEARVLGGG I+ S+RS   E  L  V+
Sbjct: 358 NENSNEARVLGGGFITHSERSAGAEAMLKQVL 389


>gi|319781789|ref|YP_004141265.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317167677|gb|ADV11215.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 396

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 287/388 (73%), Gaps = 5/388 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P++ R+VVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCC
Sbjct: 1   MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRS    G +G +R +  RP+D +RDQSYFLFATTQ Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRS----GANGAQRALY-RPVDADRDQSYFLFATTQAQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR +A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 176 RFPLGGLSKPQVRAIAEEMGLAVAAKQDSQDICFVPQGKYSDIIAKLKPTAANPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI+ YTIGQRRG+G+A GEPL+VV+LD + +RV+VGPRE+LE H+IYLR +
Sbjct: 236 DGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDADRARVVVGPREALETHKIYLRNM 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    G + F K+RS++ P P  +       +V+    E G+A GQACV Y
Sbjct: 296 NWLGDGPLTDVPAGGLELFAKVRSTRPPRPAVLHHRAGATWVELVDGESGIAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESL 396
           + D NEARV GGG I  S+R    E  L
Sbjct: 356 SDDGNEARVFGGGFIERSERGAEAEAML 383


>gi|153008906|ref|YP_001370121.1| tRNA-specific 2-thiouridylase MnmA [Ochrobactrum anthropi ATCC
           49188]
 gi|166235072|sp|A6WZ88|MNMA_OCHA4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|151560794|gb|ABS14292.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ochrobactrum anthropi ATCC 49188]
          Length = 398

 Score =  488 bits (1257), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/394 (58%), Positives = 290/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEEMGLTVAKKQDSQDICFVPQGKYSDIISKLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GEPL+VV+LD  ++RVIVGPRE+LE H+++LR+I
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEPLYVVHLDAANARVIVGPREALETHKVFLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDAPISDLPEGGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + +SN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDESNTARVFGGGFIGRSEREPQAEEMLRRLVAN 391


>gi|163758747|ref|ZP_02165834.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hoeflea phototrophica DFL-43]
 gi|162284037|gb|EDQ34321.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hoeflea phototrophica DFL-43]
          Length = 401

 Score =  488 bits (1256), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 230/392 (58%), Positives = 297/392 (75%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLD+DK+P+D RVVVAMSGGVDSSVVA LL R+GYDV+GVTLQLY+   A  R G+CC
Sbjct: 6   VNSLDIDKDPRDTRVVVAMSGGVDSSVVAGLLAREGYDVLGVTLQLYDHGAAVHRAGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+ + + HYV DYE+RF+ AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 66  AGQDIDDARRVCEVLGIPHYVLDYEKRFQEAVINPFAESYVAGETPIPCVACNQTVKFAD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R LGAD LATGHYIRSR     D   RR + RP+D ERDQSYFLFATTQ QL  +
Sbjct: 126 LLATARDLGADALATGHYIRSRANPSADNPGRRALYRPIDSERDQSYFLFATTQDQLDYV 185

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K   R+LA EMGL +A K+DSQDICFV  GKY +V++++    AL G+IVH+
Sbjct: 186 RFPLGELPKIRTRELAEEMGLTVAQKADSQDICFVPHGKYANVIEKLRPNSALAGEIVHI 245

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+GVA+G+PL+VV+LD  S RVIVGPRE+L+  R+ LR++
Sbjct: 246 DGRVLGEHPGIVHFTIGQRRGIGVAVGDPLYVVHLDARSKRVIVGPREALDTRRLILRDM 305

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   +D   +G  CF K+RS++ P P  ++  +  + V+  + E GVA GQACV Y
Sbjct: 306 NWLGDFALDDLGPEGLSCFAKVRSTRPPRPAVLRYENGEISVELVEGESGVAPGQACVLY 365

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           ++  +EARV GGG I  S+RS A E  L +++
Sbjct: 366 SAPGDEARVFGGGFIDRSERSAAAEAMLANLL 397


>gi|239832470|ref|ZP_04680799.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ochrobactrum intermedium LMG 3301]
 gi|239824737|gb|EEQ96305.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ochrobactrum intermedium LMG 3301]
          Length = 411

 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/394 (58%), Positives = 290/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 16  LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 75

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 76  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 135

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 136 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 190

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 191 RFPLGHLPKAQVREIAEEMGLTVAKKQDSQDICFVPQGKYSDIISKLKPEAANPGDIVHI 250

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GEPL+VV+LD  ++RVIVGPRE+LE H+++LR+I
Sbjct: 251 DGRTLGRHDGIVHYTVGQRRGIGVATGEPLYVVHLDAANARVIVGPREALETHKVFLRDI 310

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 311 NWLGDAPIGDLPEGGIEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 370

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + +SN ARV GGG I  S+R    EE L  ++ +
Sbjct: 371 SDESNTARVFGGGFIGRSEREPQAEEMLRRLVAN 404


>gi|306844591|ref|ZP_07477178.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO1]
 gi|306275035|gb|EFM56798.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO1]
          Length = 398

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/394 (58%), Positives = 290/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+DMRVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDMRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|110634566|ref|YP_674774.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium sp. BNC1]
 gi|123353475|sp|Q11G66|MNMA_MESSB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110285550|gb|ABG63609.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Chelativorans sp. BNC1]
          Length = 391

 Score =  486 bits (1250), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/390 (59%), Positives = 287/390 (73%), Gaps = 6/390 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P+  RVVVAMSGGVDSSVVA LL R+GY+V+GVTLQLY+   A  R GSCC
Sbjct: 1   MNSLDLPGRPEATRVVVAMSGGVDSSVVAGLLAREGYEVVGVTLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ ++HYV DYEERFR AVI PFA SY  GETP+PCV CN+TVKFSD
Sbjct: 61  AGQDIDDARRVAETLGIAHYVLDYEERFRKAVIDPFAESYVTGETPIPCVACNQTVKFSD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLETARELGADALATGHYIRSRA-----NGAHRALYRPVDADRDQSYFLFATTQEQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K  VR +A EMGL +A K DSQDICFV +GKY DV+ ++  G A  GDIVH+
Sbjct: 176 RFPLGGMSKPQVRAIAEEMGLSVAAKHDSQDICFVPRGKYSDVITKLKPGAASPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI++YTIGQRRG+G+A GEPL+VV+LD   +RV+VGPRE+LE  R+ LR++
Sbjct: 236 DGRVLGRHEGILHYTIGQRRGIGIAAGEPLYVVHLDAEHARVVVGPREALETRRLILRQV 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E+   +G   F K+RS++ P P  +   D   +V+  + E GVA GQACV Y
Sbjct: 296 NWLGDFPLEELPANGMDLFAKVRSTRPPTPATLHNRDGSTWVELHEGETGVAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           + D N+ARV GGG I  S+R  A  E+LLS
Sbjct: 356 SDDRNDARVFGGGFIERSERC-ADAEALLS 384


>gi|163843840|ref|YP_001628244.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella suis ATCC 23445]
 gi|189036219|sp|B0CI68|MNMA_BRUSI RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|163674563|gb|ABY38674.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella suis ATCC 23445]
          Length = 398

 Score =  485 bits (1248), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 229/394 (58%), Positives = 289/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHSAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|254719618|ref|ZP_05181429.1| tRNA-specific 2-thiouridylase MnmA [Brucella sp. 83/13]
 gi|265984628|ref|ZP_06097363.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. 83/13]
 gi|306837544|ref|ZP_07470417.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella sp. NF 2653]
 gi|264663220|gb|EEZ33481.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. 83/13]
 gi|306407370|gb|EFM63576.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella sp. NF 2653]
          Length = 398

 Score =  484 bits (1247), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 230/394 (58%), Positives = 289/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQAARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F KIRS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKIRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|23502454|ref|NP_698581.1| tRNA-specific 2-thiouridylase MnmA [Brucella suis 1330]
 gi|62290471|ref|YP_222264.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 1 str.
           9-941]
 gi|82700395|ref|YP_414969.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis biovar
           Abortus 2308]
 gi|148559837|ref|YP_001259458.1| tRNA-specific 2-thiouridylase MnmA [Brucella ovis ATCC 25840]
 gi|189024699|ref|YP_001935467.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus S19]
 gi|225628026|ref|ZP_03786062.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella ceti str. Cudo]
 gi|225853065|ref|YP_002733298.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis ATCC 23457]
 gi|237815980|ref|ZP_04594977.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus str. 2308 A]
 gi|254689772|ref|ZP_05153026.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 6 str.
           870]
 gi|254694261|ref|ZP_05156089.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697916|ref|ZP_05159744.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254702309|ref|ZP_05164137.1| tRNA-specific 2-thiouridylase MnmA [Brucella suis bv. 5 str. 513]
 gi|254704837|ref|ZP_05166665.1| tRNA-specific 2-thiouridylase MnmA [Brucella suis bv. 3 str. 686]
 gi|254708251|ref|ZP_05170079.1| tRNA-specific 2-thiouridylase MnmA [Brucella pinnipedialis
           M163/99/10]
 gi|254710623|ref|ZP_05172434.1| tRNA-specific 2-thiouridylase MnmA [Brucella pinnipedialis B2/94]
 gi|254714807|ref|ZP_05176618.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti M644/93/1]
 gi|254717867|ref|ZP_05179678.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti M13/05/1]
 gi|254730806|ref|ZP_05189384.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 4 str.
           292]
 gi|256032116|ref|ZP_05445730.1| tRNA-specific 2-thiouridylase MnmA [Brucella pinnipedialis
           M292/94/1]
 gi|256061638|ref|ZP_05451777.1| tRNA-specific 2-thiouridylase MnmA [Brucella neotomae 5K33]
 gi|256114160|ref|ZP_05454914.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160312|ref|ZP_05458006.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti M490/95/1]
 gi|256255517|ref|ZP_05461053.1| tRNA-specific 2-thiouridylase MnmA [Brucella ceti B1/94]
 gi|256258024|ref|ZP_05463560.1| tRNA-specific 2-thiouridylase MnmA [Brucella abortus bv. 9 str.
           C68]
 gi|256263452|ref|ZP_05465984.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 2 str.
           63/9]
 gi|256370004|ref|YP_003107515.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella microti CCM 4915]
 gi|260169251|ref|ZP_05756062.1| tRNA-specific 2-thiouridylase MnmA [Brucella sp. F5/99]
 gi|260547004|ref|ZP_05822743.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus NCTC 8038]
 gi|260755305|ref|ZP_05867653.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 6 str.
           870]
 gi|260758526|ref|ZP_05870874.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 4 str.
           292]
 gi|260762350|ref|ZP_05874693.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884320|ref|ZP_05895934.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 9 str.
           C68]
 gi|261214569|ref|ZP_05928850.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 3 str.
           Tulya]
 gi|261219714|ref|ZP_05933995.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M13/05/1]
 gi|261222726|ref|ZP_05937007.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti B1/94]
 gi|261315753|ref|ZP_05954950.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M163/99/10]
 gi|261318196|ref|ZP_05957393.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis B2/94]
 gi|261322603|ref|ZP_05961800.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M644/93/1]
 gi|261325648|ref|ZP_05964845.1| tRNA-specific 2-thiouridylase mnmA [Brucella neotomae 5K33]
 gi|261752876|ref|ZP_05996585.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 5 str. 513]
 gi|261755533|ref|ZP_05999242.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 3 str. 686]
 gi|261758765|ref|ZP_06002474.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. F5/99]
 gi|265989227|ref|ZP_06101784.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M292/94/1]
 gi|265995479|ref|ZP_06108036.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998689|ref|ZP_06111246.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M490/95/1]
 gi|294852904|ref|ZP_06793577.1| tRNA methyl transferase [Brucella sp. NVSL 07-0026]
 gi|297248856|ref|ZP_06932574.1| tRNA methyl transferase [Brucella abortus bv. 5 str. B3196]
 gi|306843064|ref|ZP_07475687.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO2]
 gi|38258585|sp|Q8CY38|MNMA_BRUSU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|71658011|sp|Q57BT1|MNMA_BRUAB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|123547133|sp|Q2YQB2|MNMA_BRUA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166234846|sp|A5VRW1|MNMA_BRUO2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|229486334|sp|B2S746|MNMA_BRUA1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|254811446|sp|C0REM2|MNMA_BRUMB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|23348445|gb|AAN30496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella suis 1330]
 gi|62196603|gb|AAX74903.1| TrmU, tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616496|emb|CAJ11563.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis biovar Abortus 2308]
 gi|148371094|gb|ABQ61073.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella ovis ATCC 25840]
 gi|189020271|gb|ACD72993.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus S19]
 gi|225617189|gb|EEH14235.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella ceti str. Cudo]
 gi|225641430|gb|ACO01344.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis ATCC 23457]
 gi|237789278|gb|EEP63489.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella abortus str. 2308 A]
 gi|256000167|gb|ACU48566.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella microti CCM 4915]
 gi|260096054|gb|EEW79931.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus NCTC 8038]
 gi|260668844|gb|EEX55784.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 4 str.
           292]
 gi|260672782|gb|EEX59603.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675413|gb|EEX62234.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 6 str.
           870]
 gi|260873848|gb|EEX80917.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 9 str.
           C68]
 gi|260916176|gb|EEX83037.1| tRNA-specific 2-thiouridylase mnmA [Brucella abortus bv. 3 str.
           Tulya]
 gi|260921310|gb|EEX87963.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti B1/94]
 gi|260924803|gb|EEX91371.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M13/05/1]
 gi|261295293|gb|EEX98789.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M644/93/1]
 gi|261297419|gb|EEY00916.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis B2/94]
 gi|261301628|gb|EEY05125.1| tRNA-specific 2-thiouridylase mnmA [Brucella neotomae 5K33]
 gi|261304779|gb|EEY08276.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M163/99/10]
 gi|261738749|gb|EEY26745.1| tRNA-specific 2-thiouridylase mnmA [Brucella sp. F5/99]
 gi|261742629|gb|EEY30555.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 5 str. 513]
 gi|261745286|gb|EEY33212.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 3 str. 686]
 gi|262553313|gb|EEZ09147.1| tRNA-specific 2-thiouridylase mnmA [Brucella ceti M490/95/1]
 gi|262766592|gb|EEZ12381.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093459|gb|EEZ17509.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661424|gb|EEZ31685.1| tRNA-specific 2-thiouridylase mnmA [Brucella pinnipedialis
           M292/94/1]
 gi|294821493|gb|EFG38492.1| tRNA methyl transferase [Brucella sp. NVSL 07-0026]
 gi|297176025|gb|EFH35372.1| tRNA methyl transferase [Brucella abortus bv. 5 str. B3196]
 gi|306286743|gb|EFM58293.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brucella sp. BO2]
 gi|326409608|gb|ADZ66673.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis M28]
 gi|326539311|gb|ADZ87526.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella melitensis M5-90]
          Length = 398

 Score =  484 bits (1246), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/394 (58%), Positives = 289/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|260462497|ref|ZP_05810704.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium opportunistum WSM2075]
 gi|259031693|gb|EEW32962.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mesorhizobium opportunistum WSM2075]
          Length = 396

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/390 (59%), Positives = 288/390 (73%), Gaps = 6/390 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P++ R+VVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCC
Sbjct: 1   MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRS    G +G  R +  RP+D +RDQSYFLFATTQ Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRS----GANGAHRALY-RPVDADRDQSYFLFATTQAQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR +A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 176 RFPLGGLSKPQVRAIAEEMGLTVAAKQDSQDICFVPQGKYSDIIAKLKPSAANPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI+ YTIGQRRG+G+A GEPL+VV+LD   +RV+VGPRE+LE  +IYLR +
Sbjct: 236 DGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDAERARVVVGPREALETRKIYLRNM 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    G + F K+RS++ P P  ++       V+    E G+A GQACV Y
Sbjct: 296 NWLGDGQLTDIPAGGIELFAKVRSTRPPRPAVLRHEAGVTSVELADGESGIAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           + D NEARV GGG I  S+R  A  E++LS
Sbjct: 356 SDDGNEARVFGGGFIERSERG-AEAEAMLS 384


>gi|24638328|sp|Q98HL0|MNMA_RHILO RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 396

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 285/388 (73%), Gaps = 5/388 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL   P++ R+VVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCC
Sbjct: 1   MNSLDLPGRPENTRIVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVSETLGIPHYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRS    G +G  R +  RP+D +RDQSYFLFATTQ Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRS----GANGAHRALY-RPVDADRDQSYFLFATTQAQIDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR +A EMGL +A K DSQDICFV QGKY D++ ++    A  GDIVH+
Sbjct: 176 RFPLGGLSKPQVRAIAEEMGLTVAAKQDSQDICFVPQGKYSDIIAKLKPAAANPGDIVHI 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH GI+ YTIGQRRG+G+A GEPL+VV+LD   +RV+VGPRE+LE H+IYLR +
Sbjct: 236 DGRVLGRHEGILRYTIGQRRGIGIASGEPLYVVHLDAERARVVVGPREALETHKIYLRNM 295

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGDG   D    G + F K+RS++ P P  ++       V+    E G+A GQACV Y
Sbjct: 296 NWLGDGPLGDIPEGGLELFAKVRSTRPPRPAVLRYVAGVTSVELADGESGIAPGQACVLY 355

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESL 396
           + D NEARV GGG I  S+R    E  L
Sbjct: 356 SDDGNEARVFGGGFIERSERGAEAEAML 383


>gi|161619531|ref|YP_001593418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella canis ATCC 23365]
 gi|260565920|ref|ZP_05836390.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 4 str. 40]
 gi|189036218|sp|A9M700|MNMA_BRUC2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|161336342|gb|ABX62647.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brucella canis ATCC 23365]
 gi|260155438|gb|EEW90518.1| tRNA-specific 2-thiouridylase mnmA [Brucella suis bv. 4 str. 40]
          Length = 398

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/394 (57%), Positives = 288/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL    +D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKSEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN ARV GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAARVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|17986711|ref|NP_539345.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis bv. 1 str.
           16M]
 gi|256045209|ref|ZP_05448107.1| tRNA-specific 2-thiouridylase MnmA [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260565193|ref|ZP_05835677.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 1 str.
           16M]
 gi|265991642|ref|ZP_06104199.1| tRNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
 gi|24638318|sp|Q8YIL6|MNMA_BRUME RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|17982334|gb|AAL51609.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Brucella melitensis bv. 1 str. 16M]
 gi|260151261|gb|EEW86355.1| tRNA-specific 2-thiouridylase mnmA [Brucella melitensis bv. 1 str.
           16M]
 gi|263002426|gb|EEZ15001.1| tRNA methyltransferase [Brucella melitensis bv. 1 str. Rev.1]
          Length = 398

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/394 (57%), Positives = 288/394 (73%), Gaps = 5/394 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVA +LKR+GYDV+GVTLQLY+   A  R GSCC
Sbjct: 3   LNSLDLPGKPEDTRVVVAMSGGVDSSVVAGILKREGYDVVGVTLQLYDHGAAVHRAGSCC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +++ + HYV DYE RFR AVI PFA+SY +GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVSESLGIPHYVLDYEARFREAVIDPFANSYVSGETPIPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHYIRSR          R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLQTARDLGADALATGHYIRSRA-----NGAHRALYRPVDTDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K  VR++A E+GL +A K DSQDICFV QGKY D++ R+    A  GDIVH+
Sbjct: 178 RFPLGHLPKAQVREIAEELGLTVAKKQDSQDICFVPQGKYSDIISRLKPEAANPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GI++YT+GQRRG+GVA GE L+VV+LD  ++RVIVGPRE+LE H+++LR++
Sbjct: 238 DGRTLGRHDGIVHYTVGQRRGIGVATGEALYVVHLDAANARVIVGPREALETHKVFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD    D    G + F K+RS++ P P  ++  D   +V+    E G+A GQACV Y
Sbjct: 298 NWLGDTPIADLPKSGMEVFAKVRSTRPPRPAVLRHADGQTWVELVDGESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGD 402
           + DSN A V GGG I  S+R    EE L  ++ +
Sbjct: 358 SDDSNAACVFGGGFIGRSEREPQAEEMLRRLMAN 391


>gi|319898474|ref|YP_004158567.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella clarridgeiae 73]
 gi|319402438|emb|CBI75979.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella clarridgeiae 73]
          Length = 409

 Score =  478 bits (1230), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/392 (58%), Positives = 296/392 (75%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL  +P++ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGHPENSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPVPCVSCNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+   +LGAD LATGHYIRSR++        R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATAYELGADALATGHYIRSRVH-----GAHRALFRPLDADRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K+ VR++A EMGL +A+K DSQDICFV QG+Y DV+ ++   +A  G IVH+
Sbjct: 178 RFPLGDLSKDRVREIATEMGLVVANKHDSQDICFVPQGRYSDVITKLRPEVANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQILG H+GI+NYT+GQRRG+GVA GE L+V+YLD  ++RVIVGPRE LE  R++LR++
Sbjct: 238 DGQILGEHSGIVNYTVGQRRGIGVATGEALYVIYLDVENARVIVGPREMLETRRLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++  +DG    VK+RS++ P P  +        VD  +SE G+A GQACV Y
Sbjct: 298 NWLGDERLDNFPLDGIDVAVKVRSTRPPRPARLHYKQGLFSVDLLESESGIAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S EAR+LGGG I+ S+ +   E+ L  V+
Sbjct: 358 NENSYEARILGGGFITRSEHAADTEKMLKQVL 389


>gi|121602707|ref|YP_989294.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella bacilliformis KC583]
 gi|166234845|sp|A1UTJ1|MNMA_BARBK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|120614884|gb|ABM45485.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella bacilliformis KC583]
          Length = 391

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/392 (59%), Positives = 290/392 (73%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P++ RVVVAMSGGVDSSVVA LLKR+GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGPPENSRVVVAMSGGVDSSVVAGLLKREGYDVVGITLQLYDHGAATHRAGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + +YV DYE RFR AVI PFA SYA GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLRIPYYVLDYESRFREAVIDPFAESYARGETPIPCVACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGAD LATGHYIRS  Y        R + RP+D ERDQSYFLFATTQ+Q+  L
Sbjct: 123 LLVTARELGADALATGHYIRSVSY-----GTHRALFRPLDSERDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K  VR++A+EMGL +ADK DSQDICFV QGKY DV+ ++    +  GDIVH+
Sbjct: 178 RFPLGNLPKARVREIAKEMGLTVADKHDSQDICFVPQGKYSDVIAKLRPEASNPGDIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NGQILG+H+GIINYT+GQRRG+GVA GE L+V++LD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 NGQILGQHSGIINYTVGQRRGIGVATGEALYVIFLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   E+   D      KIRS++ P P  +   +    VD  + E  VA GQACVFY
Sbjct: 298 NWLGDERLENFPSDCIDVAAKIRSTRPPRPARLYYKEGIFSVDLLEGESSVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
               + ARVLGGG I+ S+RS   EE L  V+
Sbjct: 358 NESGDGARVLGGGFITHSERSTDAEERLQRVL 389


>gi|319406809|emb|CBI80442.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella sp. 1-1C]
          Length = 409

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 229/392 (58%), Positives = 296/392 (75%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL  +PK+ RVVVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGHPKNSRVVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPIPCVSCNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+   +LGAD LATGHYIRSR++        R + R +D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLTTAYELGADALATGHYIRSRVH-----GAHRALFRSLDADRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ KE VR++A EMGL +A+K DSQDICFV QGKY D++ ++    A  G IVH+
Sbjct: 178 RFPLGDLSKERVREIATEMGLVVANKHDSQDICFVPQGKYSDIITKLRPEAANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQILG H+GI+NYTIGQRRG+GV+ GE L+V+YLD  ++ VIVGPRE LE  +++LR++
Sbjct: 238 DGQILGEHSGIVNYTIGQRRGIGVSTGEALYVIYLDVENACVIVGPREMLETRKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++  +DG +  VK+RS++ P    +       +VD  +SE GVA GQACV Y
Sbjct: 298 NWLGDEQLDNFPLDGIEVAVKVRSTRPPRSARLHYKQGSFFVDLLESESGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S+EAR+LGGG I+ ++R+   E+ L  V+
Sbjct: 358 NDNSHEARILGGGFITCAERAADTEKMLKRVL 389


>gi|319403803|emb|CBI77387.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella rochalimae ATCC BAA-1498]
          Length = 409

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/392 (58%), Positives = 295/392 (75%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL  +PK+ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGHPKNSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPIPCVSCNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+   +LGAD LATGHYIRSR +        R + R +D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLTTAYELGADALATGHYIRSRAH-----GAHRALFRSLDADRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ KE VR++A EMGL +A+K DSQDICFV QGKY D++ ++    A  G IVH+
Sbjct: 178 RFPLGDLSKERVREIATEMGLVVANKHDSQDICFVPQGKYSDIITKLRPEAANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQILG H+GI+NYTIGQRRG+GV+ GE L+V+YLD  ++ VIVGPRE LE  +++LR++
Sbjct: 238 DGQILGEHSGIVNYTIGQRRGIGVSTGEALYVIYLDVENACVIVGPREMLETRKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++  +DG +  VK+RS++ P    +       +VD  +SE GVA GQACV Y
Sbjct: 298 NWLGDEQLDNFPLDGIEVAVKVRSTRPPRSARLHYKQGSFFVDLLESESGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S+EAR+LGGG I+ ++R+   E+ L  V+
Sbjct: 358 NDNSHEARILGGGFITCAERAADTEKMLKKVL 389


>gi|159185866|ref|NP_356917.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Agrobacterium tumefaciens str. C58]
 gi|25298384|pir||AC3012 hypothetical protein trmU [imported] - Agrobacterium tumefaciens
           (strain C58, Dupont)
 gi|159141000|gb|AAK89702.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Agrobacterium tumefaciens str. C58]
          Length = 380

 Score =  474 bits (1221), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 222/374 (59%), Positives = 279/374 (74%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSSVVA +LKR+GYDV+G+TLQLY+   A  R GSCCAGQD+ DARRVC+T+ + 
Sbjct: 1   MSGGVDSSVVAGILKREGYDVLGITLQLYDHGAAVHRAGSCCAGQDIDDARRVCETLGIP 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HYV DYE RFR  VI PFA +YA GETP+PCV CN+TVKF+DLL+  ++LGAD LATGHY
Sbjct: 61  HYVLDYEARFRETVINPFAEAYAMGETPIPCVACNQTVKFADLLATAQELGADALATGHY 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
           IRSR         RR + RP+D +RDQS+FLFATTQ+Q+  LRFPLG + K   R LA E
Sbjct: 121 IRSRPNPVSGQPGRRALYRPIDSDRDQSWFLFATTQEQIDYLRFPLGGLSKAETRALAEE 180

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
           MGL +A K+DSQDICFV QGKY D++ ++    AL GDIVHL+G++LGRH+GI++YTIGQ
Sbjct: 181 MGLVVAKKADSQDICFVPQGKYTDIINKLKPNAALAGDIVHLDGRVLGRHDGIVHYTIGQ 240

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           RRG+GVA GEPL+VV+LD    RVIVGPRE+LE  R+YLR++NWLGDG        GF C
Sbjct: 241 RRGIGVATGEPLYVVHLDARGRRVIVGPREALETRRVYLRDMNWLGDGALAADAGQGFTC 300

Query: 327 FVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS 386
           F K+RS++ P    +  +++G+YVD    E GVA GQACV Y++   +ARV GGG I  S
Sbjct: 301 FAKVRSTRPPTEAVLHADENGIYVDLMTGEAGVAPGQACVLYSAPGPDARVYGGGFIDRS 360

Query: 387 KRSDAVEESLLSVI 400
           +RS   E SL +++
Sbjct: 361 ERSVDAEASLKALL 374


>gi|254470572|ref|ZP_05083976.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudovibrio sp. JE062]
 gi|211960883|gb|EEA96079.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pseudovibrio sp. JE062]
          Length = 400

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 224/396 (56%), Positives = 293/396 (73%), Gaps = 5/396 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L   P+D RVVVAMSGGVDSSVVA L+KR+GYDV+GVTLQLY+  +A +RKG+CC
Sbjct: 2   LNSLGLPGRPEDTRVVVAMSGGVDSSVVAGLMKREGYDVVGVTLQLYDHGEAIQRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARRV + + + HYV DYE RF+  VI  FA SY  GETP+PCV CN+TVKF D
Sbjct: 62  AGQDIHDARRVAEKLGIPHYVLDYESRFKEQVIERFADSYINGETPIPCVTCNQTVKFKD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + LGADVL TGHY+R+    G +G +   M RP+DL+RDQSYFLFATTQ+QL  L
Sbjct: 122 LLETAKDLGADVLVTGHYVRT----GMEGNQL-AMFRPVDLDRDQSYFLFATTQEQLDFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K  VR+LARE  L IADK DSQDICFV QG+Y DV+ ++    A  GDIVH+
Sbjct: 177 RFPLGGMTKPEVRELAREFDLAIADKHDSQDICFVPQGRYTDVIAKLRPHAAEPGDIVHV 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+HNGII+YTIGQRRG+GVA G+PL+VV+LD +  RVIVGP+E+L  H + LRE+
Sbjct: 237 DGRVLGKHNGIIHYTIGQRRGIGVATGDPLYVVHLDADGRRVIVGPKEALATHNLLLREV 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+G G  +D   +G   + K+RS++ P    +++N + + V+    E+GVA GQACVF+
Sbjct: 297 NWIGPGALDDLPEEGITVYAKVRSTRPPTEAVLRKNGENIQVELVAGEMGVAPGQACVFF 356

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVIGDEF 404
             +  EARVLGGG I  +++ +  E +L +++G  +
Sbjct: 357 DKEGQEARVLGGGWIQRAEKQEGAEAALKALLGKSW 392


>gi|319405239|emb|CBI78844.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella sp. AR 15-3]
          Length = 409

 Score =  471 bits (1212), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/393 (58%), Positives = 293/393 (74%), Gaps = 5/393 (1%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           RLNSLDL   P++ R+VVAMSGGVDSSVVA LLK++GYDV+G+TLQLY+   A+ R G+C
Sbjct: 2   RLNSLDLPGYPENSRIVVAMSGGVDSSVVAGLLKKEGYDVVGITLQLYDHGAATHRVGAC 61

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           CAGQD+ DARRV +T+ V HY+ DYEERFR AVI PFA SYA GETP+PCV CN+TVKF+
Sbjct: 62  CAGQDIEDARRVAETLGVPHYILDYEERFREAVINPFAESYAHGETPIPCVACNQTVKFA 121

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DLL+   +LGAD LATGHYIRSRL+        R + R +D +RDQSYFLFATTQ+Q+  
Sbjct: 122 DLLTTAYELGADALATGHYIRSRLH-----GAHRALFRSLDADRDQSYFLFATTQEQIDY 176

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLGD+ KE VR++A EMGL +A+K DSQDICFV QGKY DV+ ++    A  G IVH
Sbjct: 177 LRFPLGDLSKEHVREIAAEMGLVVANKHDSQDICFVPQGKYSDVITKLRPEAANPGVIVH 236

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           ++GQILG H+GI+NYT+GQRRG+GVA GE L+V+YLD  ++ VIVGPRE LE  +++LR+
Sbjct: 237 IDGQILGEHSGIVNYTVGQRRGIGVATGEALYVIYLDVENACVIVGPREMLETRKLFLRD 296

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVF 367
           +NWLGD   ++  +DG    VK+RS+  P    +       +VD  +SE GVA GQACV 
Sbjct: 297 VNWLGDEQLDNFPLDGIDVAVKVRSTCPPRSARLHYKQGLFFVDLLESESGVAPGQACVL 356

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y   S+EARVLGGG I+ ++R+   E+ L  V+
Sbjct: 357 YNDSSHEARVLGGGFITCAERAADTEKMLKRVL 389


>gi|49474501|ref|YP_032543.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella quintana str. Toulouse]
 gi|81646912|sp|Q6FZ46|MNMA_BARQU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|49240005|emb|CAF26420.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella quintana str. Toulouse]
          Length = 408

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 231/393 (58%), Positives = 295/393 (75%), Gaps = 7/393 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P + R+VVAMSGGVDSSVVA LLK++GYDVIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPDNSRIVVAMSGGVDSSVVAGLLKKEGYDVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYE+RFR AVI PFA SYA GETP+PCV CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLGIPHYVLDYEKRFREAVIDPFAESYAHGETPVPCVACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR +        R + RP D+ERDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSRPH-----GAHRALFRPFDVERDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +ADK DSQDICFV QGKY DV+ ++       G IVH+
Sbjct: 178 RFPLGDLPKAHVREIATEMGFVVADKHDSQDICFVPQGKYSDVITKLRPEAVNPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQ+LG+H+GI+NYT+GQRRG+GVA GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGQVLGKHSGIVNYTVGQRRGIGVATGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVF 367
           NWLGD   ++   DG +  VK+RS++ P  +      +GV+ VDF + E  VA GQACVF
Sbjct: 298 NWLGDERLDNFPSDGLEMAVKVRSTR-PSHLARLHYQEGVFSVDFLECENSVAPGQACVF 356

Query: 368 YTSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
           Y  + + AR+LGGG ++ S+R+  VE  L  V+
Sbjct: 357 YDGNGDGARILGGGFVTHSQRAVGVEMMLRRVL 389


>gi|163868748|ref|YP_001609965.1| tRNA-specific 2-thiouridylase MnmA [Bartonella tribocorum CIP
           105476]
 gi|205812594|sp|A9IWH0|MNMA_BART1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|161018412|emb|CAK01970.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella tribocorum CIP 105476]
          Length = 407

 Score =  467 bits (1202), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 225/392 (57%), Positives = 293/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D R+VVAMSGGVDSSVVA LLKR+GY+VIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPEDSRIVVAMSGGVDSSVVAGLLKREGYNVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV + + + HYV DYE+RFR AVI PFA SYA GETP+PC+ CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAEMLGIPHYVLDYEKRFREAVIDPFAESYAHGETPVPCIACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR +        R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSRSH-----GAHRALFRPLDNDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMGL +A+K DSQDICFV QGKY DV+ ++    A  G IVH+
Sbjct: 178 RFPLGDLPKARVREIAAEMGLVVANKHDSQDICFVPQGKYSDVIAKLRPEAANPGFIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ILG+H+GI+NYT+GQRRG+GV+ GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGKILGKHSGIVNYTVGQRRGIGVSTGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++    G +  VK+RS++ P    +   +    VD  + E GVA GQACV Y
Sbjct: 298 NWLGDESLDNFPSQGIEVAVKVRSTRPPHLACLHYKEGVFSVDLLECENGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             + +EAR+LGGG ++ S+R+  +E  L  V+
Sbjct: 358 DGNGHEARILGGGFVTHSERAADIEVMLKRVL 389


>gi|240850925|ref|YP_002972325.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella grahamii as4aup]
 gi|240268048|gb|ACS51636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella grahamii as4aup]
          Length = 409

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 291/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D R+VVAMSGGVDSSVVA LLK++GY+VIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPEDSRIVVAMSGGVDSSVVAGLLKKEGYNVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRV +T+ + HYV DYE+RFR AVI PFA SYA GETP+PC+ CN+TVKF+D
Sbjct: 63  AGQDIEDARRVAETLGIPHYVLDYEKRFREAVIDPFAESYAHGETPVPCIACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGAD LATGHYIRSR +        R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELGADALATGHYIRSRSH-----GAHRALFRPLDNDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +A+K DSQDICFV QGKY DV+ ++    A  G IVH+
Sbjct: 178 RFPLGDLPKARVREMAAEMGFVVANKHDSQDICFVPQGKYSDVIAKLRPEAANPGVIVHI 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ILG+H+GI+NYT+GQRRG+GV+ GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGKILGKHSGIVNYTVGQRRGIGVSTGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   +     G +  VK+RS++ P    +   +    VD  + E GVA GQACV Y
Sbjct: 298 NWLGDESLDKFPSQGIEVAVKVRSTRPPHLARLHYKEGIFSVDLLECENGVAPGQACVLY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             + +EAR+LGGG ++ S+R+   E  L  V+
Sbjct: 358 DGNGHEARILGGGFVTHSERAADTEMMLKRVL 389


>gi|49475921|ref|YP_033962.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella henselae str. Houston-1]
 gi|81647713|sp|Q6G2J9|MNMA_BARHE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|49238729|emb|CAF27985.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bartonella henselae str. Houston-1]
          Length = 409

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/392 (57%), Positives = 292/392 (74%), Gaps = 5/392 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P++ R+VVAMSGGVDSSVVA LLK++GYDVIG+TLQLY+   A+ R G+CC
Sbjct: 3   LNSLDLPGQPENSRIVVAMSGGVDSSVVAGLLKKEGYDVIGITLQLYDHGAATHRVGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DAR V +T+ + HYV DYEERFR AVI PFA+SYA GETP+PC+ CN+TVKF+D
Sbjct: 63  AGQDIEDARCVAETLGIPHYVLDYEERFREAVIDPFAASYAHGETPVPCIACNQTVKFAD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+L AD LATGHYIRSR +        R + RP+D +RDQSYFLFATTQ+Q+  L
Sbjct: 123 LLATARELDADALATGHYIRSRSH-----GAHRALFRPLDSDRDQSYFLFATTQEQIDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR++A EMG  +A+K DSQDICFV QGKY D++ ++       G IVH+
Sbjct: 178 RFPLGDLPKARVREMATEMGFVVANKHDSQDICFVPQGKYSDIITKLRPEAVNPGVIVHV 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +GQ+LG+H+GI++YT+GQRRG+GVA GE L+VVYLD  ++RVIVGPRE LE H+++LR++
Sbjct: 238 DGQVLGKHSGIVHYTVGQRRGIGVATGEALYVVYLDVENARVIVGPREMLETHKLFLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLGD   ++   DG +  VK+RS++ P    +   +    VDF + E  VA GQACVFY
Sbjct: 298 NWLGDERLDNFPPDGIEMAVKVRSTRPPHLARLHYQEGVFSVDFLECENSVAPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLSVI 400
             +S+ ARVLGGG ++ S+R+   E  L  V+
Sbjct: 358 DGNSDGARVLGGGFVTHSERAAETEMMLKRVL 389


>gi|13472503|ref|NP_104070.1| tRNA-specific 2-thiouridylase MnmA [Mesorhizobium loti MAFF303099]
 gi|14023249|dbj|BAB49856.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Mesorhizobium loti MAFF303099]
          Length = 378

 Score =  462 bits (1190), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 221/370 (59%), Positives = 271/370 (73%), Gaps = 5/370 (1%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ R GSCCAGQD+ DARRV +T+ + 
Sbjct: 1   MSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRAGSCCAGQDIDDARRVSETLGIP 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HYV DYEERFR AVI PFA SY AGETP+PCV CN+TVKF+DLL+  ++LGAD LATGHY
Sbjct: 61  HYVLDYEERFRKAVIDPFAESYVAGETPIPCVSCNQTVKFADLLATAKELGADALATGHY 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
           IRS    G +G  R +  RP+D +RDQSYFLFATTQ Q+  LRFPLG + K  VR +A E
Sbjct: 121 IRS----GANGAHRALY-RPVDADRDQSYFLFATTQAQIDYLRFPLGGLSKPQVRAIAEE 175

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
           MGL +A K DSQDICFV QGKY D++ ++    A  GDIVH++G++LGRH GI+ YTIGQ
Sbjct: 176 MGLTVAAKQDSQDICFVPQGKYSDIIAKLKPAAANPGDIVHIDGRVLGRHEGILRYTIGQ 235

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           RRG+G+A GEPL+VV+LD   +RV+VGPRE+LE H+IYLR +NWLGDG   D    G + 
Sbjct: 236 RRGIGIASGEPLYVVHLDAERARVVVGPREALETHKIYLRNMNWLGDGPLGDIPEGGLEL 295

Query: 327 FVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIISGS 386
           F K+RS++ P P  ++       V+    E G+A GQACV Y+ D NEARV GGG I  S
Sbjct: 296 FAKVRSTRPPRPAVLRYVAGVTSVELADGESGIAPGQACVLYSDDGNEARVFGGGFIERS 355

Query: 387 KRSDAVEESL 396
           +R    E  L
Sbjct: 356 ERGAEAEAML 365


>gi|328542757|ref|YP_004302866.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Polymorphum gilvum SL003B-26A1]
 gi|326412503|gb|ADZ69566.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Polymorphum gilvum SL003B-26A1]
          Length = 393

 Score =  461 bits (1187), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/377 (59%), Positives = 278/377 (73%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL + P+D RVVVAMSGGVDSSVVA L+K++GYDV+GVTLQLY+   A +R G+CC
Sbjct: 2   LNSLDLPRRPQDTRVVVAMSGGVDSSVVAGLMKQEGYDVVGVTLQLYDHGAAVQRAGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARRV + + + HYV DYE RF+ AVI  FA SY AGETP+PCV CN+TVKFSD
Sbjct: 62  AGQDIHDARRVAERLGIPHYVLDYERRFKEAVIDRFAESYMAGETPIPCVACNQTVKFSD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGADVLATGHY+RS          RR + RP DL+RDQSYFLFATTQ+QL  L
Sbjct: 122 LLETARTLGADVLATGHYVRS-----APAGNRRALYRPADLDRDQSYFLFATTQEQLDFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG   K  VR LAR  GL +ADK DSQDICFV +G+Y DV+ R+    A  GDIVH+
Sbjct: 177 RFPLGGRPKAEVRALARRFGLAVADKQDSQDICFVPKGRYADVIARLRPDAAEPGDIVHV 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRH+GII+YT+GQRRGLG+A GEPL+VV LD  + RV+VGPR++L   R+ LR++
Sbjct: 237 DGRVLGRHDGIIHYTVGQRRGLGIAAGEPLYVVRLDAAARRVVVGPRDALATRRLSLRDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVF 367
           NWLG    +         F K+RS++ PVP  + R+ DG + V+    E GVA GQACVF
Sbjct: 297 NWLGAEPLDPGAP--VALFAKVRSTRPPVPAVLTRHADGAIEVELADGETGVAPGQACVF 354

Query: 368 YTSDSNEARVLGGGIIS 384
           Y +D  EARVLGGG I+
Sbjct: 355 YDADGAEARVLGGGWIA 371


>gi|148253403|ref|YP_001237988.1| tRNA-specific 2-thiouridylase MnmA [Bradyrhizobium sp. BTAi1]
 gi|205811320|sp|A5ED38|MNMA_BRASB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146405576|gb|ABQ34082.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bradyrhizobium sp. BTAi1]
          Length = 397

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 221/378 (58%), Positives = 282/378 (74%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPEDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + + HYV DYE+RFR +VI  FA+SYA+GETP+PC++CNR +KF D
Sbjct: 62  AGQDIHDARNVAERLGIPHYVLDYEDRFRESVIDNFAASYASGETPVPCIECNRAIKFGD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGA VLATGHY+ SR     DG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLKTARELGASVLATGHYVASRRLA--DGSRA-LVC-AADADRDQSYFLFATTREQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K  VR+LAR  GL++ADK DSQDICFV  G+Y D++ ++       G+IV L
Sbjct: 178 RFPLGDMTKPEVRELARRFGLEVADKHDSQDICFVPTGRYTDIIGKLRPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG++LG H GI NYTIGQR+GLG+A G PL+VV LD  + RV+VGPRE+L  HRI LRE+
Sbjct: 238 NGRVLGAHQGIANYTIGQRKGLGIAAGAPLYVVKLDVATRRVVVGPREALRTHRITLREV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG+ + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGVLDAAVRDGLELFVRVRSTRPPQPAWLRGADGQYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            + S  ARVLGGG I  +
Sbjct: 358 DAASGRARVLGGGFIQSA 375


>gi|146342725|ref|YP_001207773.1| tRNA-specific 2-thiouridylase MnmA [Bradyrhizobium sp. ORS278]
 gi|205811327|sp|A4Z082|MNMA_BRASO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146195531|emb|CAL79558.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bradyrhizobium sp. ORS278]
          Length = 397

 Score =  456 bits (1174), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 220/378 (58%), Positives = 278/378 (73%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPEDTRVVVAMSGGVDSSVTAALLKSQGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + + HYV DYE+RFR +VI  FA+SYA+GETP+PC++CNR +KF D
Sbjct: 62  AGQDIHDARNVAERLGIPHYVLDYEDRFRESVIDNFAASYASGETPVPCIECNRAIKFGD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGA VLATGHY+ SR     DG R  + C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLKTARELGASVLATGHYVASRRL--PDGSRA-LTC-AADADRDQSYFLFATTREQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K  VR+LAR   L++ADK DSQDICFV  G+Y D++ ++       G+IV L
Sbjct: 178 RFPLGDMTKPEVRELARRFELEVADKHDSQDICFVPTGRYTDIIGKLRPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG++LG H GI NYTIGQR+GLG+A G PL+VV LD  + RV+VGPRE+L  HRI LRE+
Sbjct: 238 NGRVLGAHQGIANYTIGQRKGLGIAAGAPLYVVKLDVTTRRVVVGPREALRTHRITLREV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDAAVRDGLELFVRVRSTRAPQPAWLRGADGSYEVELVGGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            + S  ARVLGGG I  +
Sbjct: 358 DAASGRARVLGGGFIQSA 375


>gi|85713551|ref|ZP_01044541.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter sp. Nb-311A]
 gi|85699455|gb|EAQ37322.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter sp. Nb-311A]
          Length = 433

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 215/376 (57%), Positives = 277/376 (73%), Gaps = 4/376 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 35  LNSLDLEGRPQDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 94

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + V HYV DYE RFR  VI  FA SYA+GETP+PC++CNR VKF D
Sbjct: 95  AGQDIHDARNVAERLGVPHYVLDYESRFRETVIENFADSYASGETPVPCIECNRLVKFRD 154

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR      G  R ++C   D +RDQSYFLFATT++QL  L
Sbjct: 155 LLATARELGAAALATGHYVASRR---SPGGSRTLLC-AADADRDQSYFLFATTREQLDFL 210

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G Y D++ ++     L GDIV L
Sbjct: 211 RFPLGDMTKAQTRELARRFGLPVADKHDSQDICFVPTGHYTDIISQLKPNAMLSGDIVDL 270

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+++G H GI+N+T+GQRRGLG+A G PL+V+ LD  + RV+VGPRE+L++HRI LR++
Sbjct: 271 DGRVIGHHEGIVNFTVGQRRGLGIASGAPLYVLSLDAANRRVVVGPREALKMHRIVLRDV 330

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + A+  G + FV++RS++ P P +++  D G  V+    E GV+ GQACVFY
Sbjct: 331 NWIGDGALDLAIGAGLELFVRVRSTRKPQPAWLRVVDGGYEVELVAGEEGVSPGQACVFY 390

Query: 369 TSDSNEARVLGGGIIS 384
                +ARVLGGG I+
Sbjct: 391 DGPEGQARVLGGGFIA 406


>gi|218663598|ref|ZP_03519528.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli IE4771]
          Length = 345

 Score =  455 bits (1170), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 210/345 (60%), Positives = 262/345 (75%), Gaps = 1/345 (0%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPSPEHPGRRALFRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YLR++
Sbjct: 241 DGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDV 300

Query: 309 NWLGDGLFEDAVV-DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDF 352
           NWLGD    DA    GF C+ K+RS++ P P  +  +    YVD 
Sbjct: 301 NWLGDETLADAASGGGFACYAKVRSTRAPAPAVLHVDATCTYVDL 345


>gi|304394517|ref|ZP_07376438.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ahrensia sp. R2A130]
 gi|303293427|gb|EFL87806.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ahrensia sp. R2A130]
          Length = 406

 Score =  451 bits (1160), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 280/378 (74%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL  DK P D RVVVAMSGGVDSSVVA LLK  GY+V+G+TLQLY+   A ++KG+CC
Sbjct: 3   LNSLGFDKAPADTRVVVAMSGGVDSSVVACLLKEQGYEVLGMTLQLYDHGAAVQKKGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARRV + +   HYV DYE++FR  VI PFA +Y  GETP+PCV CN+TVKFSD
Sbjct: 63  AGQDIHDARRVSEQMGFPHYVLDYEQKFREQVIDPFAKAYINGETPIPCVACNQTVKFSD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGK-RRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           LL+  R+LGAD LATGHYI S+   GDDG  + R + RP D ++DQSYFLFATTQ+QL  
Sbjct: 123 LLTTARELGADCLATGHYIISK--PGDDGPLKNRQLFRPADADKDQSYFLFATTQEQLDF 180

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLGD+ K   R++A+EM L +A+KSDSQDICFV QGKY D++ +I     + GDIVH
Sbjct: 181 LRFPLGDVPKSRTREMAQEMDLIVAEKSDSQDICFVPQGKYADIIAKIRPDAGVAGDIVH 240

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           L+G++LGRH+GI N+TIGQRRG+G+A G+P++V+ +D  ++ V VGPRE+L   RI LR+
Sbjct: 241 LDGRVLGRHDGIFNFTIGQRRGIGIATGDPVYVISIDAKTATVTVGPREALATRRIALRD 300

Query: 308 INWLGDGLFEDAVV-DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           +NWLGD   EDAV  +G    V++RS++ P P  +   D   ++     E G++ GQACV
Sbjct: 301 VNWLGDETLEDAVSEEGIDLHVRVRSTRPPRPARLTLEDGTAFITLTDGEDGISPGQACV 360

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  ++ + RVLGGG I+
Sbjct: 361 FYVDENPQTRVLGGGWIA 378


>gi|205822155|sp|Q131Q8|MNMA_RHOPS RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 398

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 284/401 (70%), Gaps = 12/401 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR    DDG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGASALATGHYVSSRRL--DDGSRA-LIC-AADRDRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+IV L
Sbjct: 178 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG +LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI LR++
Sbjct: 238 NGHVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAAHRRVVVGPREALRMERIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGAIDQAVGDGLELFVRVRSTRAPQPAWLRAVGGGYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSK--------RSDAVEESLLSVIG 401
            +   +ARVLGGG I  +         R DA   +L ++ G
Sbjct: 358 DAADGQARVLGGGFIKSAAPRWSADGVRDDAASPALAAMRG 398


>gi|91978423|ref|YP_571082.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           BisB5]
 gi|91684879|gb|ABE41181.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris BisB5]
          Length = 402

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 284/401 (70%), Gaps = 12/401 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 6   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 66  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSVKFRD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR    DDG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 126 LLATARELGASALATGHYVSSRRL--DDGSRA-LIC-AADRDRDQSYFLFATTREQLDFL 181

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+IV L
Sbjct: 182 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGEIVDL 241

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG +LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI LR++
Sbjct: 242 NGHVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAAHRRVVVGPREALRMERIVLRDV 301

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQACVFY
Sbjct: 302 NWIGDGAIDQAVGDGLELFVRVRSTRAPQPAWLRAVGGGYEVELVAGEEGVSPGQACVFY 361

Query: 369 TSDSNEARVLGGGIISGSK--------RSDAVEESLLSVIG 401
            +   +ARVLGGG I  +         R DA   +L ++ G
Sbjct: 362 DAADGQARVLGGGFIKSAAPRWSADGVRDDAASPALAAMRG 402


>gi|75674801|ref|YP_317222.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter winogradskyi Nb-255]
 gi|123614062|sp|Q3SV21|MNMA_NITWN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|74419671|gb|ABA03870.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter winogradskyi Nb-255]
          Length = 400

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/390 (55%), Positives = 282/390 (72%), Gaps = 4/390 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V   + V HYV DYE RFR  VI  FA SYA+GETP+PC++CNR VKF D
Sbjct: 62  AGQDIHDARNVAARLGVPHYVLDYESRFRETVIENFADSYASGETPVPCIECNRQVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR     DG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGAAALATGHYVSSRRLA--DGSRA-LLC-AADTDRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K+  R+LAR  GL +ADK DSQDICFV  G+Y D++ R+     + GDIV L
Sbjct: 178 RFPLGDMTKQQTRELARRFGLSVADKHDSQDICFVPTGRYTDIISRLKPNAMVSGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G ++G H GI+++T+GQRRGLG+A G PL+V+ LD  + RV+VGPRE+L++HRI LR++
Sbjct: 238 DGHVIGHHEGIVHFTVGQRRGLGIASGAPLYVLSLDAANRRVVVGPREALKMHRIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + A+  G + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDRAIGAGLELFVRVRSTRRPQPAWLRVVDGRYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESLLS 398
                ++RVLGGG I+ +    A E +  S
Sbjct: 358 DGAEGQSRVLGGGFIARAMAQRANEAAAQS 387


>gi|27382106|ref|NP_773635.1| tRNA-specific 2-thiouridylase MnmA [Bradyrhizobium japonicum USDA
           110]
 gi|81735060|sp|Q89ES7|MNMA_BRAJA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|27355276|dbj|BAC52260.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Bradyrhizobium japonicum USDA 110]
          Length = 393

 Score =  449 bits (1155), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 277/378 (73%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V   + + HYV DYE+RFR +VI  FA SYA GETP+PC++CNR++KF D
Sbjct: 62  AGQDIHDARDVAAKLGIPHYVLDYEDRFRESVIDNFADSYALGETPVPCIECNRSIKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R+LGA  LATGHY+ SR    DDG R  ++    D +RDQSYFLFATTQ+QL  L
Sbjct: 122 LLKTARELGAQALATGHYVASRRL--DDGSR--VLVCAADADRDQSYFLFATTQEQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y D++ R+       GDIV L
Sbjct: 178 RFPLGDMTKPETRELARRFGLAVADKHDSQDICFVPTGRYTDIITRLRPNAMDPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LGRHNGI N+T+GQRRGLG+A   PLFVV L+  + RV+VGPRE+L++HRI LR++
Sbjct: 238 DGRVLGRHNGIANFTVGQRRGLGIAAHAPLFVVRLEAANRRVVVGPREALKMHRISLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NWLG G  + A+ +G + FV++RS++ P P +++       ++    E GV+ GQACVFY
Sbjct: 298 NWLGGGDIDSAIGNGLEMFVRVRSTRSPQPAWLRGAGGHYEIELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            + S +ARVLGGG I  +
Sbjct: 358 DAPSGQARVLGGGFIQSA 375


>gi|217978097|ref|YP_002362244.1| tRNA-specific 2-thiouridylase MnmA [Methylocella silvestris BL2]
 gi|217503473|gb|ACK50882.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylocella silvestris BL2]
          Length = 415

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 220/384 (57%), Positives = 275/384 (71%), Gaps = 7/384 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L K P   RVVVAMSGGVDSSVVAAL+K  GYDVI VT+QLY+  +A  RKG+CC
Sbjct: 18  LNSLGLPKPPAQTRVVVAMSGGVDSSVVAALMKEQGYDVIAVTMQLYDHGEAIHRKGACC 77

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DAR V   +++ HYV DYEERFR  VI PF+ SYA GETP+PCV CN  +KF+D
Sbjct: 78  AGQDIQDARLVAARLDIPHYVLDYEERFREKVINPFSHSYATGETPIPCVSCNSEIKFAD 137

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           L      LGADVLATGHY+ +R     D    R++ R  D  RDQSYFLFATT++QL  L
Sbjct: 138 LFDTALDLGADVLATGHYVSTR----SDEAGERVLHRAFDGARDQSYFLFATTRRQLQML 193

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K  VR LAR  GL +ADK+DSQDICFV +GKY D+++R++ G A+ G+IVH+
Sbjct: 194 RFPLGDMTKTDVRALARRFGLIVADKADSQDICFVPKGKYSDLIERLSPGAAVPGEIVHI 253

Query: 249 NGQILGRHNGIINYTIGQRRGLGVA---MGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           +G++LGRH G+I+YTIGQRRGLG+     GEPLFV+ LD   +RV+VGPRE+L   R +L
Sbjct: 254 DGRVLGRHAGVIHYTIGQRRGLGLGDANAGEPLFVIKLDAAGARVVVGPREALATRRAHL 313

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
           R +NW+GDG   D   +G   FV++RS++ PV   +   D G +V+F   E  V+ GQAC
Sbjct: 314 RAVNWIGDGELGDLPREGADIFVQVRSTRPPVAGRLYARDGGAHVEFVHDEDSVSPGQAC 373

Query: 366 VFYTSDSNEARVLGGGIISGSKRS 389
           VFY SD   ARVLGGG IS ++ +
Sbjct: 374 VFYASDQPRARVLGGGFISSTESA 397


>gi|307944132|ref|ZP_07659473.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseibium sp. TrichSKD4]
 gi|307772478|gb|EFO31698.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseibium sp. TrichSKD4]
          Length = 390

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/383 (57%), Positives = 278/383 (72%), Gaps = 9/383 (2%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           NSLDL   P+D RVVVAMSGGVDSSVVAAL+K +GYDVIGVTLQLY+   A  R  SCCA
Sbjct: 3   NSLDLPGRPEDTRVVVAMSGGVDSSVVAALMKEEGYDVIGVTLQLYDHGAAVSRAKSCCA 62

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           G D++DARR  + I + HYV DYE RF+  V+  FA SY AGETP+PCV CN+TVKF+DL
Sbjct: 63  GVDIHDARRAAEKIGIPHYVLDYESRFKEQVMDRFADSYIAGETPIPCVSCNQTVKFTDL 122

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   + LGADVLATGHY+RSR     DG +R +  RP+DL+RDQSYFLFATTQ+QL  +R
Sbjct: 123 LKTAKDLGADVLATGHYVRSR----PDGNKRALF-RPVDLDRDQSYFLFATTQEQLDFIR 177

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG   K  VR LA + GL +A+K DSQDICFV  G Y +V++++    A  GDIVH++
Sbjct: 178 FPLGGRPKSEVRQLAEKFGLSVANKPDSQDICFVPNGDYTEVIRKLRPNAAEPGDIVHMD 237

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G++LG+H G+I+YT+GQRRGLGVA GEPL+VV LD +  RV+VGPRE+L  + I LRE+N
Sbjct: 238 GRVLGQHEGVIHYTVGQRRGLGVATGEPLYVVRLDADEKRVVVGPREALTTNTIILREVN 297

Query: 310 WLGD-GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           WLGD  L E A +D    F K+RS++ P P  ++   +   V+    E GVA GQACVF+
Sbjct: 298 WLGDMPLDEGAELD---LFAKVRSTRPPAPAILRHTAEKTTVELVTGEAGVAPGQACVFF 354

Query: 369 TSDSNEARVLGGGIISGSKRSDA 391
            S+   ARVLGGG I+ ++RS A
Sbjct: 355 DSEDETARVLGGGWIARTERSGA 377


>gi|86751223|ref|YP_487719.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           HaA2]
 gi|86574251|gb|ABD08808.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris HaA2]
          Length = 402

 Score =  448 bits (1153), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/386 (57%), Positives = 280/386 (72%), Gaps = 5/386 (1%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T LNSLDL   P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RKG+
Sbjct: 4   TMLNSLDLAGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRKGA 63

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF
Sbjct: 64  CCAGQDIHDARDVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSVKF 123

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL+  R+LGA  LATGHY+ SR     DG R  ++C   D +RDQSYFLFATT++QL 
Sbjct: 124 RDLLATARELGASALATGHYVSSRRLA--DGSRA-LIC-AADRDRDQSYFLFATTREQLD 179

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLGDM K   RDLAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+IV
Sbjct: 180 FLRFPLGDMTKPQTRDLARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGEIV 239

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            LNG++LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI LR
Sbjct: 240 DLNGRVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAARRRVVVGPREALRMERIVLR 299

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACV 366
           ++NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQACV
Sbjct: 300 DVNWIGDGALDRAVGDGLELFVRVRSTRAPQPAWLRAVKGGYEVELVAGEEGVSPGQACV 359

Query: 367 FYTSDSNEARVLGGGII-SGSKRSDA 391
           FY +   +ARVLGGG I S + RS A
Sbjct: 360 FYDAAEGQARVLGGGFIKSAAPRSIA 385


>gi|90422506|ref|YP_530876.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           BisB18]
 gi|90104520|gb|ABD86557.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris BisB18]
          Length = 404

 Score =  448 bits (1152), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 284/391 (72%), Gaps = 4/391 (1%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A  LNSLDL+  P+D R+VVAMSGGVDSS  AALLK +GYDV+G+TLQLY+   A  RKG
Sbjct: 3   AAMLNSLDLEGRPQDTRIVVAMSGGVDSSTTAALLKSEGYDVVGITLQLYDHGAAIHRKG 62

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAGQD++DAR V D I + HYV DYE RF+ +VI  FA+SYA GETP+PC++CNR++K
Sbjct: 63  ACCAGQDIHDARAVADRIGIPHYVLDYESRFQESVIDSFAASYATGETPVPCIECNRSIK 122

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F DLLS  R+LGA  LATGHY+ SR     DG R  ++C   D +RDQSYFLFATT+ QL
Sbjct: 123 FRDLLSTARELGASALATGHYVSSRRLA--DGSRA-LVC-ASDADRDQSYFLFATTRDQL 178

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV R+       G+I
Sbjct: 179 DYLRFPLGDMTKPQTRELARKFGLSVADKHDSQDICFVPTGRYTDVVGRLKPNAMEPGEI 238

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           V L+G++LG+H GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPRE+L + RI L
Sbjct: 239 VDLDGRVLGKHQGIVHFTVGQRRGLGIASTAPLYVLRLEPSTRRVVVGPREALRMDRIVL 298

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
           R++NW+GD   + AV DG + FV++RS++ P P +++  D G  V+    E GV+ GQAC
Sbjct: 299 RDVNWIGDSSLDRAVGDGLELFVRVRSTRRPQPAWLRAQDGGYQVELVAGEDGVSPGQAC 358

Query: 366 VFYTSDSNEARVLGGGIISGSKRSDAVEESL 396
           VFY + + +ARVLGGG I  +    A + +L
Sbjct: 359 VFYDAPAGQARVLGGGFIKSATPRAAGKSAL 389


>gi|182679942|ref|YP_001834088.1| tRNA-specific 2-thiouridylase MnmA [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|205813049|sp|B2IBH3|MNMA_BEII9 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|182635825|gb|ACB96599.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 431

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 219/391 (56%), Positives = 285/391 (72%), Gaps = 9/391 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L K P   RVVVAMSGGVDSSVVAALLKR+GY+VIGVTLQLY+  +A  RKG+CC
Sbjct: 18  LNSLGLPKPPALTRVVVAMSGGVDSSVVAALLKREGYEVIGVTLQLYDHGEAVHRKGACC 77

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DAR+V D + + HYV DYEERFR  VI PFA SYA GETP+PCV CN  +KF+D
Sbjct: 78  AGQDIQDARQVADQLGIPHYVLDYEERFRRKVIDPFAQSYATGETPIPCVSCNSEIKFAD 137

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           L    + LGADVLATGHY+ S+     DG   R + R +D  RDQSYFLFATT  QL  L
Sbjct: 138 LFETAQHLGADVLATGHYVSSKAEA--DGG--RALYRSLDSSRDQSYFLFATTNAQLELL 193

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGD+ K  VR +AR++GL +ADK+DSQDICFV  GKY DV++R++ G  + G+I+H+
Sbjct: 194 RFPLGDLAKPDVRQMARQLGLVVADKADSQDICFVPSGKYSDVIERLSPGAVVPGEILHV 253

Query: 249 NGQILGRHNGIINYTIGQRR-----GLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           +G++LGRH+G+I+YTIGQRR      +G   GEPL+V+ LD   ++VIVGPR++L   R+
Sbjct: 254 DGRVLGRHSGVIHYTIGQRRGLGLGAVGAGAGEPLYVIRLDAAKAQVIVGPRQALATRRV 313

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQ 363
           +LR +NW+G G  +D    G + FV++RS++ P+P F+  ++  ++VDF   E GV+ GQ
Sbjct: 314 HLRGVNWIGPGSLQDMDEHGLEIFVQVRSTRAPIPGFLHAHESEIWVDFALDEDGVSPGQ 373

Query: 364 ACVFYTSDSNEARVLGGGIISGSKRSDAVEE 394
           ACVFY +D   ARVLGGG IS ++ +  + E
Sbjct: 374 ACVFYENDQPRARVLGGGFISATESALQMRE 404


>gi|205822083|sp|Q2ISK2|MNMA_RHOP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 398

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 221/384 (57%), Positives = 279/384 (72%), Gaps = 5/384 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLAGRPQDTRVVVAMSGGVDSSATAALLKSQGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARDVAERIGIPHYVLDYESRFRESVIDSFADSYALGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR     DG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGASALATGHYVSSRRLA--DGSRA-LIC-AADRDRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   RDLAR+ GL +ADK DSQDICFV  G+Y DVV+R+       G+IV L
Sbjct: 178 RFPLGDMTKPQTRDLARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           NG++LG H GI+++T+GQRRGLG+A   PL+V+ LD    RV+VGPRE+L + RI LR++
Sbjct: 238 NGRVLGSHPGIVHFTVGQRRGLGIASRAPLYVLRLDAARRRVVVGPREALRMERIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV DG + FV++RS++ P P +++    G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDRAVGDGLELFVRVRSTRAPQPAWLRAVKGGYEVELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGII-SGSKRSDA 391
            +   +ARVLGGG I S + RS A
Sbjct: 358 DAAEGQARVLGGGFIKSAAPRSIA 381


>gi|205822138|sp|Q21AM9|MNMA_RHOPB RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 400

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/388 (55%), Positives = 283/388 (72%), Gaps = 4/388 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D R+VVAMSGGVDSS  AALLK +GYDV+G+TLQLY+   A  RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRIVVAMSGGVDSSTTAALLKSEGYDVVGITLQLYDHGAAIHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V D I + HYV DYE RF+ +VI  FA+SYA GETP+PC++CNR++KF D
Sbjct: 62  AGQDIHDARAVADRIGIPHYVLDYESRFQESVIDSFAASYATGETPVPCIECNRSIKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLS  R+LGA  LATGHY+ SR     DG R  ++C   D +RDQSYFLFATT+ QL  L
Sbjct: 122 LLSTARELGASALATGHYVSSRRLA--DGSRA-LVC-ASDADRDQSYFLFATTRDQLDYL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV R+       G+IV L
Sbjct: 178 RFPLGDMTKPQTRELARKFGLSVADKHDSQDICFVPTGRYTDVVGRLKPNAMEPGEIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPRE+L + RI LR++
Sbjct: 238 DGRVLGKHQGIVHFTVGQRRGLGIASTAPLYVLRLEPSTRRVVVGPREALRMDRIVLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   + AV DG + FV++RS++ P P +++  D G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDSSLDRAVGDGLELFVRVRSTRRPQPAWLRAQDGGYQVELVAGEDGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESL 396
            + + +ARVLGGG I  +    A + +L
Sbjct: 358 DAPAGQARVLGGGFIKSATPRAAGKSAL 385


>gi|90419040|ref|ZP_01226951.1| tRNA methyl transferase
           ((5-methylaminomethyl-2-thiouridylate)-
           methyltransferase) [Aurantimonas manganoxydans SI85-9A1]
 gi|90337120|gb|EAS50825.1| tRNA methyl transferase
           ((5-methylaminomethyl-2-thiouridylate)-
           methyltransferase) [Aurantimonas manganoxydans SI85-9A1]
          Length = 425

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/394 (55%), Positives = 280/394 (71%), Gaps = 5/394 (1%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
            + E    NSLDL K P D RVVVAMSGGVDSSVVAA+LK  GYDV+G+TLQLY++ + +
Sbjct: 30  TLPEWPMSNSLDLPKPPADTRVVVAMSGGVDSSVVAAILKEQGYDVVGITLQLYDAGEGA 89

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
           +R GSCCAGQD++DARRV +T+ + HYV DYE+RFR AVI PFA+SY AGETP+PCV CN
Sbjct: 90  RRAGSCCAGQDIHDARRVAETLGIHHYVLDYEDRFRKAVINPFAASYLAGETPIPCVACN 149

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATT 181
           +TVKF DLL+  + LGAD LATGHYI SR     +G  R +  RP DL+RDQSYFL+ TT
Sbjct: 150 QTVKFRDLLATAQDLGADALATGHYIESR----QNGAHRSLY-RPADLDRDQSYFLYGTT 204

Query: 182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL 241
           Q+QL  LRFPLG + K   R+LA   GL +A K DSQDICFV +G+Y DV++++    + 
Sbjct: 205 QEQLDFLRFPLGGLTKPQTRELAERHGLVVAAKPDSQDICFVAKGRYSDVIRKLRPEASE 264

Query: 242 EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVH 301
            GDIVHL+G+ LGRH GI++YTIGQRRGLG+A  +PL+VV LD  +++V+VGPRE+L   
Sbjct: 265 PGDIVHLDGRHLGRHAGIVHYTIGQRRGLGIAAADPLYVVALDPATAQVVVGPREALATR 324

Query: 302 RIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVAS 361
           R+ LR++NWLG     D      + FV++RS++ P P  +Q  +    V+    E GVA 
Sbjct: 325 RLTLRDVNWLGRTDPADMAAADEEIFVRVRSTRPPAPARIQVENGVWTVELASGEDGVAP 384

Query: 362 GQACVFYTSDSNEARVLGGGIISGSKRSDAVEES 395
           GQACVFY  +   A VLGGG+IS + R    + +
Sbjct: 385 GQACVFYRGEGVGAEVLGGGVISVTDRPQRAQRA 418


>gi|92116313|ref|YP_576042.1| tRNA-specific 2-thiouridylase MnmA [Nitrobacter hamburgensis X14]
 gi|122418585|sp|Q1QQB5|MNMA_NITHX RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|91799207|gb|ABE61582.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nitrobacter hamburgensis X14]
          Length = 400

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 209/376 (55%), Positives = 276/376 (73%), Gaps = 4/376 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL+L+  P+D RVVVAMSGGVDSSV AALLK +GYDV+G+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLELEGRPQDTRVVVAMSGGVDSSVTAALLKSEGYDVVGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + + + HYV DYE RFR  VI  FA SYA+GETP+PC++CNR VKF D
Sbjct: 62  AGQDIHDARNVAERLGIPHYVLDYENRFRETVIENFADSYASGETPVPCIECNRLVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ S    G     R ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGAAALATGHYVASHRMAGGS---RALLC-AADADRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y D++ ++     + GDIV L
Sbjct: 178 RFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPTGRYTDIISQLKPNAMVSGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G ++G H+GI+++T+GQRRGLG+A G PL+V+ LD  + RV+VGPRE+L++HRI LR++
Sbjct: 238 DGHVIGHHDGIVHFTVGQRRGLGIASGAPLYVLSLDAANRRVVVGPREALKMHRIILRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  + AV  G + FV++RS++ P P +++  D    ++    E GV+ GQACVFY
Sbjct: 298 NWIGDGALDRAVGAGLELFVRVRSTRKPQPAWLRAIDGRYEIELVAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIIS 384
                +ARVLGGG I+
Sbjct: 358 DGLEGQARVLGGGFIA 373


>gi|192289904|ref|YP_001990509.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           TIE-1]
 gi|192283653|gb|ACF00034.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris TIE-1]
          Length = 401

 Score =  445 bits (1145), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 280/378 (74%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 6   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGEAIHRKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+VKF D
Sbjct: 66  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSVKFRD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR    DDG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 126 LLATARELGASALATGHYVSSRRL--DDGSRA-LVC-AADRDRDQSYFLFATTREQLQFL 181

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GDIV +
Sbjct: 182 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGDIVDV 241

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI LR+I
Sbjct: 242 DGRVLGQHPGIVHFTVGQRRGLGIASRSPLYVLRLDAARRQVVVGPREALLMDRIVLRDI 301

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  +D + DG + FV++RS++ P P +++  + G  V+    E GV+ GQACVFY
Sbjct: 302 NWIGDGALDDVIGDGLELFVRVRSTRAPQPAWLRAANGGYEVELVVGEEGVSPGQACVFY 361

Query: 369 TSDSNEARVLGGGIISGS 386
            +   +ARVLGGG I  +
Sbjct: 362 DAAEGQARVLGGGFIKSA 379


>gi|39934381|ref|NP_946657.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           CGA009]
 gi|39648230|emb|CAE26749.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris CGA009]
          Length = 401

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 280/378 (74%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 6   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGEAIHRKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+VKF D
Sbjct: 66  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSVKFRD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR    DDG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 126 LLATARELGASALATGHYVSSRRL--DDGSRA-LVC-AADRDRDQSYFLFATTREQLQFL 181

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GDIV +
Sbjct: 182 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGDIVDV 241

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI LR+I
Sbjct: 242 DGRVLGQHPGIVHFTVGQRRGLGIASRSPLYVLRLDAAQRQVVVGPREALLMDRIVLRDI 301

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  +D + DG + FV++RS++ P P +++  + G  V+    E GV+ GQACVFY
Sbjct: 302 NWIGDGSLDDVIGDGLELFVRVRSTRAPQPAWLRAANGGYEVELVVGEEGVSPGQACVFY 361

Query: 369 TSDSNEARVLGGGIISGS 386
            +   +ARVLGGG I  +
Sbjct: 362 DAAEGQARVLGGGFIKSA 379


>gi|205822121|sp|Q6NA79|MNMA_RHOPA RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 397

 Score =  445 bits (1144), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/378 (56%), Positives = 280/378 (74%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGEAIHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR    DDG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLATARELGASALATGHYVSSRRL--DDGSRA-LVC-AADRDRDQSYFLFATTREQLQFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GDIV +
Sbjct: 178 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGDIVDV 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI LR+I
Sbjct: 238 DGRVLGQHPGIVHFTVGQRRGLGIASRSPLYVLRLDAAQRQVVVGPREALLMDRIVLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  +D + DG + FV++RS++ P P +++  + G  V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGSLDDVIGDGLELFVRVRSTRAPQPAWLRAANGGYEVELVVGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            +   +ARVLGGG I  +
Sbjct: 358 DAAEGQARVLGGGFIKSA 375


>gi|316935452|ref|YP_004110434.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris DX-1]
 gi|315603166|gb|ADU45701.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris DX-1]
          Length = 401

 Score =  442 bits (1138), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 212/378 (56%), Positives = 278/378 (73%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK  GYDV+G+TLQLY+   A  RKG+CC
Sbjct: 6   LNSLDLEGRPQDTRVVVAMSGGVDSSATAALLKAQGYDVVGITLQLYDHGAAIHRKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA+GETP+PC++CNR+VKF D
Sbjct: 66  AGQDIHDARAVAERIGIPHYVLDYESRFRESVIDSFADSYASGETPVPCIECNRSVKFRD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR     +   R ++C   D +RDQSYFLFATT++QL  L
Sbjct: 126 LLATARELGASALATGHYVSSRRL---ENGSRALVC-AADRDRDQSYFLFATTREQLQFL 181

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR+ GL +ADK DSQDICFV  G+Y DVV+R+       GDIV +
Sbjct: 182 RFPLGDMTKPQTRELARQFGLSVADKHDSQDICFVPTGRYTDVVERLKPNAMEPGDIVDI 241

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H GI+++T+GQRRGLG+A   PL+V+ LD    +V+VGPRE+L + RI LR++
Sbjct: 242 DGRVLGQHPGIVHFTVGQRRGLGIASRAPLYVLRLDAARRQVVVGPREALLMDRIVLRDV 301

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG  +D V DG + FV++RS+++P P +++  + G  V+    E GV+ GQACVFY
Sbjct: 302 NWIGDGALDDVVGDGLELFVRVRSTREPQPAWLRAANGGYEVELVVGEEGVSPGQACVFY 361

Query: 369 TSDSNEARVLGGGIISGS 386
            +   +ARVLGGG I  +
Sbjct: 362 DAAEGQARVLGGGFIKSA 379


>gi|254503485|ref|ZP_05115636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Labrenzia alexandrii DFL-11]
 gi|222439556|gb|EEE46235.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Labrenzia alexandrii DFL-11]
          Length = 449

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/381 (56%), Positives = 271/381 (71%), Gaps = 7/381 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL   P+D RVVVAMSGGVDSSVVAA++  +GYDVIGVTLQLY+   A  +  SCC
Sbjct: 59  LNSLDLPGRPEDTRVVVAMSGGVDSSVVAAMMHAEGYDVIGVTLQLYDHGAAVAKTKSCC 118

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARR  + I + HYV DYE RF+  V+  FA SY AGETP+PCV CN+TVKF+D
Sbjct: 119 AGVDIHDARRAAEKIGIPHYVLDYESRFKEQVMDRFADSYIAGETPIPCVSCNQTVKFTD 178

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R LGAD LATGHY+RS       G +R +  RP DL+RDQSYFLFATTQ+QL  +
Sbjct: 179 LLKTARDLGADALATGHYVRS----ATKGNKRALF-RPADLDRDQSYFLFATTQEQLDFV 233

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG M K  VR LA E GL +A+K DSQDICFV  G Y  V++++    A  G+IVH+
Sbjct: 234 RFPLGGMPKSQVRTLAEEFGLSVANKPDSQDICFVPNGDYAAVIRKLRPNAAEPGEIVHM 293

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG HNGII++TIGQRRG+GVA GEPL+VV LD +  RVIVGPRE+L    I LRE+
Sbjct: 294 DGRVLGEHNGIIHFTIGQRRGIGVATGEPLYVVRLDADERRVIVGPREALATRTILLREM 353

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   ++   D  + F K+RS++ P P  ++  +   +VD    E GVA GQACVF+
Sbjct: 354 NWIGDQPLDEG--DEIEVFAKVRSTRPPAPAALRILNGKAFVDLANGETGVAPGQACVFF 411

Query: 369 TSDSNEARVLGGGIISGSKRS 389
            SD   ARVLGGG I  ++R+
Sbjct: 412 DSDDETARVLGGGWIHKTERT 432


>gi|118593646|ref|ZP_01551022.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Stappia aggregata IAM 12614]
 gi|118433757|gb|EAV40418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Stappia aggregata IAM 12614]
          Length = 392

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/380 (56%), Positives = 272/380 (71%), Gaps = 7/380 (1%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           NSLDL   P+D RVVVAMSGGVDSSVVAAL+K +GYDVIGVTLQLY+   A  +  SCCA
Sbjct: 3   NSLDLPGRPEDTRVVVAMSGGVDSSVVAALMKAEGYDVIGVTLQLYDHGAAVSKAKSCCA 62

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           G D++DARR  +TI + HYV DYE RF+  V+  FA SY AGETP+PCV CN+TVKF+DL
Sbjct: 63  GVDIHDARRAAETIGIPHYVLDYESRFKEQVMDRFADSYIAGETPIPCVSCNQTVKFTDL 122

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   + LGAD LATGHY+RS          +R + RP DL+RDQSYFLFATTQ QL  +R
Sbjct: 123 LKTAKDLGADALATGHYVRST-----QQGNKRALFRPADLDRDQSYFLFATTQDQLDFIR 177

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG M K  VR+LA E GL +A+K DSQDICFV  G Y +V++++    A  G+IVH++
Sbjct: 178 FPLGGMPKSKVRELAAEFGLTVANKPDSQDICFVPNGDYAEVIRKLRPNAAEPGEIVHMD 237

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G++LG H+GII+YTIGQRRGLGVA G+PL+VV LD +  RV+VGPRE+L    I LRE+N
Sbjct: 238 GRVLGEHDGIIHYTIGQRRGLGVATGDPLYVVRLDPDERRVVVGPREALATRTILLREMN 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           W+GD   ++   D  + F K+RS++ P P  ++  +   +VD    E GVA GQACVF+ 
Sbjct: 298 WIGDQPLDEG--DEIELFAKVRSTRPPAPATLRILNGKGFVDLANGETGVAPGQACVFFD 355

Query: 370 SDSNEARVLGGGIISGSKRS 389
           +D   ARVLGGG I  ++R+
Sbjct: 356 TDDETARVLGGGWIHKTERT 375


>gi|154252635|ref|YP_001413459.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Parvibaculum lavamentivorans DS-1]
 gi|154156585|gb|ABS63802.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Parvibaculum lavamentivorans DS-1]
          Length = 462

 Score =  441 bits (1135), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 219/368 (59%), Positives = 265/368 (72%), Gaps = 9/368 (2%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
           E T LNSLDL   P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A  RK
Sbjct: 63  EMTGLNSLDLPGRPEDTRVVVAMSGGVDSSVTAALLKEQGYDVVGITLQLYDHGAAVSRK 122

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAGQD+ DARRV D I + HYV DYE+RFR AV+  FA SYAAGETP+PCV CN  V
Sbjct: 123 GACCAGQDIQDARRVADQIGIPHYVLDYEDRFRRAVMDDFADSYAAGETPIPCVRCNERV 182

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL   R LGA  LATGHYI SR      G   R + RP D ERDQSYFLFATTQ+Q
Sbjct: 183 KFRDLLDTARDLGAAALATGHYIASR-----RGAAGRELHRPRDEERDQSYFLFATTQEQ 237

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLG++ K   R LA  MGL++A K DSQDICFV  G+Y  +V+++  G +  G+
Sbjct: 238 LEFLRFPLGELTKPEARALADRMGLEVAGKPDSQDICFVPTGRYTTIVEKLRPGASAPGE 297

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESLEV 300
           +VHL+G++LGRH+GI+N+TIGQRRGLG+     + EPLFVV LD    +VIVGPRE+LE 
Sbjct: 298 VVHLDGRVLGRHSGIVNFTIGQRRGLGIGASEPVSEPLFVVKLDPLKRQVIVGPREALET 357

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
            ++ LR+INWLGDG F +   +G K   K+RS++ PVP  + R  +G  V+  +SE GVA
Sbjct: 358 QKLTLRDINWLGDGPFAELPGEGLKIVAKVRSTRPPVPARLFRTGEGAVVELLESEGGVA 417

Query: 361 SGQACVFY 368
            GQACVFY
Sbjct: 418 PGQACVFY 425


>gi|299131958|ref|ZP_07025153.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Afipia sp. 1NLS2]
 gi|298592095|gb|EFI52295.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Afipia sp. 1NLS2]
          Length = 393

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 215/376 (57%), Positives = 267/376 (71%), Gaps = 4/376 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P   RVVVAMSGGVDSS  AALLK +GYDVIG+TLQLY+   A+ RKG+CC
Sbjct: 2   LNSLDLEGPPSGTRVVVAMSGGVDSSTTAALLKAEGYDVIGITLQLYDHGAATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SY  GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARDVAERIGIPHYVLDYESRFRESVIDRFAESYVLGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+LGA  LATGHY+ SR     DG R   M    D +RDQSYFLFATTQ QL DL
Sbjct: 122 LLTTARELGAKALATGHYVASRRQA--DGSR--AMVCAADADRDQSYFLFATTQDQLNDL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR   L +A+K DSQDICFV  G+Y DV++R+       GDIV L
Sbjct: 178 RFPLGDMTKTQTRELARRFDLPVAEKHDSQDICFVPTGRYTDVIERMKPNALQPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
            G++LG H GI+N+TIGQRRG+G+A  EPL+VV LD  + RVIVGPR +L    I LR+I
Sbjct: 238 RGRVLGHHQGIVNFTIGQRRGIGIAAAEPLYVVALDAAARRVIVGPRAALRKSVITLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG FE A  +G   ++K+RS++ P    ++ N D   V+    E G++ GQACVFY
Sbjct: 298 NWIGDGSFERAATEGRDLYIKVRSTRPPQAAHLRMNGDHCEVELLAGEEGISPGQACVFY 357

Query: 369 TSDSNEARVLGGGIIS 384
            + + +ARVLGGG I+
Sbjct: 358 DAPAGQARVLGGGFIT 373


>gi|218460955|ref|ZP_03501046.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli Kim 5]
          Length = 353

 Score =  441 bits (1133), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 207/325 (63%), Positives = 251/325 (77%), Gaps = 1/325 (0%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A  LN+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R G
Sbjct: 7   APPLNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAG 66

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           SCCAGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVK
Sbjct: 67  SCCAGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVK 126

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F+DLL+  ++LGAD LATGHYIRSR     +   RR + RP D +RDQSYFLFATTQQQ+
Sbjct: 127 FADLLATAKELGADALATGHYIRSRPNPSPEHPGRRALFRPADADRDQSYFLFATTQQQI 186

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+I
Sbjct: 187 DYLRFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEI 246

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           VHL+G++LG H GI+++TIGQRRG+G+A GEPL+VVYLD  S RVIVGP+E+LE HR+YL
Sbjct: 247 VHLDGRVLGSHEGILHFTIGQRRGIGIATGEPLYVVYLDARSRRVIVGPKEALETHRVYL 306

Query: 306 REINWLGD-GLFEDAVVDGFKCFVK 329
           R++NWLGD  L E A   GF C  K
Sbjct: 307 RDVNWLGDETLAEAASGGGFACTPK 331


>gi|115523063|ref|YP_779974.1| tRNA-specific 2-thiouridylase MnmA [Rhodopseudomonas palustris
           BisA53]
 gi|115517010|gb|ABJ04994.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodopseudomonas palustris BisA53]
          Length = 419

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/378 (56%), Positives = 279/378 (73%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK +GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 21  LNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGEAIHRKGACC 80

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA+SYA GETP+PC++CNR++KF D
Sbjct: 81  AGQDIHDARTVAERIGIPHYVLDYESRFRESVIDSFATSYATGETPVPCIECNRSIKFRD 140

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLS  R+LGA VLATGHY+ SR     DG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 141 LLSTARELGAAVLATGHYVSSRRL--PDGSRA-LVC-AADADRDQSYFLFATTREQLDFL 196

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y DVV R+       GDIV L
Sbjct: 197 RFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPSGRYSDVVGRLKPNAMEPGDIVDL 256

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H+GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPR +L + RI LR++
Sbjct: 257 DGRVLGKHHGIVHFTVGQRRGLGIASHAPLYVLRLEPSTRRVVVGPRAALRMDRILLRDV 316

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 317 NWIGDNSLDLAVGDGLEMFVRVRSTRRPQPAWLRAIDGEYQVELIAGEDGVSPGQACVFY 376

Query: 369 TSDSNEARVLGGGIISGS 386
            +   +ARVLGGG I  +
Sbjct: 377 DAPEGQARVLGGGFIKSA 394


>gi|205822308|sp|A7HV69|MNMA_PARL1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 399

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/366 (59%), Positives = 264/366 (72%), Gaps = 9/366 (2%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T LNSLDL   P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A  RKG+
Sbjct: 2   TGLNSLDLPGRPEDTRVVVAMSGGVDSSVTAALLKEQGYDVVGITLQLYDHGAAVSRKGA 61

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD+ DARRV D I + HYV DYE+RFR AV+  FA SYAAGETP+PCV CN  VKF
Sbjct: 62  CCAGQDIQDARRVADQIGIPHYVLDYEDRFRRAVMDDFADSYAAGETPIPCVRCNERVKF 121

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL   R LGA  LATGHYI SR      G   R + RP D ERDQSYFLFATTQ+QL 
Sbjct: 122 RDLLDTARDLGAAALATGHYIASR-----RGAAGRELHRPRDEERDQSYFLFATTQEQLE 176

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLG++ K   R LA  MGL++A K DSQDICFV  G+Y  +V+++  G +  G++V
Sbjct: 177 FLRFPLGELTKPEARALADRMGLEVAGKPDSQDICFVPTGRYTTIVEKLRPGASAPGEVV 236

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVA----MGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           HL+G++LGRH+GI+N+TIGQRRGLG+     + EPLFVV LD    +VIVGPRE+LE  +
Sbjct: 237 HLDGRVLGRHSGIVNFTIGQRRGLGIGASEPVSEPLFVVKLDPLKRQVIVGPREALETQK 296

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASG 362
           + LR+INWLGDG F +   +G K   K+RS++ PVP  + R  +G  V+  +SE GVA G
Sbjct: 297 LTLRDINWLGDGPFAELPGEGLKIVAKVRSTRPPVPARLFRTGEGAVVELLESEGGVAPG 356

Query: 363 QACVFY 368
           QACVFY
Sbjct: 357 QACVFY 362


>gi|205821605|sp|Q07SU0|MNMA_RHOP5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 400

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 214/378 (56%), Positives = 279/378 (73%), Gaps = 4/378 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P+D RVVVAMSGGVDSS  AALLK +GYDV+G+TLQLY+  +A  RKG+CC
Sbjct: 2   LNSLDLEGRPQDTRVVVAMSGGVDSSTTAALLKAEGYDVVGITLQLYDHGEAIHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA+SYA GETP+PC++CNR++KF D
Sbjct: 62  AGQDIHDARTVAERIGIPHYVLDYESRFRESVIDSFATSYATGETPVPCIECNRSIKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LLS  R+LGA VLATGHY+ SR     DG R  ++C   D +RDQSYFLFATT++QL  L
Sbjct: 122 LLSTARELGAAVLATGHYVSSRRL--PDGSRA-LVC-AADADRDQSYFLFATTREQLDFL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR  GL +ADK DSQDICFV  G+Y DVV R+       GDIV L
Sbjct: 178 RFPLGDMTKPQTRELARSFGLSVADKHDSQDICFVPSGRYSDVVGRLKPNAMEPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G++LG+H+GI+++T+GQRRGLG+A   PL+V+ L+ ++ RV+VGPR +L + RI LR++
Sbjct: 238 DGRVLGKHHGIVHFTVGQRRGLGIASHAPLYVLRLEPSTRRVVVGPRAALRMDRILLRDV 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GD   + AV DG + FV++RS++ P P +++  D    V+    E GV+ GQACVFY
Sbjct: 298 NWIGDNSLDLAVGDGLEMFVRVRSTRRPQPAWLRAIDGEYQVELIAGEDGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIISGS 386
            +   +ARVLGGG I  +
Sbjct: 358 DAPEGQARVLGGGFIKSA 375


>gi|114706635|ref|ZP_01439536.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fulvimarina pelagi HTCC2506]
 gi|114538027|gb|EAU41150.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fulvimarina pelagi HTCC2506]
          Length = 394

 Score =  439 bits (1130), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 215/383 (56%), Positives = 272/383 (71%), Gaps = 10/383 (2%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T LNSLD+ K P+D RV+VAMSGGVDSSV AA+LK +GYDV+G+TLQLY++     + G+
Sbjct: 3   THLNSLDIPKAPEDTRVIVAMSGGVDSSVTAAILKDEGYDVVGITLQLYDAGDTPAKAGA 62

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD+ DARRVCD + + HYV DYEE FR AVI PFA +Y AGETP+PCV CN+TVKF
Sbjct: 63  CCAGQDIRDARRVCDLLGIPHYVLDYEENFREAVIDPFADAYVAGETPIPCVSCNQTVKF 122

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKR--RRIMCRPMDLERDQSYFLFATTQQQ 184
            DLL     LG D LATGHYI SR       KR   R + RP DL+RDQSYFL+ TTQ+Q
Sbjct: 123 RDLLKTAMDLGGDALATGHYIESR-------KRGNHRSLHRPFDLDRDQSYFLYGTTQKQ 175

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           +  LRFPL  + K+  R++A + GL IA K DSQDICFV  G+Y D+V+R+       G+
Sbjct: 176 VDFLRFPLASLTKDETREIAAKHGLAIASKPDSQDICFVPTGRYSDLVRRLRPEAGDPGE 235

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IVH++G++LG H GIINYT+GQRRGLGVA GEPL+VV LD  + RV+VGPRE+L    + 
Sbjct: 236 IVHIDGRVLGEHEGIINYTVGQRRGLGVAAGEPLYVVKLDPATRRVVVGPREALATRAVR 295

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQ 363
           LRE+NWL +   E    +  + FVK+RS++ P P  +  + +G + V+   +E GVA GQ
Sbjct: 296 LREVNWLAEESAEVYATETREIFVKLRSTRPPSPARLAADGEGGWMVELLAAEYGVAKGQ 355

Query: 364 ACVFYTSDSNEARVLGGGIISGS 386
           ACVFY ++   A VLGGGII GS
Sbjct: 356 ACVFYGAEGAGAEVLGGGIIDGS 378


>gi|209884347|ref|YP_002288204.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oligotropha carboxidovorans OM5]
 gi|229486419|sp|B6JCC3|MNMA_OLICO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209872543|gb|ACI92339.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oligotropha carboxidovorans OM5]
          Length = 393

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 217/383 (56%), Positives = 272/383 (71%), Gaps = 5/383 (1%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSLDL+  P   RVVVAMSGGVDSS  AALLK +GYDVIG+TLQLY+  +A+ RKG+CC
Sbjct: 2   LNSLDLEGPPSSTRVVVAMSGGVDSSTTAALLKAEGYDVIGITLQLYDHGEATHRKGACC 61

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR V + I + HYV DYE RFR +VI  FA SYA GETP+PC++CNR+VKF D
Sbjct: 62  AGQDIHDARDVAERIGIPHYVLDYESRFRESVIDRFAESYALGETPVPCIECNRSVKFRD 121

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGA  LATGHY+ SR     DG R   M    D +RDQSYFLFATTQ QL  L
Sbjct: 122 LLTTAQELGAQALATGHYVASRRQ--PDGSR--AMVCAADADRDQSYFLFATTQDQLNHL 177

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K   R+LAR   L +A+K DSQDICFV  G+Y DV++R+     L GDIV L
Sbjct: 178 RFPLGDMTKAQTRELARRFDLPVAEKHDSQDICFVPTGRYTDVIERMRPNAMLPGDIVDL 237

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
            G++LG H GI N+T+GQRRG+G+A   PL+VV LD  S +VIVGPR +L  + I LR+I
Sbjct: 238 RGRVLGHHQGIANFTVGQRRGIGIAASMPLYVVALDAASRQVIVGPRAALRKNLITLRDI 297

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           NW+GDG F+D   +G   ++K+RS++ P P  ++ N D   V+    E GV+ GQACVFY
Sbjct: 298 NWIGDGTFDDVAREGRDLYIKVRSTRPPQPAHLRMNGDHCEVELFAGEEGVSPGQACVFY 357

Query: 369 TSDSNEARVLGGGIIS-GSKRSD 390
            + + +ARVLGGG I+  S  SD
Sbjct: 358 DAPTGQARVLGGGFITHASNNSD 380


>gi|170743223|ref|YP_001771878.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium sp. 4-46]
 gi|205816883|sp|B0UIW7|MNMA_METS4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|168197497|gb|ACA19444.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium sp. 4-46]
          Length = 382

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/377 (57%), Positives = 268/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P+D RVVVAMSGGVDSSVVA LL+R GYDV+G+TLQLY+   A+ R+G+CC
Sbjct: 1   MNSLDLPKAPQDTRVVVAMSGGVDSSVVAGLLRRQGYDVVGITLQLYDHGAATHRRGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARR  +T+ + HYV DYE+RFR AVI  FA SY  GETP+PCV+CNR++KF D
Sbjct: 61  AGQDIHDARRAAETLGIPHYVLDYEDRFREAVIDRFAESYIHGETPIPCVECNRSIKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+    LGAD LATGHY+ SR   G      R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLATALDLGADALATGHYVASRARPGGG----RALYRALDPARDQSYFLYATTPEQLDVL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K+  R LARE GL +ADK DSQDICFV QG+Y DV+ R+    A  G+IVHL
Sbjct: 177 RFPLGELPKDETRRLAREFGLAVADKPDSQDICFVPQGRYQDVIARLRPDAARPGEIVHL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH GII +T+GQRRGLG+A GEPL+VV LD  ++RV+VGPRE+L    I + E 
Sbjct: 237 DGRTLGRHEGIIGFTVGQRRGLGLATGEPLYVVRLDPETARVVVGPREALATSVIRIAET 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND--DGVYVDFEKSEVGVASGQACV 366
           NWLGD    D  +DG    V++RS+++P P  ++ N       V  E  E GV+ GQAC 
Sbjct: 297 NWLGDEPLAD--LDGMPVAVRVRSTREPRPAALRWNRALACAEVVLETPEDGVSPGQACA 354

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   ARVLGGG I
Sbjct: 355 IYADDGPRARVLGGGTI 371


>gi|296446642|ref|ZP_06888583.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylosinus trichosporium OB3b]
 gi|296255870|gb|EFH02956.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylosinus trichosporium OB3b]
          Length = 411

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/403 (54%), Positives = 276/403 (68%), Gaps = 12/403 (2%)

Query: 3   VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK 62
           V + T LNSL L K  +D RVVVAMSGGVDSSVVAALL   GYDV+GVTLQLY+  +A  
Sbjct: 8   VPDETELNSLGLPKPAQDTRVVVAMSGGVDSSVVAALLAEQGYDVVGVTLQLYDHGEAVH 67

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
           RKGSCCAGQD++DARRV   + + HYV D+E RFR  VI  FA SYA+GETP+PCV CN+
Sbjct: 68  RKGSCCAGQDIHDARRVAARLGIPHYVLDFETRFRETVIDTFAQSYASGETPVPCVACNQ 127

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
            VKF DL    + LGAD LATGHYI SR      G+  R + R MD  RDQSYFLFATT+
Sbjct: 128 FVKFVDLFETAKDLGADALATGHYIASR-----PGRGGRGLYRAMDAARDQSYFLFATTR 182

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
            QL  LRFPLG+  K  VR+LAR   LD+A+K DSQDICFV  G Y D+V+R++ G A+ 
Sbjct: 183 PQLDMLRFPLGEYAKPDVRELARRFDLDVAEKPDSQDICFVPSGHYSDIVERLSPGAAVP 242

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMG------EPLFVVYLDKNSSRVIVGPRE 296
           G+IVH++G++LGRH G+I+YTIGQRRGLG+         +PL+VV LD   +RVIVGPRE
Sbjct: 243 GEIVHVDGRVLGRHAGVIHYTIGQRRGLGLGAAVAGRASDPLYVVRLDAARARVIVGPRE 302

Query: 297 SLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKS 355
           +LE   + LR++NW+G+G   D    G +   ++RS++ P P   +     G  V FE  
Sbjct: 303 ALETRSVRLRDVNWIGEGELADLPEGGLEIEARVRSTRPPTPARLLPLAGGGAQVLFETG 362

Query: 356 EVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           E GV+ GQACVFY  D   ARVLGGG I+ ++ +    E +L+
Sbjct: 363 EFGVSPGQACVFYDRDGARARVLGGGFIAAAEHAAEPTEPILA 405


>gi|323137322|ref|ZP_08072400.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylocystis sp. ATCC 49242]
 gi|322397309|gb|EFX99832.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylocystis sp. ATCC 49242]
          Length = 412

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 214/383 (55%), Positives = 267/383 (69%), Gaps = 11/383 (2%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           + L L  +P D RVVVAMSGGVDSSVVAALLK  GYDV+GVTLQLY+  +A+ RKG+CCA
Sbjct: 9   DPLILPASPGDTRVVVAMSGGVDSSVVAALLKEQGYDVVGVTLQLYDHGEATHRKGACCA 68

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           GQD+ DAR V   + + H+V DYE RFR  VI  FA+SYA+GETP+PCV CN+ +KF+DL
Sbjct: 69  GQDIQDARAVAARLGIPHFVLDYERRFREKVIDEFAASYASGETPVPCVACNQFIKFADL 128

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
               + LGA VLATGHYI SR    DDG+  R + R  D  RDQSYFLFATT++QL  LR
Sbjct: 129 FETAKDLGAHVLATGHYISSR----DDGEGGRALYRAKDASRDQSYFLFATTREQLRMLR 184

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLGD  K  VR++AR  GL++ADK DSQDICFV  G+Y DVV+R+     + GDIVH++
Sbjct: 185 FPLGDYTKAEVREMARNYGLEVADKPDSQDICFVPSGRYTDVVERLAPDAVVPGDIVHVD 244

Query: 250 GQILGRHNGIINYTIGQRRGLGVAM------GEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           G++LGRH G+++YTIGQRRGLG+         EPLFVV LD   + V+VGPRE+LE   +
Sbjct: 245 GRVLGRHAGVVHYTIGQRRGLGLGASVAGRDAEPLFVVRLDAARAEVVVGPREALETRAV 304

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASG 362
            LR++NW+G G F D    G     ++RS++ PVP   + R D    V F  SE GV+ G
Sbjct: 305 ALRDVNWIGSGEFNDMPPQGIDIMARVRSTRPPVPARLIAREDSSATVVFAASEFGVSPG 364

Query: 363 QACVFYTSDSNEARVLGGGIISG 385
           QACVFY    + ARVLGGG I+ 
Sbjct: 365 QACVFYDRADDAARVLGGGFIAA 387


>gi|220925891|ref|YP_002501193.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium nodulans ORS
           2060]
 gi|254811453|sp|B8IU32|MNMA_METNO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|219950498|gb|ACL60890.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium nodulans ORS 2060]
          Length = 382

 Score =  432 bits (1110), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 212/377 (56%), Positives = 266/377 (70%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P+D RVVVAMSGGVDSSVVA LLKR GYDV+G+TLQLY+   A+ R+G+CC
Sbjct: 1   MNSLDLPKAPQDTRVVVAMSGGVDSSVVAGLLKRQGYDVVGITLQLYDHGAATHRRGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DARR  +T+ + HYV DYE+RFR AVI  FA SY  GETP+PCV+CNR++KF D
Sbjct: 61  AGQDIHDARRAAETLGIPHYVLDYEDRFREAVIDRFADSYIHGETPIPCVECNRSIKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+    LGAD LATGHY+ SR   G      R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLATALDLGADALATGHYVASRPRPGGS----RALYRALDPARDQSYFLYATTAEQLDVL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG++ K+  R LARE GL +ADK DSQDICFV QG+Y DV+ R+       G+IVHL
Sbjct: 177 RFPLGELPKDETRRLAREFGLSVADKPDSQDICFVPQGRYQDVIARLRPDSVRPGEIVHL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LGRH+GII +T+GQRRGL +A GEPL+VV LD  ++RV+VGPRE+L    I L E 
Sbjct: 237 DGRTLGRHDGIIGFTVGQRRGLKLATGEPLYVVRLDPETARVVVGPREALATSVIRLAET 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACV 366
           NWLGD    +  +DG    V++RS+++P P  ++ N       V     E GV+ GQAC 
Sbjct: 297 NWLGDEPLTE--LDGMPVAVRVRSTREPRPATLRWNRAASCAEVMLATPEDGVSPGQACA 354

Query: 367 FYTSDSNEARVLGGGII 383
            Y  +   ARVLGGG I
Sbjct: 355 IYADEGPRARVLGGGTI 371


>gi|170751444|ref|YP_001757704.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium radiotolerans JCM 2831]
 gi|205816882|sp|B1LV15|MNMA_METRJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|170657966|gb|ACB27021.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium radiotolerans JCM 2831]
          Length = 384

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 213/385 (55%), Positives = 273/385 (70%), Gaps = 10/385 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LDL K P + RVVVAMSGGVDSSVVA LLKR G+DV+GVTLQLY+   AS RKG+CC
Sbjct: 1   MNALDLPKAPHETRVVVAMSGGVDSSVVAGLLKRQGFDVVGVTLQLYDHGAASHRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD++DAR   + + + HYV DYE+RFR+ VI  FA SY AGETP+PCV+CNRTVKF D
Sbjct: 61  AGQDIHDARAAAEHLGIPHYVLDYEDRFRDEVIEKFAESYLAGETPIPCVECNRTVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R L AD LATGHY+ SR   G      R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLGLARDLDADALATGHYVASRALPGGG----RALHRALDPARDQSYFLYATTAEQLDFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+M+K   R LA+E+GL +A+K DSQDICFV QG+Y DV+ R+    A  G+IV L
Sbjct: 177 RFPLGEMEKTETRALAKELGLSLAEKPDSQDICFVPQGRYSDVIARLRPDAARPGEIVDL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G +LGRH+GI++YT+GQR+GLG++  EPL+VV L+ +++RV+VGPR +L   RI L ++
Sbjct: 237 DGHVLGRHDGIVHYTVGQRKGLGLSGPEPLYVVRLEPDAARVVVGPRTALATTRIRLSDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVF 367
           NWLG+G  E   V      V++RS++ P P  +    DG V V   + E GV+ GQAC  
Sbjct: 297 NWLGEGPAE--AVRDLPVAVRVRSTRPPRPATLTVGPDGAVEVVLAEPEDGVSPGQACAI 354

Query: 368 YTSDSNEARVLGGGIISGSKRSDAV 392
           Y  D   ARVLGGG I   +R DA+
Sbjct: 355 YADDGPRARVLGGGTI---RRVDAL 376


>gi|158425974|ref|YP_001527266.1| tRNA-specific 2-thiouridylase MnmA [Azorhizobium caulinodans ORS
           571]
 gi|172047846|sp|A8HVS0|MNMA_AZOC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|158332863|dbj|BAF90348.1| TRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Azorhizobium caulinodans ORS 571]
          Length = 390

 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 265/378 (70%), Gaps = 5/378 (1%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQD 72
           D+  +P   RVVVAMSGGVDSSVVA LL R G+DV+GVTLQLY+  +A++RKG+CCAGQD
Sbjct: 7   DIGTDPASTRVVVAMSGGVDSSVVAGLLARAGFDVVGVTLQLYDQGEAARRKGACCAGQD 66

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           +YDAR V D + + HYV DYE RFR  VI  FA SYAAG TP+PCVDCNRTVKF DLL+ 
Sbjct: 67  IYDARDVADRLGIPHYVLDYESRFREEVIERFADSYAAGFTPIPCVDCNRTVKFRDLLAT 126

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
              LGA VLATGHY+ SR     DG  RR + R  +  RDQSYFL+ATTQ Q   LRFPL
Sbjct: 127 AEDLGASVLATGHYVASRAL--PDG--RRGLFRAAEENRDQSYFLYATTQAQATKLRFPL 182

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G M+K  VR LA E+GL +ADK DSQDICFV  G Y +VV+R+       GDIVHL+G++
Sbjct: 183 GGMRKSDVRALAAELGLPVADKPDSQDICFVPGGDYAEVVERLRPEAGEAGDIVHLDGRV 242

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LGRH G+++YTIGQR+GLG++  EPL+VV +D     V VGPRE+L V  I L +INWLG
Sbjct: 243 LGRHRGVMHYTIGQRKGLGISTPEPLYVVAIDAARREVRVGPREALAVRSIGLTDINWLG 302

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFYTSD 371
           D    DA       +VK+RS++ P P  + R+ DG   V+    E GVA GQACVFY + 
Sbjct: 303 DVPLLDACAAEQDIYVKVRSTRPPTPARLLRDADGAPTVELLAGEEGVAPGQACVFYDAA 362

Query: 372 SNEARVLGGGIISGSKRS 389
           S  AR+LGGG I  ++R+
Sbjct: 363 SGAARLLGGGTIVRAERA 380


>gi|240140914|ref|YP_002965394.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens AM1]
 gi|254563424|ref|YP_003070519.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens DM4]
 gi|240010891|gb|ACS42117.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens AM1]
 gi|254270702|emb|CAX26706.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens DM4]
          Length = 410

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/377 (55%), Positives = 271/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 26  MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 85

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 86  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 145

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R+LGA+ LATGHY+ SR     +G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 146 LLGLARELGAEALATGHYVASRAR--PEGG--RALYRALDPARDQSYFLYATTPEQLAYL 201

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+IV L
Sbjct: 202 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEIVDL 261

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 262 DGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 321

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLGDG  ED V       V++RS+++P P  +  N  +    V+    E GV+ GQACV
Sbjct: 322 NWLGDGAPEDIVER--PVAVRVRSTREPRPARLSWNAAEACAEVELLVPEDGVSPGQACV 379

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 380 IYADDDPRAQVLGGGTI 396


>gi|83859630|ref|ZP_00953150.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicaulis alexandrii HTCC2633]
 gi|83851989|gb|EAP89843.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicaulis alexandrii HTCC2633]
          Length = 433

 Score =  422 bits (1084), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/375 (55%), Positives = 270/375 (72%), Gaps = 8/375 (2%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+L   P D RVV AMSGGVDSSVVAA+L R GY V+G+TLQLY+  +A  RKG+CCAGQ
Sbjct: 66  LNLGGEPSDHRVVAAMSGGVDSSVVAAVLHRAGYQVVGMTLQLYDHGEAVHRKGACCAGQ 125

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D++DARRV + +  +HYV DYE RFR AVI  FA +Y AG TP+PCV CN++VKF+DLL+
Sbjct: 126 DIHDARRVAEAMGFAHYVLDYETRFREAVIEDFADTYLAGFTPIPCVRCNQSVKFADLLA 185

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
            ++QLGAD L TGHYI+ R   G+  + RR      D  +DQSYFLFATT++QL  LRFP
Sbjct: 186 TSKQLGADCLVTGHYIQ-RTMSGNRPELRRAA----DAGKDQSYFLFATTEEQLDYLRFP 240

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG + KE  R+LA  +GL +A K DSQDICFV  G Y  VV+++  G +  G+IVHL+G+
Sbjct: 241 LGHLNKEQTRELAAALGLIVAAKPDSQDICFVPDGDYAAVVEKVRPGASRPGEIVHLDGR 300

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           ++G H G++ YT+GQRRGLG+A GEPL+VV LD  +++VIVGPRE+L+V RI L ++NW+
Sbjct: 301 VMGEHEGVLRYTVGQRRGLGIATGEPLYVVRLDAENAQVIVGPREALQVRRITLTDVNWI 360

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSD 371
           GDG   +A  DG    +K+RS++ P P  ++   DGV+V  E  E GVA GQACVFY S 
Sbjct: 361 GDGDLSEA--DGLTVGIKVRSTRPPKPAILEVTGDGVFVLLETGEEGVAPGQACVFY-SH 417

Query: 372 SNEARVLGGGIISGS 386
            +  RVLGGG I  +
Sbjct: 418 PDHDRVLGGGWIRAT 432


>gi|218532352|ref|YP_002423168.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium
           chloromethanicum CM4]
 gi|218524655|gb|ACK85240.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium chloromethanicum CM4]
          Length = 410

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 210/377 (55%), Positives = 271/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 26  MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 85

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 86  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFADSYLSGETPIPCVECNRSVKFRD 145

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R+LGA+ LATGHY+ SR     +G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 146 LLGLARELGAEALATGHYVASRAR--PEGG--RALYRALDPARDQSYFLYATTPEQLAYL 201

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+IV L
Sbjct: 202 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEIVDL 261

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 262 DGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 321

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLGDG  ED V       V++RS+++P P  +  N  +    V+    E GV+ GQACV
Sbjct: 322 NWLGDGTPEDIVER--PVAVRVRSTREPRPGRLSWNAAEACAEVELLVPEDGVSPGQACV 379

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 380 IYADDDPRAQVLGGGTI 396


>gi|154244361|ref|YP_001415319.1| tRNA-specific 2-thiouridylase MnmA [Xanthobacter autotrophicus Py2]
 gi|154158446|gb|ABS65662.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Xanthobacter autotrophicus Py2]
          Length = 436

 Score =  420 bits (1080), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/383 (55%), Positives = 263/383 (68%), Gaps = 5/383 (1%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T L  LD D +P   RVVVAMSGGVDSSVVA L  R GYDV+GVTLQLY+  +A+ R+G+
Sbjct: 49  TDLPLLDTDGDPASTRVVVAMSGGVDSSVVAGLYARAGYDVVGVTLQLYDHGEAAHRRGA 108

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD+YDA  V  T+ + HYV DYE RF+  VI  FA+SYA+G TP+PCVDCNRTVKF
Sbjct: 109 CCAGQDIYDASEVARTLGIPHYVLDYESRFKEEVIDRFAASYASGVTPIPCVDCNRTVKF 168

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL+   +LGA  LATGHY+ SR     DG  RR + R  +  RDQSYFL+ATT  QL 
Sbjct: 169 RDLLATAEELGARYLATGHYVASRAL--PDG--RRGLYRAAEEARDQSYFLYATTAAQLE 224

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLG+M+K  VR LA E GL +ADK DSQDICFV  G Y  VV+R+    A  GDIV
Sbjct: 225 RLRFPLGEMRKADVRALAAEFGLPVADKPDSQDICFVPGGDYAQVVQRLRPEAAEPGDIV 284

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           HL+G++LGRH G+++YTIGQR+GLG+A  EPL+V+ +D    +V VGPR +L V  I + 
Sbjct: 285 HLDGRVLGRHRGVMHYTIGQRKGLGIATPEPLYVIAIDAARQQVRVGPRAALSVSAITID 344

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQAC 365
           ++NWLGD  F DA+      +VK+RS++ PVP  + R  DG   V     E GVA GQAC
Sbjct: 345 DVNWLGDIPFTDALARQADVYVKVRSTRPPVPAHLARATDGTPAVHLAVGEEGVAPGQAC 404

Query: 366 VFYTSDSNEARVLGGGIISGSKR 388
           V Y      AR+LGGG I  ++R
Sbjct: 405 VLYDDAGAAARLLGGGTIMRAER 427


>gi|163853494|ref|YP_001641537.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens PA1]
 gi|163665099|gb|ABY32466.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium extorquens PA1]
          Length = 410

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/377 (55%), Positives = 270/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 26  MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 85

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 86  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 145

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R LGA+ LATGHY+ SR     +G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 146 LLGLARDLGAEALATGHYVASRAR--PEGG--RALYRALDPARDQSYFLYATTPEQLAYL 201

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+IV L
Sbjct: 202 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEIVDL 261

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 262 DGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 321

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLGDG  ED  +      V++RS+++P P  +  N  +    V+    E GV+ GQACV
Sbjct: 322 NWLGDGAPED--IAERPVAVRVRSTREPRPARLSWNAAEACAEVELLVPEDGVSPGQACV 379

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 380 IYADDDPRAQVLGGGTI 396


>gi|23012016|ref|ZP_00052207.1| COG0482: Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Magnetospirillum magnetotacticum MS-1]
          Length = 403

 Score =  419 bits (1078), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 207/377 (54%), Positives = 271/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 19  MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 78

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE++FR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 79  AGRDIHDARAVAETLGIPHYVLDYEDKFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 138

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL++ R LGA+ LATGHY+ SR  + + G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 139 LLALARDLGAEALATGHYVASR-PLAEGG---RGLFRALDPARDQSYFLYATTPEQLAFL 194

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++    A  G IV L
Sbjct: 195 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEAARPGAIVDL 254

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL +++GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 255 DGRHLGEHEGIIHYTVGQRRGLKLSVGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 314

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFE--KSEVGVASGQACV 366
           NWLG G  E   +      V++RS+++P P  +  N +    + E    E GV+ GQACV
Sbjct: 315 NWLGGGTPES--LAELPVAVRVRSTREPRPARLSWNAEAACAEVELVAPEDGVSPGQACV 372

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 373 IYADDGPRAQVLGGGTI 389


>gi|205829088|sp|A7ICB9|MNMA_XANP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 389

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/383 (55%), Positives = 263/383 (68%), Gaps = 5/383 (1%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T L  LD D +P   RVVVAMSGGVDSSVVA L  R GYDV+GVTLQLY+  +A+ R+G+
Sbjct: 2   TDLPLLDTDGDPASTRVVVAMSGGVDSSVVAGLYARAGYDVVGVTLQLYDHGEAAHRRGA 61

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD+YDA  V  T+ + HYV DYE RF+  VI  FA+SYA+G TP+PCVDCNRTVKF
Sbjct: 62  CCAGQDIYDASEVARTLGIPHYVLDYESRFKEEVIDRFAASYASGVTPIPCVDCNRTVKF 121

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL+   +LGA  LATGHY+ SR     DG  RR + R  +  RDQSYFL+ATT  QL 
Sbjct: 122 RDLLATAEELGARYLATGHYVASRAL--PDG--RRGLYRAAEEARDQSYFLYATTAAQLE 177

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLG+M+K  VR LA E GL +ADK DSQDICFV  G Y  VV+R+    A  GDIV
Sbjct: 178 RLRFPLGEMRKADVRALAAEFGLPVADKPDSQDICFVPGGDYAQVVQRLRPEAAEPGDIV 237

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           HL+G++LGRH G+++YTIGQR+GLG+A  EPL+V+ +D    +V VGPR +L V  I + 
Sbjct: 238 HLDGRVLGRHRGVMHYTIGQRKGLGIATPEPLYVIAIDAARQQVRVGPRAALSVSAITID 297

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQAC 365
           ++NWLGD  F DA+      +VK+RS++ PVP  + R  DG   V     E GVA GQAC
Sbjct: 298 DVNWLGDIPFTDALARQADVYVKVRSTRPPVPAHLARATDGTPAVHLAVGEEGVAPGQAC 357

Query: 366 VFYTSDSNEARVLGGGIISGSKR 388
           V Y      AR+LGGG I  ++R
Sbjct: 358 VLYDDAGAAARLLGGGTIMRAER 380


>gi|205822340|sp|A9W8W7|MNMA_METEP RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 385

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 209/377 (55%), Positives = 270/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 1   MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 61  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R LGA+ LATGHY+ SR     +G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLGLARDLGAEALATGHYVASR--ARPEGG--RALYRALDPARDQSYFLYATTPEQLAYL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++       G+IV L
Sbjct: 177 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEATRPGEIVDL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL ++ GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 237 DGRRLGEHEGIIHYTVGQRRGLKLSAGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLGDG  ED  +      V++RS+++P P  +  N  +    V+    E GV+ GQACV
Sbjct: 297 NWLGDGAPED--IAERPVAVRVRSTREPRPARLSWNAAEACAEVELLVPEDGVSPGQACV 354

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 355 IYADDDPRAQVLGGGTI 371


>gi|114798727|ref|YP_759370.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hyphomonas neptunium ATCC 15444]
 gi|123323559|sp|Q0C4H3|MNMA_HYPNA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|114738901|gb|ABI77026.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hyphomonas neptunium ATCC 15444]
          Length = 394

 Score =  418 bits (1075), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/379 (54%), Positives = 263/379 (69%), Gaps = 6/379 (1%)

Query: 6   ATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG 65
           A R+NSL   K P + RVV AMSGGVDSSVVAA+LK +GYDVIG+TLQLY+   A ++KG
Sbjct: 10  AGRVNSLGFAKPPHETRVVAAMSGGVDSSVVAAMLKAEGYDVIGITLQLYDHGAAIEKKG 69

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
           +CCAGQD++DAR V D I + HYV DYE RFR  V+  FA +Y +G TP+PC+ CN+TVK
Sbjct: 70  ACCAGQDIHDARNVSDAIGIPHYVLDYESRFREQVMEDFADTYLSGSTPIPCIRCNQTVK 129

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F+DLL+  ++LGAD LATGHYIR       DG     + R  D  RDQSYFLFATT+ QL
Sbjct: 130 FADLLATAKELGADCLATGHYIRR-----TDGPEGPELHRAQDASRDQSYFLFATTRAQL 184

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             LRFPLG + K  VR+LA +  L +A K DSQDICFV  G Y  VV+++  G    G+I
Sbjct: 185 DFLRFPLGSLPKSEVRELAEKFALQVAAKPDSQDICFVPDGSYAKVVEKLRPGSGRGGEI 244

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           VHL+G++LG+H G+I+YTIGQRRGLGVA G+PLFVV +D  + RVIVGPRE+L    + L
Sbjct: 245 VHLDGRVLGKHEGVIHYTIGQRRGLGVATGDPLFVVKIDAPARRVIVGPREALMTRGLLL 304

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC 365
            E+NWLG G  E+A   G +  +++RS++ PVP  +   D    V F+  E GVA GQA 
Sbjct: 305 EELNWLGQGSLEEAATHGARVLIRVRSTRPPVPGRLGYEDGVPAVFFDAPEEGVARGQAA 364

Query: 366 VFYTSDSNEARVLGGGIIS 384
           V Y  + +  R+LGGG I+
Sbjct: 365 VLYDLEGS-TRILGGGFIA 382


>gi|298292472|ref|YP_003694411.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Starkeya novella DSM 506]
 gi|296928983|gb|ADH89792.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Starkeya novella DSM 506]
          Length = 395

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/358 (57%), Positives = 256/358 (71%), Gaps = 6/358 (1%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQ 71
           D  ++P   RVVVAMSGGVDSSVVAAL  + GYDV+GVTLQLY+  +A   R G+CCAGQ
Sbjct: 6   DTSRSPSHTRVVVAMSGGVDSSVVAALYAKAGYDVVGVTLQLYDHGEAMHHRPGACCAGQ 65

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+YDAR V + + + HYV DYE RFR+AVI  FA +YAAGETP+PCVDCNRTVKF DLL 
Sbjct: 66  DIYDARTVAEKLGIPHYVLDYESRFRHAVIERFADAYAAGETPIPCVDCNRTVKFRDLLE 125

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
             R LGAD+LATGHY+ SR   G     RR + RP+D  RDQSYFL+ATTQ+Q+  LRFP
Sbjct: 126 TARDLGADILATGHYVTSRALEGG----RRALFRPLDESRDQSYFLYATTQEQIDMLRFP 181

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG+  K  VR LA E GL +ADK DSQDICFV  G Y  +V+++    A  G+IVHL+G+
Sbjct: 182 LGETTKPEVRALAEEFGLKVADKPDSQDICFVPNGHYTAIVEKLRPEAAEPGEIVHLDGR 241

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           +LG+H G++ YTIGQR+GLG+A  EPL+VV +D    RV+VGPR +L V  I + E+NWL
Sbjct: 242 VLGQHAGVMRYTIGQRKGLGIAASEPLYVVGIDAGRRRVLVGPRAALGVSAIRIDEVNWL 301

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFY 368
           GD   + A   G   +VK+RS++ PVP  + R +D GV V    +E GVA GQACVFY
Sbjct: 302 GDETLDAAAEAGRDLYVKVRSARAPVPGHLARASDGGVEVHLAGAEEGVAPGQACVFY 359


>gi|312116059|ref|YP_004013655.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221188|gb|ADP72556.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 395

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/375 (54%), Positives = 260/375 (69%), Gaps = 9/375 (2%)

Query: 11  SLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAG 70
           +L L  +P   R+VVAMSGGVDSS+ AAL+KR GYD +G+TLQLY+  +A  RKG+CCAG
Sbjct: 23  ALGLTGSPSSHRIVVAMSGGVDSSLTAALVKRAGYDTVGITLQLYDHGEAMARKGACCAG 82

Query: 71  QDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL 130
           QD+ DAR V D + V HYV DYE+RFR +VI  FA SY AGETP+PCV CN+TVKF DLL
Sbjct: 83  QDIMDARGVADRLGVPHYVLDYEDRFRQSVIDDFADSYLAGETPVPCVRCNQTVKFRDLL 142

Query: 131 SVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRF 190
              R+LGA  L TGHY+RS       G R   M +  D +RDQSYFLFATTQ QL  LRF
Sbjct: 143 GAARELGASALVTGHYVRSV-----PGPRGIEMHQAADPDRDQSYFLFATTQAQLDFLRF 197

Query: 191 PLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNG 250
           PLG M K   R++A  + L +A K DSQDICFV  G Y  +++++       G+IVH +G
Sbjct: 198 PLGGMTKTETREMAAALHLPVASKPDSQDICFVPSGDYASIIRKLRPESGEPGEIVHADG 257

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           ++LG+H GIIN+T+GQR+GLG+A GEPLFV+ ++ ++ RVIVGPRE L   R+ LR++NW
Sbjct: 258 RVLGQHPGIINFTVGQRKGLGIATGEPLFVIRIEPSARRVIVGPREMLRTARLSLRDVNW 317

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDP--VPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           +G G  ++AV  G   FVK+RS+Q P    +F +R   GV VD    E GVA+GQACVFY
Sbjct: 318 IGGGSLDEAVAGGRSLFVKVRSTQPPREARLFAERG--GVGVDLAGGEFGVAAGQACVFY 375

Query: 369 TSDSNEARVLGGGII 383
                 ARVLGGG I
Sbjct: 376 DRAGGAARVLGGGFI 390


>gi|188583764|ref|YP_001927209.1| tRNA-specific 2-thiouridylase MnmA [Methylobacterium populi BJ001]
 gi|179347262|gb|ACB82674.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Methylobacterium populi BJ001]
          Length = 395

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 271/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 11  MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 70

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 71  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 130

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R LGA+ LATGHY+ SR     +G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 131 LLGMARDLGAEALATGHYVASR--AQPEGG--RALYRALDPARDQSYFLYATTPEQLAFL 186

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++    A  G+IV L
Sbjct: 187 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEAARPGEIVDL 246

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL +++GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 247 DGRRLGEHEGIIHYTVGQRRGLKLSVGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 306

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLG     D + D     V++RS+++P P  +  N  +  + V+    E GV+ GQACV
Sbjct: 307 NWLGS-RAPDGLAD-LPVAVRVRSTREPRPARLSWNAAEACLEVELVVPEDGVSPGQACV 364

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 365 IYADDGPRAQVLGGGTI 381


>gi|205822346|sp|B1ZGZ6|MNMA_METPB RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 385

 Score =  414 bits (1065), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 271/377 (71%), Gaps = 8/377 (2%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSLDL K P + RVVVAMSGGVDSSVVA LLKR+GYDV+GVTLQLY+   A+ RKG+CC
Sbjct: 1   MNSLDLPKPPHETRVVVAMSGGVDSSVVAGLLKREGYDVVGVTLQLYDHGAATHRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DAR V +T+ + HYV DYE+RFR +VI  FA SY +GETP+PCV+CNR+VKF D
Sbjct: 61  AGRDIHDARAVAETLGIPHYVLDYEDRFRESVIDRFAESYLSGETPIPCVECNRSVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL + R LGA+ LATGHY+ SR     +G   R + R +D  RDQSYFL+ATT +QL  L
Sbjct: 121 LLGMARDLGAEALATGHYVASR--AQPEGG--RALYRALDPARDQSYFLYATTPEQLAFL 176

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG+  K+  R LARE+GL +ADK+DSQDICFV QG Y DV+ ++    A  G+IV L
Sbjct: 177 RFPLGERPKDETRALARELGLAVADKADSQDICFVPQGGYADVIAKLRPEAARPGEIVDL 236

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
           +G+ LG H GII+YT+GQRRGL +++GEPL+VV L+  ++RV+VGPR +L   RI L ++
Sbjct: 237 DGRRLGEHEGIIHYTVGQRRGLKLSVGEPLYVVRLEPETARVVVGPRAALATRRIRLTDL 296

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN--DDGVYVDFEKSEVGVASGQACV 366
           NWLG     D + D     V++RS+++P P  +  N  +  + V+    E GV+ GQACV
Sbjct: 297 NWLGS-RAPDGLAD-LPVAVRVRSTREPRPARLSWNAAEACLEVELVVPEDGVSPGQACV 354

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D   A+VLGGG I
Sbjct: 355 IYADDGPRAQVLGGGTI 371


>gi|114569244|ref|YP_755924.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Maricaulis maris MCS10]
 gi|122316614|sp|Q0ARV1|MNMA_MARMM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|114339706|gb|ABI64986.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Maricaulis maris MCS10]
          Length = 405

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/374 (55%), Positives = 264/374 (70%), Gaps = 10/374 (2%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           + L L  NP D RVVVAMSGGVDSSV AALL   GYDV+GVTLQLY+   A  +KG+CCA
Sbjct: 25  DPLGLGGNPGDHRVVVAMSGGVDSSVTAALLHHLGYDVVGVTLQLYDHGAAMAKKGACCA 84

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           GQD+YDA+RV +     HYV DYE RFR AVI  FA +Y AG TP+PCV CN+TVKF+DL
Sbjct: 85  GQDIYDAKRVAEACGFRHYVLDYESRFREAVIEEFADTYLAGFTPIPCVRCNQTVKFADL 144

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L+  RQLGA  +ATGHYI+       DG     + R  D  +DQSYFLFATT  QL  LR
Sbjct: 145 LTTARQLGAVCMATGHYIQRV-----DGPNGAELRRAADAGKDQSYFLFATTHDQLDFLR 199

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG + K+  R+LA   GL +ADK DSQDICFV  G+Y D+V+++  G +  G+IVH++
Sbjct: 200 FPLGHLNKDQTRELAEAFGLIVADKPDSQDICFVPNGRYVDIVEKVRPGASRPGEIVHVD 259

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G++LG H G+I YT+GQRRGL +A+G+PL+VV LD   + V+VGPRE+LE+  I L++IN
Sbjct: 260 GRVLGTHEGVIRYTVGQRRGLKIAVGDPLYVVRLDAAKAEVVVGPREALEIDTIALKDIN 319

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYT 369
           WLGD    +A +DG    VK+RS++ PVP  +  + D + V   + E GVA GQACVFY+
Sbjct: 320 WLGD----EAPLDGAPVRVKVRSTRPPVPAALSVDGDDIRVVLARGEEGVAPGQACVFYS 375

Query: 370 SDSNEARVLGGGII 383
           SD +E RVLGGG I
Sbjct: 376 SD-DEDRVLGGGWI 388


>gi|218682213|ref|ZP_03529814.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli CIAT 894]
          Length = 294

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/294 (64%), Positives = 232/294 (78%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +N+LD DK P++ RVVVAMSGGVDSSVVA LLK+ GYDV+G+TLQLY+   A  R GSCC
Sbjct: 1   MNTLDFDKKPEETRVVVAMSGGVDSSVVAGLLKQQGYDVLGITLQLYDHGAAVHRAGSCC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+ DARRVC+T+ + HYV DYE+RFR  VI PFA SY AGETP+PCV CN+TVKF+D
Sbjct: 61  AGQDIDDARRVCETLGIPHYVLDYEKRFRETVINPFAESYVAGETPIPCVSCNQTVKFAD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  ++LGAD LATGHYIRSR     D   RR + RP D +RDQSYFLFATTQ+Q+  L
Sbjct: 121 LLATAKELGADALATGHYIRSRPNPLADKPGRRALFRPADADRDQSYFLFATTQEQIDYL 180

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA EMGL +A K+DSQDICFV QGKY D++ ++    AL G+IVHL
Sbjct: 181 RFPLGGLPKAETRRLAEEMGLVVAKKADSQDICFVPQGKYSDIITKLKPNAALAGEIVHL 240

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           +G++LG H GI+++TIGQRRG+G+A GEPL+VV+LD  S RVIVGP+E+LE HR
Sbjct: 241 DGRVLGTHEGILHFTIGQRRGIGIATGEPLYVVFLDARSRRVIVGPKEALETHR 294


>gi|329890336|ref|ZP_08268679.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brevundimonas diminuta ATCC 11568]
 gi|328845637|gb|EGF95201.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Brevundimonas diminuta ATCC 11568]
          Length = 410

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/371 (55%), Positives = 259/371 (69%), Gaps = 7/371 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  RVV AMSGGVDS+VVAALL + GYDV+GVTLQLY+  +A K+KG+CCAGQD++DAR
Sbjct: 42  PQGARVVAAMSGGVDSTVVAALLHKAGYDVVGVTLQLYDHGEALKKKGACCAGQDIHDAR 101

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              D I + HYV DYE RF++AVI  FA SY  G+TP+PC+ CN+TVKF DLL V R LG
Sbjct: 102 LAADLIGIPHYVLDYENRFKDAVIDQFADSYLKGQTPVPCIRCNQTVKFRDLLDVARDLG 161

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY+R   +    G R + M + +D  RDQSYFLFATTQ QL  LRFPL D++K
Sbjct: 162 AEAMATGHYVRRATH----GNRSQ-MRKAVDHSRDQSYFLFATTQDQLDYLRFPLADLEK 216

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A  +GL IA K DSQDICFV  G Y  ++ R+       GDIVH++G++LGRH+
Sbjct: 217 PQVRGVAASLGLRIAAKPDSQDICFVPTGDYRTLIDRLRPQGREAGDIVHMDGRVLGRHS 276

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD-GLF 316
           GI +YTIGQRRGL VA+GEPLFVV LD +  RVIVGPRE+L   R+ L E NWLGD    
Sbjct: 277 GITDYTIGQRRGLNVAVGEPLFVVKLDPDHRRVIVGPREALLTARLTLEETNWLGDQATI 336

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           E+A  DG     ++RS++ P P  +   D  V V F++ E GVA GQACV Y    +E R
Sbjct: 337 EEAARDGAPVLARVRSTRQPSPARLALVDGAVQVVFDQGEEGVAPGQACVLYDPADDE-R 395

Query: 377 VLGGGIISGSK 387
           V+GGG I  ++
Sbjct: 396 VMGGGFIHSTE 406


>gi|315497620|ref|YP_004086424.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Asticcacaulis excentricus CB 48]
 gi|315415632|gb|ADU12273.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Asticcacaulis excentricus CB 48]
          Length = 402

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/376 (54%), Positives = 262/376 (69%), Gaps = 10/376 (2%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RVV AMSGGVDSSV AALL   GY+VIGVTLQLY+  +A K+ G+CCAGQD++DAR   +
Sbjct: 36  RVVAAMSGGVDSSVAAALLHAAGYEVIGVTLQLYDHGQALKKTGACCAGQDIHDARVAAE 95

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I ++HYV DYE RF+++VI  FA SY  GETP+PC+ CN+TVKF DLL V R LGA+ +
Sbjct: 96  KIGIAHYVLDYESRFKDSVIEEFADSYLRGETPVPCIRCNQTVKFRDLLDVARDLGAEAM 155

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+  R    D G R  +  R +D  RDQSYFLFATT++QL  LRFPL D+ K  VR
Sbjct: 156 ATGHYVERR----DTGNRAELR-RAIDRNRDQSYFLFATTREQLDFLRFPLADIPKPQVR 210

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           D+AR+MGL++A K DSQDICFV +GKY  ++ R+       GDIVHL+G++LG+H GI  
Sbjct: 211 DIARQMGLNVAAKPDSQDICFVPEGKYTTLIDRLRPQGREAGDIVHLDGRVLGKHQGITG 270

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG-LFEDAV 320
           YTIGQRRGL +A+GEPLFV+ LD  + RVIVGPRE+L    + ++E NWLGD    E A 
Sbjct: 271 YTIGQRRGLNIAVGEPLFVIKLDAETRRVIVGPREALNTAALVMKETNWLGDHETLESAA 330

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                   ++RS++ PVP  +   +  V V F+ SE GVA GQACV Y   ++E RVLGG
Sbjct: 331 AAHLPVLARVRSTRPPVPARLNLREGQVEVVFDASEEGVAPGQACVLY-DPADEDRVLGG 389

Query: 381 GIISGSKRSDAVEESL 396
           G I   +R+  VE +L
Sbjct: 390 GFI---ERTRPVELAL 402


>gi|254294555|ref|YP_003060578.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hirschia baltica ATCC 49814]
 gi|254043086|gb|ACT59881.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hirschia baltica ATCC 49814]
          Length = 409

 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/375 (52%), Positives = 259/375 (69%), Gaps = 6/375 (1%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L  DK   + RVV AMSGGVDS+VVAALL   GYDV+GVTLQLY+   A K++G+CCAGQ
Sbjct: 31  LGFDKPRSETRVVAAMSGGVDSTVVAALLHHAGYDVVGVTLQLYDHGAALKKQGACCAGQ 90

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D++DARR CD + + HYV DYE RF+  V+  FA +Y AG TP+PCV CN+TVKF DLL 
Sbjct: 91  DIHDARRACDALGIPHYVLDYESRFKEQVMEDFADTYLAGSTPIPCVRCNQTVKFRDLLE 150

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
            ++ LGAD +ATGHYIR    VG++G     + R  D ++DQSYFLFATT +QL  LRFP
Sbjct: 151 TSKDLGADCMATGHYIRR--VVGENGPE---LARAADPDKDQSYFLFATTHEQLDYLRFP 205

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG M KES R +A  +GL++A K DSQDICFV  GKY  +V+++  G   +G+IVH++G+
Sbjct: 206 LGGMNKESTRKVASALGLEVASKPDSQDICFVPDGKYTAIVEKLRPGSGRKGEIVHMDGR 265

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           +LG H G+I YT+GQRRGLGVA GEP++VV +D    +VIVGPRE+LE   + + E NWL
Sbjct: 266 VLGEHEGVIKYTVGQRRGLGVATGEPIYVVKIDAGKRQVIVGPREALETRGLSMGESNWL 325

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSD 371
           G    E+A         ++RS++ P    +   +      FE +E GVA GQACV Y++ 
Sbjct: 326 GANSLEEACASNTPALARVRSTRPPKAGHMAMINGQPGFMFEDAEEGVAPGQACVLYST- 384

Query: 372 SNEARVLGGGIISGS 386
            + +RVLGGG I+G+
Sbjct: 385 GDASRVLGGGFITGT 399


>gi|300023996|ref|YP_003756607.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525817|gb|ADJ24286.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 397

 Score =  402 bits (1032), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/369 (52%), Positives = 254/369 (68%), Gaps = 6/369 (1%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RVVVAMSGGVDSSV AA++K  G+DVIGVTLQLY+   A+ RKGSCCAGQD++DARRV D
Sbjct: 16  RVVVAMSGGVDSSVAAAIMKAAGHDVIGVTLQLYDHGSATGRKGSCCAGQDIHDARRVAD 75

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV DYE RF   VI  FA SY  GETP+PCV CN  +KF DLL   + LGA+VL
Sbjct: 76  ALGIPHYVLDYEARFAQKVIESFAESYVHGETPIPCVTCNNEIKFRDLLETAKDLGAEVL 135

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
            TGHY++ R     D +    + R +D +RDQSYFLF  T+ QL  L FP+G ++K  VR
Sbjct: 136 VTGHYVQRR-----DTEHGPELARAVDTDRDQSYFLFGITKAQLAALWFPVGALEKSEVR 190

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           DLAR   L +ADKSDSQDICFV  G+Y DV++R+       G+IVHL+G++LGRH GI++
Sbjct: 191 DLARSFNLPVADKSDSQDICFVPTGRYTDVIERLKPNALDAGNIVHLDGRVLGRHEGIVH 250

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YT+GQRRG+ +   EPL+VV LD   + V+VGPR +L    + LR++NWLG+  F ++  
Sbjct: 251 YTVGQRRGIKIPAAEPLYVVRLDAAKNEVVVGPRSALTTTGLILRDVNWLGENSFAESAR 310

Query: 322 DGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
           +G + FV++RSSQ      V  + + G  V+    E G+A+GQACVFY S    ARVLGG
Sbjct: 311 NGLELFVRMRSSQKLRAALVTADGETGGKVELHDGEEGIATGQACVFYASQEPGARVLGG 370

Query: 381 GIISGSKRS 389
           G I+ + ++
Sbjct: 371 GWIAKTVKA 379


>gi|221233878|ref|YP_002516314.1| tRNA-specific 2-thiouridylase MnmA [Caulobacter crescentus NA1000]
 gi|220963050|gb|ACL94406.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Caulobacter crescentus NA1000]
          Length = 410

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/373 (54%), Positives = 261/373 (69%), Gaps = 6/373 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  R+V AMSGGVDS+V AALL R GYDV+GVTLQLY+   A  RKG+CCAGQD+ DAR
Sbjct: 35  PEGARIVAAMSGGVDSTVTAALLARAGYDVVGVTLQLYDHGAAISRKGACCAGQDILDAR 94

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RFR  VI  FA +Y  GETP+PCV CN+TVKF DLL V R LG
Sbjct: 95  MAAERIGIPHYVLDYESRFREQVIEDFADAYLRGETPIPCVRCNQTVKFRDLLDVARDLG 154

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY++ R   G+ G R  +  R  D  +DQSYFLFATT++QL  LRFPLG M K
Sbjct: 155 AEAMATGHYVQ-RAMPGNGGNRPELR-RAADPAKDQSYFLFATTREQLDFLRFPLGGMDK 212

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR +A  +GL IADK DSQDICFV +GKY  V+ RI    A  GD+VHL+G++LGRH 
Sbjct: 213 PTVRAVAAGLGLSIADKPDSQDICFVPEGKYTTVIDRIRPQGAEAGDVVHLDGRVLGRHE 272

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG--DGL 315
           G+  YTIGQRRGL +A+G+PLFVV ++ +  +VIVGPRE+L    + L+E +WLG  D L
Sbjct: 273 GVTRYTIGQRRGLNIAVGDPLFVVKINADKRQVIVGPREALLTASLTLKEGSWLGAQDSL 332

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
            E A  DG +   ++RS+++PVP  +   D  + V F+ +E GVA GQACV Y   ++  
Sbjct: 333 -EAAAEDGQRVLARVRSTREPVPGRLAMIDGALSVVFDGAEEGVAPGQACVLYDP-ADPD 390

Query: 376 RVLGGGIISGSKR 388
           RVLGGG I+G+ R
Sbjct: 391 RVLGGGFIAGTTR 403


>gi|16125150|ref|NP_419714.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Caulobacter crescentus CB15]
 gi|14195261|sp|P58074|MNMA_CAUCR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|13422162|gb|AAK22882.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Caulobacter crescentus CB15]
          Length = 383

 Score =  399 bits (1024), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 205/373 (54%), Positives = 261/373 (69%), Gaps = 6/373 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  R+V AMSGGVDS+V AALL R GYDV+GVTLQLY+   A  RKG+CCAGQD+ DAR
Sbjct: 8   PEGARIVAAMSGGVDSTVTAALLARAGYDVVGVTLQLYDHGAAISRKGACCAGQDILDAR 67

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RFR  VI  FA +Y  GETP+PCV CN+TVKF DLL V R LG
Sbjct: 68  MAAERIGIPHYVLDYESRFREQVIEDFADAYLRGETPIPCVRCNQTVKFRDLLDVARDLG 127

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY++ R   G+ G R  +  R  D  +DQSYFLFATT++QL  LRFPLG M K
Sbjct: 128 AEAMATGHYVQ-RAMPGNGGNRPELR-RAADPAKDQSYFLFATTREQLDFLRFPLGGMDK 185

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR +A  +GL IADK DSQDICFV +GKY  V+ RI    A  GD+VHL+G++LGRH 
Sbjct: 186 PTVRAVAAGLGLSIADKPDSQDICFVPEGKYTTVIDRIRPQGAEAGDVVHLDGRVLGRHE 245

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG--DGL 315
           G+  YTIGQRRGL +A+G+PLFVV ++ +  +VIVGPRE+L    + L+E +WLG  D L
Sbjct: 246 GVTRYTIGQRRGLNIAVGDPLFVVKINADKRQVIVGPREALLTASLTLKEGSWLGAQDSL 305

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
            E A  DG +   ++RS+++PVP  +   D  + V F+ +E GVA GQACV Y   ++  
Sbjct: 306 -EAAAEDGQRVLARVRSTREPVPGRLAMIDGALSVVFDGAEEGVAPGQACVLYDP-ADPD 363

Query: 376 RVLGGGIISGSKR 388
           RVLGGG I+G+ R
Sbjct: 364 RVLGGGFIAGTTR 376


>gi|197104258|ref|YP_002129635.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phenylobacterium zucineum HLK1]
 gi|196477678|gb|ACG77206.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phenylobacterium zucineum HLK1]
          Length = 371

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/372 (53%), Positives = 254/372 (68%), Gaps = 7/372 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P   R+V AMSGGVDS+V AALL R GYDV+GVTLQLY+   A ++KG+CCAGQD++DAR
Sbjct: 4   PAGTRIVAAMSGGVDSTVTAALLARAGYDVVGVTLQLYDHGAAVQKKGACCAGQDIHDAR 63

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RF+  VI  FA +Y  GETP+PC+ CN+TVKF DLL V R LG
Sbjct: 64  TAAEGIGIPHYVLDYESRFKQQVIEDFADAYLRGETPIPCIRCNQTVKFRDLLDVARDLG 123

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A  +ATGHY+R     G +G     + R  D  RDQSYFLFATT +QL  LRFPLG M K
Sbjct: 124 AQAMATGHYVRRE--AGAEGPE---LHRAADPARDQSYFLFATTAEQLDYLRFPLGAMPK 178

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR  A E+GL +ADK DSQDICFV +G+Y  ++ R+    A  GDIVHL+G++LGRH 
Sbjct: 179 PAVRAAAAELGLAVADKPDSQDICFVPEGRYTTIIDRLRPQGAEPGDIVHLDGRVLGRHE 238

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL-F 316
           G+  YTIGQRRGL VA+G+PLFVV +D ++ +V+VGPRE+L    + L+E NW+G G   
Sbjct: 239 GVTRYTIGQRRGLNVAVGDPLFVVRIDADARQVVVGPREALLTRALGLKETNWIGGGPSI 298

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           E A   G     ++RS+++PVP  +   D    V F+  E GVA GQACV Y  +S   R
Sbjct: 299 EAACEAGRPVLARVRSTREPVPGRLSLVDGVPGVVFDNPEEGVAPGQACVLYAPES-PTR 357

Query: 377 VLGGGIISGSKR 388
           VLGGG I+G+ R
Sbjct: 358 VLGGGFIAGTVR 369


>gi|295690747|ref|YP_003594440.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Caulobacter segnis ATCC 21756]
 gi|295432650|gb|ADG11822.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Caulobacter segnis ATCC 21756]
          Length = 409

 Score =  395 bits (1015), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 206/374 (55%), Positives = 256/374 (68%), Gaps = 7/374 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P+  R+V AMSGGVDS+V AALL R GYDV+GVTLQLY+   A  RKG+CCAGQD+ DAR
Sbjct: 35  PEGTRIVAAMSGGVDSTVTAALLARAGYDVVGVTLQLYDHGAAISRKGACCAGQDILDAR 94

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RFR  VI  FA +Y  GETP+PCV CN+TVKF DLL V R LG
Sbjct: 95  MAAERIGIPHYVLDYESRFREQVIEDFADAYLRGETPIPCVRCNQTVKFRDLLDVARDLG 154

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY++  +  G +  + R   R  D  +DQSYFLFATT++QL  LRFPLG M K
Sbjct: 155 AEAMATGHYVQRGMPAGTNRPQLR---RAADPAKDQSYFLFATTREQLDFLRFPLGGMDK 211

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR +A  +GL IADK DSQDICFV +GKY  V+ RI    A  GDIVHL+G++LGRH 
Sbjct: 212 PTVRAVAAGLGLSIADKPDSQDICFVPEGKYTTVIDRIRPQGAEAGDIVHLDGRVLGRHE 271

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG--DGL 315
           G+  YTIGQRRGL VA+G+PLFVV +D +  +VIVGPRE+L    + L+E NWLG  D L
Sbjct: 272 GVTRYTIGQRRGLNVAVGDPLFVVRIDADKRQVIVGPREALLTAALTLKETNWLGGQDDL 331

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
              A  +G     ++RS+++PV   +   D  V V F+ SE GVA GQACV Y     E 
Sbjct: 332 AA-AADEGQPVLARVRSTREPVAGRLSLLDGEVAVTFDGSEEGVAPGQACVLYDPADPE- 389

Query: 376 RVLGGGIISGSKRS 389
           RVLGGG I+ + R+
Sbjct: 390 RVLGGGFIARAVRA 403


>gi|254419496|ref|ZP_05033220.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brevundimonas sp. BAL3]
 gi|196185673|gb|EDX80649.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brevundimonas sp. BAL3]
          Length = 400

 Score =  392 bits (1006), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/367 (55%), Positives = 251/367 (68%), Gaps = 7/367 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P   RVV AMSGGVDS+VVAALL + GYDV+GVTLQLY+   A K+KG+CCAGQD++DAR
Sbjct: 32  PVGARVVAAMSGGVDSTVVAALLHKAGYDVVGVTLQLYDHGAALKKKGACCAGQDIHDAR 91

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RF++AVI  FA SY  G+TP+PC+ CN+TVKF DLL V R LG
Sbjct: 92  LAAEMIGIPHYVLDYESRFKDAVIDQFADSYLKGQTPVPCIRCNQTVKFRDLLDVARDLG 151

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY+R R  VG+    R  M + +D  RDQSYFLFATTQ QL  LRFPL D++K
Sbjct: 152 AEAMATGHYVR-RAAVGN----RSQMRKAIDHSRDQSYFLFATTQDQLDYLRFPLADLEK 206

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR +A E+GL IA K DSQDICFV  G Y  ++ R+       G+IVH++G++LG H 
Sbjct: 207 PQVRGVAAELGLKIAAKPDSQDICFVPSGDYRTLIDRLRPQGREAGEIVHMDGRVLGTHA 266

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD-GLF 316
           GI +YTIGQRRGL VA+GEPLFVV L+  + RVIVGPRE+L    + L E NWLGD    
Sbjct: 267 GITDYTIGQRRGLNVAVGEPLFVVKLEPETRRVIVGPREALLTASLTLEETNWLGDEATI 326

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            +A         ++RS++ P P  +   DD V V F++ E GVA GQAC  Y  D  + R
Sbjct: 327 MEAAQANLPVLARVRSTRPPSPARLILIDDQVCVVFDEGEEGVAPGQACALYDPDDPD-R 385

Query: 377 VLGGGII 383
           VLGGG I
Sbjct: 386 VLGGGFI 392


>gi|84686908|ref|ZP_01014792.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84665105|gb|EAQ11585.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium HTCC2654]
          Length = 381

 Score =  385 bits (990), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 202/386 (52%), Positives = 259/386 (67%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +    R+NSL   K   + RVVVAMSGGVDSSVVAA LKR+GYDVIGVTLQLY+   A
Sbjct: 1   MSLDTEIRVNSLGFAKPESETRVVVAMSGGVDSSVVAAKLKREGYDVIGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  FR AVI  FA SY  G TP+PC+ C
Sbjct: 61  LAKKGACCAGVDIHDARRVAEEMGFPHYVLDYENIFREAVIEEFADSYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL+  + L AD +ATGHYI+   + GD G     + R  D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLATAKDLDADCMATGHYIQR--FDGDAGPE---LHRAADANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +K K+  R LARE GL++ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLSFLRFPLGHLKTKDETRALAREFGLEVADKPDSQDICFVPDGNYAGVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LGRH+G+I+YTIGQRRGLG+  + +PL+VV LD  + +V+VGP+E L
Sbjct: 236 AEPGEIVHADGRVLGRHDGVIHYTIGQRRGLGIGGLSDPLYVVRLDTETRQVVVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F       +   VK+RS++ P    ++  ++    V+    E 
Sbjct: 296 ATRTIPVREINWLGDAPFTSQ--GEWHLSVKVRSTRPPREAVIRPISETEAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  DS+  R+ GGG I
Sbjct: 354 GVSPGQACVFYAPDSS--RIFGGGWI 377


>gi|167644970|ref|YP_001682633.1| tRNA-specific 2-thiouridylase MnmA [Caulobacter sp. K31]
 gi|205811623|sp|B0SWD8|MNMA_CAUSK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|167347400|gb|ABZ70135.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Caulobacter sp. K31]
          Length = 409

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/377 (52%), Positives = 253/377 (67%), Gaps = 9/377 (2%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P   R+V AMSGGVDS+V AALL + GYDV+GVTLQLY+   A  +KG+CCAGQD+ DAR
Sbjct: 35  PVGTRIVAAMSGGVDSTVTAALLAKAGYDVVGVTLQLYDHGAAITKKGACCAGQDILDAR 94

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RF+  VI  FA +Y  GETP+PCV CN+TVKF DLL V R LG
Sbjct: 95  MAAERIGIPHYVLDYESRFKEQVIEEFADAYLRGETPIPCVRCNQTVKFRDLLDVARDLG 154

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY++     G +  + R   R  D  +DQSYFLFATT +QL  LRFPLG M K
Sbjct: 155 AEAMATGHYVQRSFAAGANRPQLR---RAADPAKDQSYFLFATTAEQLDFLRFPLGGMDK 211

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR +A E+GL IADK DSQDICFV +GKY  V+ RI    AL GD+VH++G++LGRH 
Sbjct: 212 PTVRLVAAELGLAIADKPDSQDICFVPEGKYTTVIDRIRPHGALPGDLVHMDGRVLGRHE 271

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLF 316
           G+  YTIGQRRGL +A+G+PLFVV +D +  +VIVGPRE+L    + L+E NWLG +   
Sbjct: 272 GVTRYTIGQRRGLNIAVGDPLFVVKIDADKRQVIVGPREALLTQALSLKEGNWLGVEDSL 331

Query: 317 EDAVVDGFKCFVKIRSSQDPVP----VFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
           E A   G     ++RS+++PVP    +    N     + F+  E GVA GQACV Y    
Sbjct: 332 EAAAAAGAPVLARVRSTREPVPGRLTLVPGPNGGEPRLVFDGLEEGVAPGQACVLYDPAD 391

Query: 373 NEARVLGGGIISGSKRS 389
            E RVLGGG I  ++R+
Sbjct: 392 PE-RVLGGGFIVATERA 407


>gi|302382556|ref|YP_003818379.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193184|gb|ADL00756.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 407

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/371 (53%), Positives = 253/371 (68%), Gaps = 8/371 (2%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P   RVV AMSGGVDS+VVAALL + GYDV+GVTLQLY+   A K+KG+CCAGQD++DAR
Sbjct: 37  PVGSRVVAAMSGGVDSTVVAALLHKAGYDVVGVTLQLYDHGAALKKKGACCAGQDIHDAR 96

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + + + HYV DYE RFR+AVI  FA SY  G+TP+PC+ CN+TVKF DLL V R LG
Sbjct: 97  LAAEMLGIPHYVLDYESRFRDAVIDQFADSYLKGQTPVPCIRCNQTVKFRDLLDVARDLG 156

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A  +ATGHY+     V  DG+ +  M + +D  RDQSYFLFATT+ QL  LRFPL  ++K
Sbjct: 157 AAAMATGHYVGR--AVAADGRAQ--MRKAIDPSRDQSYFLFATTRDQLDYLRFPLAGLEK 212

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
            +VR +A E+GL IA K DSQDICFV  G Y  ++ R+       G+IVH++G++LG H 
Sbjct: 213 PAVRGVAAELGLRIAAKPDSQDICFVPSGDYRTLIDRLRPQGREAGEIVHMDGRVLGHHA 272

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD-GLF 316
           GI +YTIGQRRGL VA+GEPLFV  LD ++ RVIVGPRE+L    + L E NWLGD    
Sbjct: 273 GITDYTIGQRRGLNVAVGEPLFVTRLDPDTRRVIVGPREALLTASLTLDETNWLGDEASI 332

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQAC-VFYTSDSNEA 375
           E A         ++RS++ P P  +   D G+ V FE  E GVA GQAC ++Y SD +  
Sbjct: 333 EAAAAANTPVLARVRSTRPPSPARLTLADSGISVVFETGEEGVAPGQACALYYPSDPD-- 390

Query: 376 RVLGGGIISGS 386
           R+LGGG I+ +
Sbjct: 391 RLLGGGFIAST 401


>gi|262276991|ref|ZP_06054784.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [alpha
           proteobacterium HIMB114]
 gi|262224094|gb|EEY74553.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [alpha
           proteobacterium HIMB114]
          Length = 377

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 263/388 (67%), Gaps = 13/388 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           + +++ T  N L  DK+    +VVVAMSGGVDSSVVAALLK+DGYDVIG+TLQL++  K 
Sbjct: 3   LAITDITEKNILGFDKDKSQTKVVVAMSGGVDSSVVAALLKKDGYDVIGITLQLFDYGKI 62

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
            K KG+CCAG+D+YDA++VCD + + H VF+YE  F+  VI  FA SY  GETP+PCVDC
Sbjct: 63  GKTKGTCCAGKDIYDAKKVCDQLEIKHEVFNYESIFKEEVIEKFADSYIKGETPIPCVDC 122

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N+TVKF DL    + L AD LATGHY++ R++         +M RP DL RDQSYFLF T
Sbjct: 123 NQTVKFRDLFKSAKNLDADALATGHYVK-RIF-----NHSAMMYRPEDLNRDQSYFLFNT 176

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           TQ+QL  LRFPL  + K   RD+AR++ L +A+K DSQDICFV  G Y  +V+++     
Sbjct: 177 TQEQLDYLRFPLASLPKTKTRDIARDLKLQVANKPDSQDICFVPNGNYKTIVEKLRPESF 236

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           +EG+IV   G+ILG+HNGI N+TIGQR+G+ V+  +P FV+ +D   ++V++G RE L V
Sbjct: 237 VEGEIVDTKGKILGKHNGIANFTIGQRKGIKVSSIDPFFVIRIDPKKNQVVIGSREELSV 296

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
             IYL++IN+L D   ++ +   F  FVK+RS+ + +   V  +D+G  V     E GV+
Sbjct: 297 QTIYLKDINYLCD---KEQLNGDF--FVKVRSTGNLLECNV--SDNGHKVTLLSGETGVS 349

Query: 361 SGQACVFYTSDSNEARVLGGGIISGSKR 388
            GQACVFY  D    RV GGG I  +++
Sbjct: 350 PGQACVFYKKDEFGMRVYGGGWIDRTEK 377


>gi|114766932|ref|ZP_01445852.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pelagibaca bermudensis HTCC2601]
 gi|114540839|gb|EAU43901.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius sp. HTCC2601]
          Length = 380

 Score =  382 bits (980), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/382 (52%), Positives = 258/382 (67%), Gaps = 12/382 (3%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
           +A  LNSL L K P + RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A  +K
Sbjct: 4   DAPTLNSLGLPKPPSETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAALAKK 63

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAG D++DARRV + +   HYV DYE  FR+AVI  FA SY  G TP+PC+ CN  V
Sbjct: 64  GACCAGIDIHDARRVAEQMGFPHYVLDYENIFRDAVIDEFAESYLGGATPVPCIRCNERV 123

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL   + L AD +ATGHYI+    VGD G     +    D  RDQSYFLF+TT +Q
Sbjct: 124 KFKDLLETAKDLDADCMATGHYIQR--MVGDQGAE---LHSAADANRDQSYFLFSTTPEQ 178

Query: 185 LCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEG 243
           L  LRFPLG +K K   R+LA + GL +ADK DSQDICFV  G Y  V++++  G A  G
Sbjct: 179 LDYLRFPLGHLKSKAETRELAAKYGLSVADKPDSQDICFVPDGNYASVIEKLRPGAAEPG 238

Query: 244 DIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           +IVH +G++LG H G+I+YTIGQRRGLG+  + EPL+VV LD ++ +VIVGP+E L   +
Sbjct: 239 EIVHADGRVLGEHRGVIHYTIGQRRGLGIGGLTEPLYVVKLDVDNKQVIVGPKEMLATRK 298

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVAS 361
           + +REINWLGD  F     + +   VK+RS++ P    V+  ++    V+   +E GV+ 
Sbjct: 299 VPVREINWLGDAPFTSR--EEWHLSVKVRSTRPPREAIVRPISETEAEVELVVAEEGVSP 356

Query: 362 GQACVFYTSDSNEARVLGGGII 383
           GQACVFY  DS+  R+ GGG I
Sbjct: 357 GQACVFYDPDSS--RIFGGGWI 376


>gi|304321619|ref|YP_003855262.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Parvularcula bermudensis HTCC2503]
 gi|303300521|gb|ADM10120.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Parvularcula bermudensis HTCC2503]
          Length = 409

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 200/385 (51%), Positives = 261/385 (67%), Gaps = 14/385 (3%)

Query: 1   MVVSEATRLNSLDLDKN-PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK 59
           M+ +  T L +  LD   PK  R+VVAMSGGVDSSV AAL+ R GYDV+G+TLQLY+   
Sbjct: 4   MIKTPLTDLTASQLDLGLPKGARIVVAMSGGVDSSVTAALVHRAGYDVVGITLQLYDHGV 63

Query: 60  ASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD 119
           A  +KG+CCAGQD+ DAR V D + + HYV DYE+RF ++V+  FA +Y AG TP+PCV 
Sbjct: 64  AIAKKGACCAGQDIADARAVADRLGIPHYVLDYEDRFGDSVMQDFADTYLAGATPIPCVR 123

Query: 120 CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA 179
           CN+ VKF DLL   R LGA  +ATGHYIR       D  R   + R  D  +DQSYFLFA
Sbjct: 124 CNQRVKFRDLLHTARDLGAAAMATGHYIRR-----TDDDRGLALRRAEDAGKDQSYFLFA 178

Query: 180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           TT++QL  LRFPLGD+ KE+ R +A E+GL +ADK DSQDICFV +G+Y  VV+R+  G 
Sbjct: 179 TTREQLSFLRFPLGDLPKETTRQIAAELGLGVADKPDSQDICFVPEGRYASVVERLRPGA 238

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G IV LNGQ+LG+H GII+YT+GQRRGL +  + EPL+V+ LD + + V+VGP+ +L
Sbjct: 239 ATPGAIVDLNGQVLGQHQGIIHYTVGQRRGLALGGLVEPLYVIRLDADRAEVVVGPKAAL 298

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVG 358
            V  I L E+NWLG    E+A     +  VK+RS++ PV   ++R+     V F++ + G
Sbjct: 299 GVRAIRLDEMNWLGT---EEAAT--HRVAVKVRSTKPPVLAVLKRSGAEAEVMFDEPQEG 353

Query: 359 VASGQACVFYTSDSNEARVLGGGII 383
           VA GQA VFY    ++  VLGGG I
Sbjct: 354 VAPGQAGVFYALKDDQ--VLGGGWI 376


>gi|297181386|gb|ADI17576.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase
           domain-protein [uncultured alpha proteobacterium
           HF0130_06E21]
          Length = 454

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 256/381 (67%), Gaps = 17/381 (4%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSL  D+ P + RVVVAMSGGVDSSV AALL   GYDV+G+TLQLY+   A+ R  +CC
Sbjct: 75  MNSLGFDRPPAETRVVVAMSGGVDSSVTAALLHEQGYDVVGITLQLYDHGAATARFKACC 134

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+YDA RV D I   HYV DYE RFR  VI  FA +Y  GETP+PCV CN+TVKF D
Sbjct: 135 AGQDIYDAYRVADMIGFPHYVLDYESRFREDVIENFADAYVRGETPIPCVTCNQTVKFRD 194

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           L++  R LGAD LATGHYIR     G  G     + R +D  RDQSYFLFATT  QL  L
Sbjct: 195 LVATARDLGADALATGHYIRRE--AGPGGAE---LHRAVDASRDQSYFLFATTHDQLDFL 249

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLGDM K+ VR+ AR +GL IA+K DSQDICFV  GKY  +V+++  G A  GDIVHL
Sbjct: 250 RFPLGDMPKDQVREHARRLGLAIAEKPDSQDICFVPDGKYAQIVEKLRPGAAEPGDIVHL 309

Query: 249 NGQILGRHNGIINYTIGQRRGLGV-----AMGEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           NG +LG H GI+N+TIGQRRG+G+     A  + L+VV LD  + RVIVGPRE+L   R+
Sbjct: 310 NGTVLGEHEGILNFTIGQRRGIGIGGRKDADADALYVVRLDPETRRVIVGPREALATSRV 369

Query: 304 YLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASG 362
            +  +NWLG+G  +    +G +  VKIRS+ +PVP  V     G   V+    E GV+ G
Sbjct: 370 PVNGLNWLGEG--DAPPAEGVEVSVKIRSTMEPVPGRVAGISCGAAMVELAMPEFGVSPG 427

Query: 363 QACVFYTSDSNEARVLGGGII 383
           QA VFY    + ARVLGGG I
Sbjct: 428 QAAVFY----DGARVLGGGWI 444


>gi|254462137|ref|ZP_05075553.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium HTCC2083]
 gi|206678726|gb|EDZ43213.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 381

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 197/386 (51%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +  AT+LNSL   K P D RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDTATKLNSLGFAKAPSDTRVVVAMSGGVDSSVVAAQLASEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGLDIHDARRVAEEMGFPHYVLDYENVFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++     G  +  +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRKM-----GPEKAELHAAADGARDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            Q+QL  LRFPLG +  K++ R+LA + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 KQEQLDFLRFPLGHLPSKDATRELAAKFGLSVADKPDSQDICFVPNGNYAAVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  GDIV   G +LG+H G+I+YTIGQRRGLG+  +  PL+VV LD +   VIVGP+E L
Sbjct: 236 AEAGDIVDTEGNVLGKHEGVIHYTIGQRRGLGIGGLETPLYVVRLDVDLKHVIVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD        + +   V++RS++ P P  ++  +D    V+    E 
Sbjct: 296 STRTIPVREINWLGDAPLSSK--EEWHVLVRVRSTRPPRPAIIRPISDVEATVELLTPED 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY +DS   R+ GGG I
Sbjct: 354 GVSPGQACVFYDTDST--RIFGGGWI 377


>gi|149915230|ref|ZP_01903758.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. AzwK-3b]
 gi|149810951|gb|EDM70790.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. AzwK-3b]
          Length = 379

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/378 (52%), Positives = 255/378 (67%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P D RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGFAKAPADTRVVVAMSGGVDSSVVAAQLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARRV + +   HYV DYE  FR+AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGIDIHDARRVAEDMGFPHYVLDYENIFRDAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ ++  G  G    + C   D  RDQSYFLF+TT +QL  L
Sbjct: 127 LLETARDLDADCMATGHYIQRKM--GAHGP--ELHCA-ADAARDQSYFLFSTTPEQLDFL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K + R+LA   GL +ADK DSQDICFV  G Y  V++++  G A  G+I H
Sbjct: 182 RFPLGHLPSKHATRELAARYGLKVADKPDSQDICFVPDGNYAAVIEKLRPGAAEPGEIAH 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           ++G+ILG H G+I+YTIGQRRGLG+  + EPL+VV LD ++ RVIVGP+E L    + +R
Sbjct: 242 VDGRILGTHEGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDAQRVIVGPKELLATRLVPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F+      +   VK+RS++ P    ++   D G  V+    E GV+ GQAC
Sbjct: 302 EINWLGDAPFDSR--PEWHLSVKLRSTRPPQEAILRPLPDGGAEVELLSPEEGVSPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  ++ ++R+LGGG I
Sbjct: 360 VFY--ETGDSRILGGGWI 375


>gi|260426477|ref|ZP_05780456.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Citreicella sp. SE45]
 gi|260420969|gb|EEX14220.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Citreicella sp. SE45]
          Length = 380

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/382 (51%), Positives = 256/382 (67%), Gaps = 12/382 (3%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
           +A +LNSL L K P + RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A  +K
Sbjct: 4   DAPKLNSLGLPKPPSETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAALAKK 63

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAG D++DARRV + +   HYV DYE  FR+AVI  FA SY  G TP+PC+ CN  V
Sbjct: 64  GACCAGIDIHDARRVAEQMGFPHYVLDYENIFRDAVIDEFAESYLGGATPVPCIRCNERV 123

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL   + L AD +ATGHYI+    VGD G     +    D  RDQSYFLF+TT +Q
Sbjct: 124 KFKDLLETAKDLDADCMATGHYIQR--MVGDRGPE---LHSAADANRDQSYFLFSTTPEQ 178

Query: 185 LCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEG 243
           L  LRFPLG +K K   R LA + GL +ADK DSQDICFV  G Y  V++++  G A  G
Sbjct: 179 LSFLRFPLGHLKSKAETRALAAKYGLSVADKPDSQDICFVPDGNYASVIEKLRPGAAEPG 238

Query: 244 DIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           +IVH++G++LG H G+I+YTIGQRRGLG+  + +PL+VV LD +  +VIVGP+E L    
Sbjct: 239 EIVHVDGRVLGEHRGVIHYTIGQRRGLGIGGLSDPLYVVKLDVDKKQVIVGPKELLATRT 298

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVAS 361
           + +REINWLGD  F       +   VK+RS++ P    ++  ++    V+   +E GV+ 
Sbjct: 299 VPVREINWLGDEPFTSR--KEWHVSVKVRSTRPPREAVIRPISETEAEVELVVAEEGVSP 356

Query: 362 GQACVFYTSDSNEARVLGGGII 383
           GQACVFY  D+  +R+ GGG I
Sbjct: 357 GQACVFY--DTESSRIFGGGWI 376


>gi|86138410|ref|ZP_01056984.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. MED193]
 gi|85824935|gb|EAQ45136.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. MED193]
          Length = 381

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 200/386 (51%), Positives = 256/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +   T LNSL   K P + RVVVAMSGGVDSSVVAA L   GYDVIGVTLQLY+   A
Sbjct: 1   MALDTDTPLNSLGFAKPPAETRVVVAMSGGVDSSVVAAYLADQGYDVIGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ ++  GD+G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLEADCMATGHYIQRKM--GDNGAE---LHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKDATREMAAQYGLAVADKPDSQDICFVPDGNYTSVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG H G+I+YTIGQRRGLG+  + EPL+VV LD +  +VIVGP+E L
Sbjct: 236 AEPGEIVHADGRVLGTHTGVIHYTIGQRRGLGIGGLTEPLYVVRLDVDKKQVIVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F+      +   VK+RS++ P    ++  +     V+    E 
Sbjct: 296 ATRTIPVREINWLGDAPFDSR--QEWNVMVKVRSTRPPREAIIRPLSATTAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY SDS+  R+ GGG I
Sbjct: 354 GVSPGQACVFYDSDSS--RIFGGGWI 377


>gi|85702766|ref|ZP_01033870.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius sp. 217]
 gi|85671694|gb|EAQ26551.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius sp. 217]
          Length = 383

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 201/386 (52%), Positives = 256/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +     LNSL   K P + RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDTNKPLNSLGFPKPPAETRVVVAMSGGVDSSVVAAHLASEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  FR+AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGVDIHDARRVAEEMGFPHYVLDYENIFRDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ +L  G  G    + C   D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLEADCMATGHYIQRKL--GSQGP--ELHCA-SDSARDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K + R+LA + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKAATRELAAQYGLQVADKPDSQDICFVPNGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG+H G+I+YTIGQRRGLG+  + EPL+VV LD ++ RVIVGP+E L
Sbjct: 236 AEPGEIVHADGRVLGQHEGVIHYTIGQRRGLGIGGLEEPLYVVRLDVDARRVIVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + LREINWLGD          ++  VK+RS++ P    ++  +     V+    E 
Sbjct: 296 STRTVPLREINWLGDVPMTSQTE--WQVSVKVRSTRPPREAVLRPISATEATVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY +D +  RVLGGG I
Sbjct: 354 GVSPGQACVFYETDGS--RVLGGGWI 377


>gi|99081242|ref|YP_613396.1| tRNA-specific 2-thiouridylase MnmA [Ruegeria sp. TM1040]
 gi|123077645|sp|Q1GGT2|MNMA_SILST RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|99037522|gb|ABF64134.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruegeria sp. TM1040]
          Length = 381

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 195/386 (50%), Positives = 257/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +     +NSL   K+P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MALDNEAPVNSLGFAKSPAETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++  G+ G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLEADCMATGHYIQRKM--GEHGPE---LHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDFLRFPLGHLPSKDATREMAAQYGLSVADKPDSQDICFVPNGDYASVIQKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G IVH +G++LG HNG+I+YTIGQRRGLG+  + EPL+VV LD +  +VIVGP+E L
Sbjct: 236 AEPGQIVHADGRVLGEHNGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDQKQVIVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
              R+ +REINWLGD  F     D +   VK+RS++ P    ++  ++    V+   +E 
Sbjct: 296 ATRRVPVREINWLGDAPFTSR--DEWHLSVKVRSTRPPRDAIIRPISETEAEVELFSAEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  D N +R+ GGG I
Sbjct: 354 GISPGQACVFY--DPNGSRIYGGGWI 377


>gi|84516171|ref|ZP_01003531.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Loktanella vestfoldensis SKA53]
 gi|84509867|gb|EAQ06324.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Loktanella vestfoldensis SKA53]
          Length = 379

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/378 (51%), Positives = 254/378 (67%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSL   K P D RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   INSLGFAKAPADTRVVVAMSGGVDSSVVAAKLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AV+  FA SY  G TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEEMGFPHYVLDYENTFREAVMDEFADSYLGGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ ++     G +   +    D  +DQSYFLF+TTQ QL  L
Sbjct: 127 LLQTARDLDADCMATGHYIQRKM-----GVQGAELHSAADAAKDQSYFLFSTTQDQLDYL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG  K K+  R LA + GL +ADK DSQDICFV  G Y  V++++  G A  G IV 
Sbjct: 182 RFPLGHHKSKDETRALAAKYGLSVADKPDSQDICFVPNGDYAAVIEKLRPGAASPGTIVD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           +NGQ+LG+HNG+I+YT+GQRRGLG+  + +PL+VV LD +  +VIVGP++ L   R+ LR
Sbjct: 242 INGQVLGQHNGVIHYTVGQRRGLGIGGLADPLYVVRLDVDKKQVIVGPKDMLATRRVPLR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINW+G G   D  +   +  V++RS++ P    ++  +D    V+   +E GV+ GQAC
Sbjct: 302 EINWIGGGKLTD--IAERQIAVRVRSTRPPTDAILRPISDTEAEVELLVAEQGVSPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY +DS   RVLGGG I
Sbjct: 360 VFYDTDST--RVLGGGWI 375


>gi|167042070|gb|ABZ06805.1| putative tRNA methyl transferase [uncultured marine microorganism
           HF4000_141I21]
          Length = 382

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/379 (48%), Positives = 255/379 (67%), Gaps = 10/379 (2%)

Query: 5   EATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
           ++ + NSL   K PKD +VVVAMSGGVDSS VA L+K+DGYDVIG+TL+LY+  K+SK  
Sbjct: 4   KSEKFNSLGFLKRPKDTKVVVAMSGGVDSSTVAGLMKKDGYDVIGITLKLYDDAKSSKES 63

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
             CCAGQD+ DA+RV   +N+ H +  Y+++F+  VI  F  SY AGETP+PCV CN+TV
Sbjct: 64  RQCCAGQDILDAKRVSQQLNIDHKILYYQKKFKKDVIDSFIDSYVAGETPIPCVQCNQTV 123

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DL S   ++ AD L TGHY+     +  +G     M R +DL RDQSYFLF+TTQ+Q
Sbjct: 124 KFRDLYSYALEMKADALITGHYVNR---IKKNGNAE--MYRAIDLTRDQSYFLFSTTQEQ 178

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLG M+K+  R +A ++ L++ADK DSQDICFV  G Y  ++K+       +G+
Sbjct: 179 LNFLRFPLGQMQKKETRKIASKLKLNVADKPDSQDICFVPNGNYASIIKKYRPESFQKGN 238

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           I+ + G I+G+H+GIIN+TIGQR+G+G+A  EPL+V+ ++  ++ VIVG R +L + +IY
Sbjct: 239 ILDIVGNIVGKHDGIINFTIGQRKGIGIAYKEPLYVININAKTNEVIVGNRVALAIKKIY 298

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           L+ +N     L  DA       F+K+RS+   V   V  ND G  V+ E+ E G++ GQA
Sbjct: 299 LKNLN-----LLSDAEEYNNNLFIKVRSTGRLVKAKVNLNDTGAEVNLEELETGISPGQA 353

Query: 365 CVFYTSDSNEARVLGGGII 383
           CVFY+ +    +VLGGG I
Sbjct: 354 CVFYSKNQFGDKVLGGGWI 372


>gi|254510076|ref|ZP_05122143.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacteraceae bacterium KLH11]
 gi|221533787|gb|EEE36775.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacteraceae bacterium KLH11]
          Length = 381

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 256/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +   T LNSL   K P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MALDAKTPLNSLGFAKPPSETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ ++  G +G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLEADCMATGHYIQRKM--GPNGSE---LHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDFLRFPLGHLPSKDATREMAAQYGLAVADKPDSQDICFVPNGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++L +HNG+I+YTIGQRRGLG+  + EPL+VV LD +  +V+VGP+E L
Sbjct: 236 AEPGEIVHADGRVLAQHNGVIHYTIGQRRGLGIGGLTEPLYVVKLDVDKKQVVVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + +REINWLGD  F     D +   VK+RS++ P    ++  +D    V+    E 
Sbjct: 296 ATRTVPVREINWLGDAPFSSQ--DEWHVSVKVRSTRPPREAIIRPLSDTTAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  ++  +R+ GGG I
Sbjct: 354 GISPGQACVFY--ETGGSRIFGGGWI 377


>gi|255263925|ref|ZP_05343267.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thalassiobium sp. R2A62]
 gi|255106260|gb|EET48934.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thalassiobium sp. R2A62]
          Length = 378

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 199/378 (52%), Positives = 251/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P D RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  ++G+CC
Sbjct: 7   LNSLGFAKAPADTRVVVAMSGGVDSSVVAAQLAEEGYDVVGVTLQLYDHGAALAKQGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARRV   +   HYV DYE  F+ AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGLDIHDARRVAQEMGFPHYVLDYENTFKEAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++  GD G    + C   D  RDQSYFLF+TT  QL  L
Sbjct: 127 LLETAKDLDADCMATGHYIQRKM--GDHGA--ELHCA-TDANRDQSYFLFSTTLDQLDYL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++  G A  GDIV 
Sbjct: 182 RFPLGHLPSKNETRALAEKYGLSVADKPDSQDICFVPNGNYAAVIEKLRPGAAEPGDIVD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           +NG +LG HNG+I+YT+GQRRGLG+  + +PL+VV LD ++ +VIVGP++ L    I +R
Sbjct: 242 INGTVLGTHNGVIHYTVGQRRGLGIGGLADPLYVVKLDVDAKQVIVGPKDMLSTRTIPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F+ +V       VK+RS++ P    V+  +     V+    E GV+ GQAC
Sbjct: 302 EINWLGDDAFDASVERNI--MVKVRSTRPPREAIVRPISATEATVELLTPEEGVSPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY+ DS   R+LGGG I
Sbjct: 360 VFYSPDS--PRILGGGWI 375


>gi|84500833|ref|ZP_00999068.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicola batsensis HTCC2597]
 gi|84390900|gb|EAQ03318.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicola batsensis HTCC2597]
          Length = 382

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/386 (50%), Positives = 255/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +   + LNSL   K P + RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDRTSDLNSLGFAKPPAETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  FR+AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGLDIHDARRVAEEMGFPHYVLDYENIFRDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ ++     G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLDADCMATGHYIQRKM-----GAAGAELHSAADAARDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLSFLRFPLGHLASKAETRALAAKYGLPVADKPDSQDICFVPNGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV  +G++LG H G+I+YTIGQRRGLG+  + +PL+VV LD ++ RV+VGP+E L
Sbjct: 236 AEPGEIVDTSGRVLGHHEGVIHYTIGQRRGLGIGGLSDPLYVVRLDVDARRVVVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
              ++ +REINWLG+G F D      +  VK+RS++ P    ++  +D    V+    E 
Sbjct: 296 ATRQVPVREINWLGEGAFTDQPER--EISVKVRSTRPPREAILRPVSDTEAVVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  ++   R+LGGG I
Sbjct: 354 GVSPGQACVFY--ETGGTRILGGGWI 377


>gi|163794310|ref|ZP_02188282.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [alpha
           proteobacterium BAL199]
 gi|159180478|gb|EDP64999.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [alpha
           proteobacterium BAL199]
          Length = 394

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 211/392 (53%), Positives = 263/392 (67%), Gaps = 23/392 (5%)

Query: 7   TRLNSLDLD-KNPKDMR-VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
           T +  LDL    P+  R VVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+   A  RK
Sbjct: 3   TTVPDLDLGLPGPRSARRVVVAMSGGVDSSVTAALLKEAGYDVVGITLQLYDHGAAVARK 62

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
           G+CCAG D++DAR V + + + HYV DYE RFR +VI  FA SY  GETP+PCV CN+TV
Sbjct: 63  GACCAGSDIHDARTVAERLGIPHYVLDYESRFRESVIDDFADSYLRGETPIPCVRCNQTV 122

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF DLL+  R LGA+ LATGHY+R  L  G DG     + R +D  +DQSYFLFATT +Q
Sbjct: 123 KFRDLLTTARDLGAEALATGHYVRRVL--GPDGPE---LHRAVDPGKDQSYFLFATTPEQ 177

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  LRFPLG M KE+ RD AR +GL + DK DSQDICFV  G Y +VVK++  G A  GD
Sbjct: 178 LAFLRFPLGSMSKEATRDEARRLGLVVQDKPDSQDICFVPNGNYAEVVKKLRPGAADPGD 237

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGL---------GVAMGEPLFVVYLDKNSSRVIVGPR 295
           IVHL+G +LG+H+G+I+YT+GQRRG+         G A  +PL+VV LD ++ RVIVGPR
Sbjct: 238 IVHLDGTVLGQHDGVIHYTVGQRRGIGVGGRRGAEGEAATDPLYVVRLDPDARRVIVGPR 297

Query: 296 ESLEVHRIYLREINWLG-DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFE 353
           E+L    +   E+NWLG DG   ++   G +  VK+RS Q PV   V  +   G  V  +
Sbjct: 298 EALAAETVLAGEVNWLGADGGVPES---GARAQVKLRSVQAPVTATVYGDAAGGARVVLD 354

Query: 354 KSEVGVASGQACVFYTSDSNEARVLGGGIISG 385
           + + GV++GQA VFY  D   ARVLGGG I G
Sbjct: 355 QPQYGVSAGQAAVFYGEDG--ARVLGGGWIRG 384


>gi|259416977|ref|ZP_05740897.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Silicibacter sp. TrichCH4B]
 gi|259348416|gb|EEW60193.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Silicibacter sp. TrichCH4B]
          Length = 381

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 256/386 (66%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +     +NSL   K+P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MALDNEAPVNSLGFAKSPAETRVVVAMSGGVDSSVVAAYLAEQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++  G+ G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLEADCMATGHYIQRKM--GEHGPE---LHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDFLRFPLGHLPSKDATREMAAQYGLSVADKPDSQDICFVPNGDYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G IVH +G++LG HNG+I+YTIGQRRGLG+  + EPL+VV LD +  +VIVGP++ L
Sbjct: 236 AEPGQIVHADGRVLGEHNGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDKKKVIVGPKDML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
              R+ +REINWLGD  F       +   VK+RS++ P    ++  +D    V+   +E 
Sbjct: 296 ATRRVPVREINWLGDEPFTSRTE--WHLSVKVRSTRPPRDAIIRPISDTEAEVELFSAEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  D N +R+ GGG I
Sbjct: 354 GISPGQACVFY--DPNGSRIFGGGWI 377


>gi|260576792|ref|ZP_05844777.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter sp. SW2]
 gi|259021044|gb|EEW24355.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter sp. SW2]
          Length = 379

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/378 (51%), Positives = 252/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L K P++ RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGLAKPPQETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AVI  FA +Y AG TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEAMGFPHYVLDYENTFRAAVIDEFADAYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R+L AD +ATGHYI+ +L     G     +    D  RDQSYFLF+TT +QL  L
Sbjct: 127 LLATARELDADCMATGHYIQRKL-----GLHGPELHSATDPARDQSYFLFSTTAEQLDYL 181

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA   GL +ADK DSQDICFV  G Y  V++++  G A  G IV 
Sbjct: 182 RFPLGHLASKAETRALAARYGLAVADKPDSQDICFVPNGDYAAVIEKLRPGAAEPGLIVG 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           L+G  LG H G+I+YTIGQRRGLG+  + +PL+V+ LD  + +V+VGP+ +L   R+ LR
Sbjct: 242 LDGTPLGEHRGVIHYTIGQRRGLGIGGVADPLYVLRLDPETRQVVVGPKAALSTRRVPLR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F+      +   VK+RS++ P P  V+  +     V+    E G+++GQAC
Sbjct: 302 EINWLGDAAFDSQ--PEWLLNVKVRSTRPPRPALVRPLSATEAEVELLAPEDGISAGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  + +  RVLGGG I
Sbjct: 360 VFYAPEGS--RVLGGGWI 375


>gi|149203838|ref|ZP_01880807.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius sp. TM1035]
 gi|149142955|gb|EDM30997.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius sp. TM1035]
          Length = 383

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 196/378 (51%), Positives = 252/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K+P + RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 9   LNSLGFPKSPAETRVVVAMSGGVDSSVVAAHLAAEGYDVVGVTLQLYDHGAALAKKGACC 68

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARRV + +   HYV DYE  FR+AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 69  AGVDIHDARRVAEEMGFPHYVLDYENIFRDAVIDEFADSYLAGATPVPCIRCNERVKFKD 128

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ ++     G +   +    D  RDQSYFLF+TT +QL  L
Sbjct: 129 LLETARDLEADCMATGHYIQRKM-----GVQGPELHSATDSARDQSYFLFSTTPEQLEFL 183

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K++ R+LA + GL +ADK DSQDICFV  G Y  V++++  G A  G+IVH
Sbjct: 184 RFPLGHLPSKQATRELAAQYGLQVADKPDSQDICFVPNGNYASVIEKLRPGAAEPGEIVH 243

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            +G+ILG H G+I+YTIGQRRGLG+  + EPL+VV LD ++ RVIVGP++ L    + LR
Sbjct: 244 ADGRILGTHEGVIHYTIGQRRGLGIGGLEEPLYVVRLDVDTRRVIVGPKDMLSTRTVPLR 303

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD          +   VK+RS++ P    ++  +     V+    E GV+ GQAC
Sbjct: 304 EINWLGDAPLTSQA--EWHISVKVRSTRPPREAVLRPISATEATVELLTPEEGVSPGQAC 361

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  ++   RVLGGG I
Sbjct: 362 VFY--ETTGTRVLGGGWI 377


>gi|126729666|ref|ZP_01745479.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sagittula stellata E-37]
 gi|126709785|gb|EBA08838.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sagittula stellata E-37]
          Length = 379

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 254/378 (67%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L K P + RVVVAMSGGVDSSVVAA+LK +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGLPKPPSETRVVVAMSGGVDSSVVAAMLKEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARRV + +   HYV DYE  F+ AVI  FA SY  G TP+PC+ CN  VKF D
Sbjct: 67  AGIDIHDARRVAEDMGFPHYVLDYENIFQEAVIEEFADSYLGGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ +      G R   +    D  RDQSYFLF+TT +QL  L
Sbjct: 127 LLETAKDLEADCMATGHYIQRKT-----GARGPELHSAADAARDQSYFLFSTTPEQLDFL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K + R+LA   GL +ADK DSQDICFV  G Y  V++++  G A  G+IVH
Sbjct: 182 RFPLGHLPSKAATRELAARYGLAVADKPDSQDICFVPDGNYAKVIEKLRPGAAEPGEIVH 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           ++G++LG+H G+I+YTIGQRRGLG+  + EPL+VV LD  + +V+VGP++ L    I +R
Sbjct: 242 IDGRVLGQHRGVIHYTIGQRRGLGIGGLSEPLYVVRLDVETRQVVVGPKDLLATRTIPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F       ++  VK+RS++ P    ++  ++    V+   +E GV+ GQAC
Sbjct: 302 EINWLGDAPFTSQAE--WQLDVKVRSTRPPREAIIRPLSETTGEVELVVAEEGVSPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  D++  R+ GGG I
Sbjct: 360 VFYAPDNS--RIFGGGWI 375


>gi|114768812|ref|ZP_01446438.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [alpha
           proteobacterium HTCC2255]
 gi|114549729|gb|EAU52610.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [alpha
           proteobacterium HTCC2255]
          Length = 382

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/388 (48%), Positives = 260/388 (67%), Gaps = 11/388 (2%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           +++     LNS+   K+PKD RV+VAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 4   IMIQNTKALNSMGFAKDPKDTRVLVAMSGGVDSSVVAAMLSEEGYDVVGVTLQLYDHGAA 63

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG+D+ DARRV + +   HYV DYE +F+ +VI  FA +Y AG TP+PC+ C
Sbjct: 64  LAKKGACCAGRDIQDARRVAEEMGFPHYVLDYENKFKESVIDEFADAYLAGATPVPCIRC 123

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+  +   ++GK    + +  D +RDQSYFLF+T
Sbjct: 124 NERVKFRDLLETAKDLDADCMATGHYIQRFV---ENGKAE--LHKAADQDRDQSYFLFST 178

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            Q+QL  LRFPLG +K K+  R+LA + GL +ADK DSQDICFV  G Y  V++++    
Sbjct: 179 KQEQLDYLRFPLGHLKSKKDTRELAHKYGLPVADKPDSQDICFVPNGSYAAVIEKLRPEA 238

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLE 299
           A  G IV  +G +LG H GIINYT+GQRRGLG+  G+PL+V+ LD +S  VIVGP+E+L 
Sbjct: 239 ANPGQIVSQDGAVLGEHKGIINYTVGQRRGLGIGGGDPLYVIKLDADSREVIVGPKEALA 298

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVG 358
              + ++EINWLG+  F D+        V++RS++ P    ++  ++    V+   +E G
Sbjct: 299 TRTVLIKEINWLGEDNFLDSKERTLA--VRVRSTRSPKEAIIKPISETTATVELVMAEEG 356

Query: 359 VASGQACVFYTSDSNEARVLGGGIISGS 386
           +A GQACVFY  D    R+ GGG I+ +
Sbjct: 357 IAPGQACVFY--DIEGTRIYGGGWITNN 382


>gi|83951896|ref|ZP_00960628.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius nubinhibens ISM]
 gi|83836902|gb|EAP76199.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseovarius nubinhibens ISM]
          Length = 380

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 256/378 (67%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL L K P + RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGLPKPPSETRVVVAMSGGVDSSVVAAQLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARRV + +   HYV DYE  F++AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGIDIHDARRVAEEMGFPHYVLDYENIFQDAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ +   G +G    + C   D  RDQSYFLF+TT +QL  L
Sbjct: 127 LLQTARDLDADCMATGHYIQRKQ--GQNGP--ELHCA-TDANRDQSYFLFSTTPEQLEFL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K++ R+LA + GL +ADK DSQDICFV  G Y  V++++  G A  G+IVH
Sbjct: 182 RFPLGHLPSKDATRELAAKYGLSVADKPDSQDICFVPNGNYAAVIEKLRPGAAEPGEIVH 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            +G++LG HNG+I+YTIGQRRGLG+  + +PL+VV LD +   V+VGP+E L    + +R
Sbjct: 242 ADGRVLGTHNGVIHYTIGQRRGLGIGGLSDPLYVVKLDVDKKHVVVGPKEMLSTRNVPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F+      ++  VK+RS++ P    ++  +     V+    E G++ GQAC
Sbjct: 302 EINWLGDEPFDSRAE--WQVSVKVRSTRPPREAVIRPLSPTTAEVELLSPEDGISPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY ++   +R+LGGG I
Sbjct: 360 VFYETEG--SRILGGGWI 375


>gi|110679829|ref|YP_682836.1| tRNA-specific 2-thiouridylase MnmA [Roseobacter denitrificans OCh
           114]
 gi|123065538|sp|Q166E3|MNMA_ROSDO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|109455945|gb|ABG32150.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter denitrificans OCh 114]
          Length = 380

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 251/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +  +  LNSL   K P + RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MPLDPSPTLNSLGFAKPPAETRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  F++AVI  FA SY  G TP+PC+ C
Sbjct: 61  LAKKGACCAGLDIHDARRVSEKMGFPHYVLDYENIFKDAVIDEFAESYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ +      G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRK-----SGPYGAELHSAADANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  KE  R LA + GL +A+K DSQDICFV  G Y  V++++    
Sbjct: 176 TPEQLAFLRFPLGHLPSKEDTRALAEKYGLSVANKPDSQDICFVPDGDYASVIRKLRPEA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  GDIV  +G++L RH+G++NYTIGQRRGLG+  +  PL+V+ LD  + +V+VGP+  L
Sbjct: 236 AAPGDIVDTDGRVLARHDGVVNYTIGQRRGLGIGGLATPLYVIKLDAEARQVVVGPKSML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + +REINWLGD  F+    D +   VK+RS++ P    ++  +D    V+    E 
Sbjct: 296 STRTVPVREINWLGDEPFQSR--DAWHLAVKVRSTRPPTDAIIRPISDTEATVELTSPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY +DS+  R+ GGG I
Sbjct: 354 GISPGQACVFYDTDSS--RIYGGGWI 377


>gi|254451424|ref|ZP_05064861.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Octadecabacter antarcticus 238]
 gi|198265830|gb|EDY90100.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Octadecabacter antarcticus 238]
          Length = 379

 Score =  371 bits (953), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 198/378 (52%), Positives = 252/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGFAKPPSQTRVVVAMSGGVDSSVVAAQLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEDMGFPHYVLDYENTFREAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++     G R   +    D  RDQSYFLF+T  +QL  L
Sbjct: 127 LLETAKDLDADCMATGHYIQRKM-----GARGAELHCAEDANRDQSYFLFSTKPEQLDYL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K++ R+LAR+ GL +ADK DSQDICFV  G Y  V++++  G A  GDIV 
Sbjct: 182 RFPLGHLPSKDATRELARKYGLALADKPDSQDICFVPNGNYAAVIEKLRPGAAEPGDIVD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            +G +L +H G+I+YTIGQRRGLG+  + +PL+VV LD +   VIVGP+E L    + +R
Sbjct: 242 TDGSVLAQHRGVIHYTIGQRRGLGIGGLADPLYVVKLDVDKKHVIVGPKEMLTTRTVPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F DAV +     VKIRS++ P+   V+  +     ++    E GVA GQAC
Sbjct: 302 EINWLGDDAF-DAVAE-RHISVKIRSTKPPMEAIVRPLSATTAEIELLTPEEGVAPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY +DS+  R+ GGG I
Sbjct: 360 VFYDNDSS--RIFGGGWI 375


>gi|159044055|ref|YP_001532849.1| tRNA-specific 2-thiouridylase MnmA [Dinoroseobacter shibae DFL 12]
 gi|205816871|sp|A8LK49|MNMA_DINSH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157911815|gb|ABV93248.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dinoroseobacter shibae DFL 12]
          Length = 384

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 246/378 (65%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P + RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 12  LNSLGFAKPPSETRVVVAMSGGVDSSVVAAELACEGYDVVGVTLQLYDHGAALAKKGACC 71

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AVI  FA SY  G TP+PC+ CN  VKF D
Sbjct: 72  AGRDIHDARRVAEEMGFPHYVLDYENTFREAVIDEFADSYLGGATPVPCIRCNERVKFKD 131

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ ++     G  +  +    D  RDQSYFLF+TTQ+QL  L
Sbjct: 132 LLETARDLEADCMATGHYIQRKM-----GPAKAELHSAADANRDQSYFLFSTTQEQLDYL 186

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++  G    G+IV 
Sbjct: 187 RFPLGHLASKAETRALAAKHGLSVADKPDSQDICFVPNGDYASVIEKLRPGAGEPGEIVD 246

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           ++G +LG H G+I+YTIGQRRGLG+  +  PL+VV LD ++ RVIVGP+E+L    + LR
Sbjct: 247 MDGTVLGAHRGVIHYTIGQRRGLGIGGLETPLYVVKLDPDARRVIVGPKEALSTRHVPLR 306

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD          +   VK+RS++ P    ++  +D    V+    E GV+ GQAC
Sbjct: 307 EINWLGDAPLSSRAE--WPIAVKVRSTRPPRDAILRPISDTEATVELLTPEEGVSPGQAC 364

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  D +  R+ GGG I
Sbjct: 365 VFY--DPDGTRIFGGGWI 380


>gi|254465357|ref|ZP_05078768.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium Y4I]
 gi|206686265|gb|EDZ46747.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium Y4I]
          Length = 381

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +   T +NSL   K P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MALDHNTTVNSLGFAKPPSETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++  G +G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLEADCMATGHYIQRKM--GPNGPE---LHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKDATREMAAQYGLAVADKPDSQDICFVPDGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG H G+I+YTIGQRRGLG+  + EPL+VV LD +  +V+VGP+E L
Sbjct: 236 AEPGEIVHSDGRVLGSHEGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDKKQVVVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F     D +   VK+RS++ P    ++   D    V+    E 
Sbjct: 296 ATRTIPVREINWLGDEPFTSR--DEWHLKVKVRSTRPPREAIIRPLTDTTAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY S+ +  R+ GGG I
Sbjct: 354 GISPGQACVFYASEGS--RIFGGGWI 377


>gi|254475742|ref|ZP_05089128.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruegeria sp. R11]
 gi|214029985|gb|EEB70820.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruegeria sp. R11]
          Length = 381

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M       LNSL   K P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MAQESNPPLNSLGFAKPPSETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ ++     G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLEADCMATGHYIQRKM-----GAHGPELHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKDATREMAAQYGLAVADKPDSQDICFVPNGDYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG+HNG+I+YTIGQRRGLG+  + EPL+VV LD ++ +V+VGP+E L
Sbjct: 236 AEPGEIVHADGRVLGQHNGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDNKQVVVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F        K  VK+RS++ P    ++  ++    V+    E 
Sbjct: 296 ATRTIPVREINWLGDAPFTSQPEWHLK--VKVRSTRPPREAIIRPISETEAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  + +  R+ GGG I
Sbjct: 354 GVSPGQACVFYAGEGS--RIYGGGWI 377


>gi|89069527|ref|ZP_01156871.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicola granulosus HTCC2516]
 gi|89044862|gb|EAR50952.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanicola granulosus HTCC2516]
          Length = 379

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/378 (51%), Positives = 248/378 (65%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L R+GYDV+GVTLQLY+   A  RKG+CC
Sbjct: 7   LNSLGFAKPPAQTRVVVAMSGGVDSSVVAAELAREGYDVVGVTLQLYDHGAALARKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  F++AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEEMGFPHYVLDYENVFKDAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ ++     G     +    D  RDQSYFLF+TT +QL  L
Sbjct: 127 LLETARDLDADCMATGHYIQRKM-----GAHGPELHSAADAARDQSYFLFSTTPEQLAYL 181

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA   GL +ADK DSQDICFV  G Y  V++++  G A  GDIV 
Sbjct: 182 RFPLGHLASKAETRALAGRHGLPVADKPDSQDICFVPNGNYASVIEKLRPGAAEPGDIVD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
             G++LG H G+I+YTIGQRRGLG+  + +PL+VV LD ++ RV+VGP+E L    + +R
Sbjct: 242 TEGRVLGTHRGLIHYTIGQRRGLGIGGLADPLYVVKLDVDTRRVVVGPKELLATRTVPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGDG F +      +  VK+RS++ P    ++  +     V+    E GV+ GQAC
Sbjct: 302 EINWLGDGGFLEG--GPREISVKVRSTRPPTEALLRPISATEAEVELLTPEEGVSPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  ++   RVLGGG I
Sbjct: 360 VFY--ETGGTRVLGGGWI 375


>gi|56696559|ref|YP_166916.1| tRNA-specific 2-thiouridylase MnmA [Ruegeria pomeroyi DSS-3]
 gi|81349989|sp|Q5LST9|MNMA_SILPO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|56678296|gb|AAV94962.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruegeria pomeroyi DSS-3]
          Length = 375

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 196/378 (51%), Positives = 252/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 3   LNSLGFAKPPSETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAALAKKGACC 62

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 63  AGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRCNERVKFKD 122

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   R L AD +ATGHYI+ ++  G +G    + C   D  RDQSYFLF+TT +QL  L
Sbjct: 123 LLETARDLEADCMATGHYIQRKM--GPNGP--ELHCA-EDANRDQSYFLFSTTPEQLDYL 177

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G A  G+IVH
Sbjct: 178 RFPLGHLPSKDATREMAAQYGLAVADKPDSQDICFVPNGNYASVIEKLRPGAAEPGEIVH 237

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            +G++LG H G+I+YTIGQRRGLG+  + EPL+VV LD +  +V+VGP+E L    I +R
Sbjct: 238 ADGRVLGSHEGVIHYTIGQRRGLGIGGLSEPLYVVRLDVDRKQVVVGPKELLATRTIPVR 297

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F       +   VK+RS++ P    V+  ++    V+    E GV+ GQAC
Sbjct: 298 EINWLGDAPFTSR--PEWHLSVKVRSTRPPREAIVRPISETEAEVELLTPEEGVSPGQAC 355

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY SD +  R+ GGG I
Sbjct: 356 VFYESDGS--RIFGGGWI 371


>gi|209964264|ref|YP_002297179.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodospirillum centenum SW]
 gi|259495835|sp|B6ISD0|MNMA_RHOCS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|209957730|gb|ACI98366.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodospirillum centenum SW]
          Length = 392

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/399 (50%), Positives = 253/399 (63%), Gaps = 23/399 (5%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSL  DK P+D RVVVAMSGGVDSSV AALLK  GYDV+G+TLQLY+      RKG+CC
Sbjct: 1   MNSLGFDKAPQDTRVVVAMSGGVDSSVTAALLKEQGYDVVGITLQLYDHGLTVGRKGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+YDAR+V D I++ HYV DYE RF  +VI  FA SY  GETP+PCV CN+ VKF D
Sbjct: 61  AGQDIYDARQVADRIDIPHYVLDYESRFGQSVIDDFADSYLRGETPIPCVRCNQRVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R LGAD LATGHY  +R   G  G     + R  D  RDQSYFLFATT  QL  L
Sbjct: 121 LLAQARDLGADCLATGHY--ARRVAGPTGP---ALHRGADPARDQSYFLFATTPAQLDYL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFP+G + K   R LA  +GL +ADK DSQDICFV  G Y  VV+++  G    G+IVHL
Sbjct: 176 RFPIGHLPKSETRALAERLGLAVADKPDSQDICFVPAGNYAQVVEKLRPGAVEPGEIVHL 235

Query: 249 NGQILGRHNGIINYTI-----GQRRGLGVAMGE---PLFVVYLDKNSSRVIVGPRESLEV 300
           +G++LGRH+G+I YT+         G     GE   PL+VV ++  + RV+VGPR +L  
Sbjct: 236 DGRVLGRHDGVIRYTVGQRRGLGIGGRRTPEGEELDPLYVVRVEPETRRVVVGPRTALAR 295

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGV 359
            R+ +RE+NWLG     D  V      VK+RS+Q  +P  V    D G  V   + + GV
Sbjct: 296 DRVLVREVNWLGGTDTADVPVT-----VKLRSAQPALPARVSLTADGGAVVTLTQPQYGV 350

Query: 360 ASGQACVFYTSDSNEARVLGGGIISGSKRSDAVEESLLS 398
           A GQA VFY  D    RVLGGG I  ++ S A+ ++ + 
Sbjct: 351 APGQAAVFYQGD----RVLGGGWIVRAEASPALADAPIP 385


>gi|163736308|ref|ZP_02143727.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phaeobacter gallaeciensis BS107]
 gi|161390178|gb|EDQ14528.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phaeobacter gallaeciensis BS107]
          Length = 381

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M      +LNSL   K P + RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A
Sbjct: 1   MAQDAHPQLNSLGFAKPPAETRVVVAMSGGVDSSVVAAHLADEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ +     DG     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLEADCMATGHYIQRK-----DGPNGPELHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKDATREMASQYGLAVADKPDSQDICFVPNGDYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG H+G+I+YTIGQRRGLG+  + EPL+VV LD ++ +V+VGP+E L
Sbjct: 236 AEPGEIVHSDGRVLGTHDGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDTKQVVVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F     D +   VK+RS++ P    ++  ++    V+    E 
Sbjct: 296 ATRTIPVREINWLGDEPFTSR--DEWHLKVKVRSTRPPRDAIIRPISETEAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  + +  R+ GGG I
Sbjct: 354 GISPGQACVFYAEEGS--RIFGGGWI 377


>gi|163741163|ref|ZP_02148555.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phaeobacter gallaeciensis 2.10]
 gi|161385516|gb|EDQ09893.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phaeobacter gallaeciensis 2.10]
          Length = 381

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M      +LNSL   K P + RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A
Sbjct: 1   MAQDAHPQLNSLGFAKPPAETRVVVAMSGGVDSSVVAAHLADEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   R L AD +ATGHYI+ +     DG     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETARDLEADCMATGHYIQRK-----DGPNGPELHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKDATREMASQYGLAVADKPDSQDICFVPNGDYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG H+G+I+YTIGQRRGLG+  + EPL+VV LD ++ +V+VGP+E L
Sbjct: 236 AEPGEIVHSDGRVLGTHDGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDTKQVVVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F     D +   VK+RS++ P    ++  ++    V+    E 
Sbjct: 296 ATRTIPVREINWLGDEPFTSR--DEWHLKVKVRSTRPPRDAIIRPISETEAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  + +  R+ GGG I
Sbjct: 354 GISPGQACVFYAGEGS--RIFGGGWI 377


>gi|254437717|ref|ZP_05051211.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Octadecabacter antarcticus 307]
 gi|198253163|gb|EDY77477.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Octadecabacter antarcticus 307]
          Length = 379

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 194/378 (51%), Positives = 250/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGFAKPPSQTRVVVAMSGGVDSSVVAAQLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEDMGFPHYVLDYENTFREAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++     G R   +    D  RDQSYFLF+T  +QL  L
Sbjct: 127 LLETAKDLDADCMATGHYIQRKM-----GPRGAQLHCAEDANRDQSYFLFSTKPEQLEYL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K++ R+LAR+ GL +ADK DSQDICFV  G Y  V++++  G A  G+IV 
Sbjct: 182 RFPLGHLPSKDATRELARKYGLALADKPDSQDICFVPNGNYAAVIEKLRPGAAEPGNIVD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           ++G +L +H G+I+YTIGQRRGLG+  + +PL+VV LD +   VIVGP++ L    + +R
Sbjct: 242 IDGTVLAQHRGVIHYTIGQRRGLGIGGLADPLYVVKLDVDKKHVIVGPKDLLTTRTVPVR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD  F+          VKIRS++ P+   V+  +     ++    E GVA GQAC
Sbjct: 302 EINWLGDDAFDSKTERHIS--VKIRSTKPPMEAIVRPLSATTAEIELLTPEEGVAPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY SDS+  R+ GGG I
Sbjct: 360 VFYDSDSS--RIFGGGWI 375


>gi|294084590|ref|YP_003551348.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664163|gb|ADE39264.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 419

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/397 (47%), Positives = 261/397 (65%), Gaps = 17/397 (4%)

Query: 3   VSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK 62
            ++ + +NSL   K P D RVVVAMSGGVDSSV AA+L  +GY+VIG+TLQLY+   A +
Sbjct: 27  TADLSAINSLGFAKAPADTRVVVAMSGGVDSSVTAAMLHDEGYEVIGITLQLYDHGVAVQ 86

Query: 63  RKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNR 122
            KG+CCAG D++DAR V   + + HYV DYE +FR+ V+  FA SY  GETP+PCV CN+
Sbjct: 87  TKGACCAGIDIHDARTVSARLGIPHYVLDYESKFRDQVMEDFADSYLRGETPIPCVRCNQ 146

Query: 123 TVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
           TVKF+DLL+  ++LGAD LATGHY++ RL    +     ++ R +D  +DQSYFLFATT 
Sbjct: 147 TVKFTDLLTTAQELGADCLATGHYVQ-RL----ETPAGPVLRRGIDASKDQSYFLFATTA 201

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
           +Q+  LRFPLG + K+  RDLAR+ GL +++K DSQDICFV  G+Y DVV+R+  G    
Sbjct: 202 EQMDYLRFPLGGLTKDETRDLARKYGLAVSEKPDSQDICFVPNGRYGDVVRRLRPGAVEA 261

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVA-------MGEPLFVVYLDKNSSRVIVGPR 295
           GDIVHL+G +LG+H G+I+YTIGQRRGLG+           PL+VV +D  + RVIVGP+
Sbjct: 262 GDIVHLDGTVLGQHKGVIDYTIGQRRGLGIGGRKDADEADGPLYVVGIDAAAHRVIVGPQ 321

Query: 296 ESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEK 354
            +L  + ++L E +W+  G    A V G     ++R++   +P  ++  + G   V  + 
Sbjct: 322 SALACYEVHLSETSWVAGG---GAPVAGHPVLARLRNTAPAMPAVLEAGEGGCAIVRLDD 378

Query: 355 SEVGVASGQACVFYTSDSNEARVLGGGIISGSKRSDA 391
            + G+A GQA   Y +   E  +LGGG IS +  + A
Sbjct: 379 PQFGIAVGQAAAIYDAADPE-NLLGGGWISAAPLAGA 414


>gi|260433794|ref|ZP_05787765.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260417622|gb|EEX10881.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 381

 Score =  367 bits (941), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 254/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +     LNSL   K P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MALDTEPPLNSLGFAKPPSETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
              VKF DLL   + L AD +ATGHYI+ ++  G +G    + C   D  RDQSYFLF+T
Sbjct: 121 KERVKFKDLLETAKDLEADCMATGHYIQRKM--GPNGP--ELHCA-EDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLEFLRFPLGHLPSKDATREMAAQYGLSVADKPDSQDICFVPNGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG+H+G+I+YTIGQRRGLG+  + EPL+VV LD +  +V+VGP+E L
Sbjct: 236 AEPGEIVHADGRVLGQHDGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDRKQVVVGPKELL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F       +   VK+RS++ P    ++   D    V+    E 
Sbjct: 296 ATRTIPVREINWLGDEPFTSQ--KEWHVSVKVRSTRPPREAIIRPLTDTTAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  ++  +R+ GGG I
Sbjct: 354 GVSPGQACVFY--ETGGSRIFGGGWI 377


>gi|330813834|ref|YP_004358073.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486929|gb|AEA81334.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter sp. IMCC9063]
          Length = 379

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 187/381 (49%), Positives = 253/381 (66%), Gaps = 13/381 (3%)

Query: 4   SEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR 63
           +    +NSL   K P++ +VVVAMSGGVDSS VA LLK   Y VIG+TLQLY+  K  K 
Sbjct: 7   TNTNSINSLGFAKAPEETKVVVAMSGGVDSSTVAGLLKEQNYHVIGITLQLYDYGKIGKT 66

Query: 64  KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRT 123
            G+CCAG+D+YDA+RV + +N+ H+VF+YE  F+  VI  FA SY  GETP+PCV CN+T
Sbjct: 67  SGTCCAGKDIYDAKRVSEQLNIEHHVFNYESLFKEEVIEKFADSYLKGETPIPCVSCNQT 126

Query: 124 VKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQ 183
           VKF DL    ++LGAD L TGHY++    +G+  + +  M +P+D  RDQSYFLF+TTQ+
Sbjct: 127 VKFRDLFKSAKKLGADALVTGHYVKR---LGNLNQSK--MYQPVDANRDQSYFLFSTTQE 181

Query: 184 QLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEG 243
           QL  LRFPL D+ K+  RDLA++M L +ADK DSQDICFV  G Y  V++++       G
Sbjct: 182 QLDYLRFPLADLPKQETRDLAKKMNLSVADKPDSQDICFVPNGNYKSVIEKLRPESYDPG 241

Query: 244 DIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           +IV L G++LGRHNGIIN+TIGQR+G+ V    E +FV+ ++  +  VIVG R+ L + +
Sbjct: 242 NIVDLEGKVLGRHNGIINFTIGQRKGIKVGGQEEAIFVIKINPETKDVIVGSRQDLNITK 301

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASG 362
           I ++EIN+L D       ++G   F+K+RS+   +P  V  +D    V  +  E GV+ G
Sbjct: 302 IQVKEINFLCD----PKELEG-NFFIKVRSTGRLLPCRV--SDSATSVTLQAGESGVSPG 354

Query: 363 QACVFYTSDSNEARVLGGGII 383
           QACVFY  D    RV GGG I
Sbjct: 355 QACVFYRKDDKGMRVYGGGWI 375


>gi|126737635|ref|ZP_01753365.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. SK209-2-6]
 gi|126721028|gb|EBA17732.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. SK209-2-6]
          Length = 381

 Score =  366 bits (940), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 193/386 (50%), Positives = 252/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +   T LNSL   K P + RVVVAMSGGVDSSVVAA L   GYDV+GVTLQLY+   A
Sbjct: 1   MALDNDTPLNSLGFAKPPAETRVVVAMSGGVDSSVVAAYLADQGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV +     HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGIDIHDARRVAEERGFPHYVLDYENIFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+  +  G+ G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLEADCMATGHYIQRMM--GEQGPE---LHSAEDANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K++ R++A + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 TPEQLDYLRFPLGHLPSKDATREMAAQYGLAVADKPDSQDICFVPDGNYASVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IVH +G++LG H G+I+YTIGQRRGLG+  + EPL+VV LD +  +V+VGP++ L
Sbjct: 236 AEPGEIVHSDGRVLGTHEGVIHYTIGQRRGLGIGGLSEPLYVVKLDVDKKQVVVGPKDLL 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               I +REINWLGD  F        K  VK+RS++ P    ++   +    V+    E 
Sbjct: 296 ATRTIPVREINWLGDAPFTSQKEWHLK--VKVRSTRPPREAIIRPLTETTAEVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY S+ +  R+ GGG I
Sbjct: 354 GISPGQACVFYASEGS--RIFGGGWI 377


>gi|288958853|ref|YP_003449194.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Azospirillum sp. B510]
 gi|288911161|dbj|BAI72650.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Azospirillum sp. B510]
          Length = 391

 Score =  365 bits (936), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 199/385 (51%), Positives = 256/385 (66%), Gaps = 16/385 (4%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           +NSL L K P+D RVVVAMSGGVDSSV AA+L+ +GYDV+G+TLQLY+   A ++ G+CC
Sbjct: 1   MNSLGLSKRPQDTRVVVAMSGGVDSSVTAAVLREEGYDVVGITLQLYDHGLALQKPGACC 60

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AGQD+YDAR+V D I + HYV DYE RF   V+  FA SY  GETP+PCV CN+ VKF D
Sbjct: 61  AGQDIYDARQVADRIGIPHYVLDYEGRFSQDVMDDFADSYLRGETPIPCVRCNQRVKFRD 120

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL+  R LGAD LATGHY+R R+     G R   + R +D  +DQSYFLFATT++QL  L
Sbjct: 121 LLNTARDLGADALATGHYVR-RIA----GPRGAELHRAVDPAKDQSYFLFATTREQLEFL 175

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
           RFPLG + K   R LA   GL++A K DSQDICFV  G Y +VV ++  G    GDIVH+
Sbjct: 176 RFPLGGLTKPETRALAGRHGLEVAAKPDSQDICFVPNGNYAEVVAKLRPGSVEPGDIVHV 235

Query: 249 NGQILGRHNGIINYTIGQRRGLGVA-----MGEPLFVVYLDKNSSRVIVGPRESLEVHRI 303
           +G++LGRH G+++YT+GQR+GLG+        E L+VV L+    RV+VGPR  L    +
Sbjct: 236 DGRVLGRHKGVVHYTVGQRKGLGIGGIRGQEEEALYVVRLEPARRRVVVGPRRDLARSLV 295

Query: 304 YLREINWLG-DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVAS 361
            +R++NWLG D   + A   G +  VK+RS+Q   P       DG   V+  + + G+A 
Sbjct: 296 MVRDVNWLGSDPAPDQADGAGLEVSVKLRSAQPAAPALWHAGPDGTARVELREPQHGIAP 355

Query: 362 GQACVFYTSDSNEARVLGGGIISGS 386
           GQACV Y  D    RVLGGG ISG+
Sbjct: 356 GQACVVYQGD----RVLGGGWISGT 376


>gi|89054998|ref|YP_510449.1| tRNA-specific 2-thiouridylase MnmA [Jannaschia sp. CCS1]
 gi|122498420|sp|Q28PD8|MNMA_JANSC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|88864547|gb|ABD55424.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Jannaschia sp. CCS1]
          Length = 380

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 191/386 (49%), Positives = 253/386 (65%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +  +  LNSL   K P D RVVVAMSGGVDSS VAA L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDRSDGLNSLGFAKAPADTRVVVAMSGGVDSSAVAAQLADEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG+D++DA RV +T+   HYV DYE  F++AVI  FA SY AG TP+PC+ C
Sbjct: 61  LAKKGACCAGRDIHDAARVAETMGFPHYVLDYENVFKDAVIDEFADSYLAGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++     G+ +  +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRKM-----GREKAELHSAADAARDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            Q+QL  LRFPLG ++ K   R LA + GL +ADK DSQDICFV  G Y  V++++  G 
Sbjct: 176 KQEQLDFLRFPLGHLESKAETRALAAKYGLSVADKPDSQDICFVPNGNYAAVIEKLRPGA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV ++G +L  H G+I+YTIGQRRGLG+  + +PL+VV LD ++ RVIVGP+E L
Sbjct: 236 ADPGEIVDIDGNVLAMHRGVIHYTIGQRRGLGIGGLDDPLYVVKLDPDTRRVIVGPKEML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + +REINWLGD  F+      ++  VKIRS++ P    ++  +     V+   +E 
Sbjct: 296 STRTVPVREINWLGDTPFDSQ--QEWQMDVKIRSTRPPRGAVIRPVSATEAEVELIVAEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  +    R+ GGG I
Sbjct: 354 GVSPGQACVFYAPEGG--RIFGGGWI 377


>gi|126736443|ref|ZP_01752184.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. CCS2]
 gi|126713981|gb|EBA10851.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter sp. CCS2]
          Length = 379

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 193/378 (51%), Positives = 249/378 (65%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K+P   RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGFAKSPAQTRVVVAMSGGVDSSVVAAKLAEEGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AV+  FA SY  G TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEEMGFPHYVLDYENTFREAVMDEFADSYLGGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+  +  G +G        P    +DQSYFLF+TTQ QL  L
Sbjct: 127 LLETAKDLDADCMATGHYIQRMM--GANGAELHSAADPT---KDQSYFLFSTTQDQLDYL 181

Query: 189 RFPLG-DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG    KE  R LA + GL +ADK DSQDICFV  G Y  V++++  G A  G+IV 
Sbjct: 182 RFPLGHHASKEETRALAAKYGLSVADKPDSQDICFVPNGDYAAVIEKLRPGAAEPGNIVD 241

Query: 248 LNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            +G++LG H G+I+YTIGQRRGLG+  + +PL+VV LD +   VIVGP++ L   R+ +R
Sbjct: 242 TDGKVLGTHKGVIHYTIGQRRGLGIGGLADPLYVVKLDVDRKEVIVGPKDLLATRRVPIR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINW+GDG   D  +   +  V++RS++ P    ++  ++    V+   +E GV+ GQAC
Sbjct: 302 EINWIGDGNLMD--MGERQIAVRVRSTRPPTDAVLRPISETEAEVELLVAEQGVSPGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  DS   RVLGGG I
Sbjct: 360 VFYDPDST--RVLGGGWI 375


>gi|126726432|ref|ZP_01742273.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium HTCC2150]
 gi|126704295|gb|EBA03387.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacterales bacterium HTCC2150]
          Length = 377

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 193/380 (50%), Positives = 248/380 (65%), Gaps = 12/380 (3%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T LNSL   K P D RVVVAMSGGVDSSVVAA+L   GYDV+GVTLQLY+   A  +KG+
Sbjct: 4   TPLNSLGFAKAPADTRVVVAMSGGVDSSVVAAVLAEQGYDVVGVTLQLYDHGAALAKKGA 63

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAG+D++DARRV +T+   HYV DYE +F+ AVI  FA SY AG TP+PC+ CN  VKF
Sbjct: 64  CCAGRDIHDARRVAETMGFPHYVLDYENKFKEAVIDEFADSYLAGATPVPCIRCNERVKF 123

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL   + L AD +ATGHYI+  +     G  +  + +  D  RDQSYFLF+T Q QL 
Sbjct: 124 KDLLETAKDLDADCMATGHYIQRMM-----GDTKAELHQAADGNRDQSYFLFSTKQDQLD 178

Query: 187 DLRFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
            LRFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++  G A  GDI
Sbjct: 179 YLRFPLGHLTSKAETRALAAKYGLPVADKPDSQDICFVPNGNYAAVIEKLRPGSAEPGDI 238

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           V  +G ILG HNG+I+YTIGQRRGLG+  + +PL+VV LD +  +V+VG +E L    + 
Sbjct: 239 VDTDGNILGAHNGVIHYTIGQRRGLGIGGLADPLYVVRLDVDKRQVVVGAKELLATRTVP 298

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQ 363
           L EINWLGD        D +   V++RS++ P   V    ++    V+   +E G+++GQ
Sbjct: 299 LGEINWLGDEPLMSR--DEWHLDVRVRSTRPPRGAVLRPISETTATVELITAEEGISAGQ 356

Query: 364 ACVFYTSDSNEARVLGGGII 383
           ACVFY  D+   R+ GGG I
Sbjct: 357 ACVFY--DTESTRIFGGGWI 374


>gi|83593359|ref|YP_427111.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodospirillum rubrum ATCC 11170]
 gi|123526416|sp|Q2RSS1|MNMA_RHORT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|83576273|gb|ABC22824.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodospirillum rubrum ATCC 11170]
          Length = 377

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 192/384 (50%), Positives = 247/384 (64%), Gaps = 12/384 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSC 67
           ++   L   P   RVVVAMSGGVDSSV AALLK  G+DV+G+T++LY+  K       +C
Sbjct: 1   MSQTPLSPPPVGGRVVVAMSGGVDSSVTAALLKEQGHDVVGLTMRLYDHGKPLGPGARTC 60

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           CAGQD++DARRV D + ++HYV DYE RFR  VI PFA+SY  GETP+PCV CN+TVKF 
Sbjct: 61  CAGQDIHDARRVADRLGIAHYVLDYESRFREDVIEPFAASYGRGETPIPCVLCNQTVKFR 120

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DLL+    LG   LATGHY+R RL    DG     + R +D  RDQSYFLFATT+ QL  
Sbjct: 121 DLLAAALDLGGTALATGHYVR-RL----DGPEGPRLYRAVDPGRDQSYFLFATTKGQLGR 175

Query: 188 LRFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
           L FPLG M  K+  R +AR +GL + DK DSQDICFV  G Y  VV+R+  G+   G+IV
Sbjct: 176 LLFPLGAMASKDETRAIARRLGLAVGDKPDSQDICFVPDGDYAKVVERLRPGVVEAGEIV 235

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
            L+G +LG H G+I++T+GQRRG+G+    EPL+V+ LD  + R++VGP  +L    I +
Sbjct: 236 DLDGTVLGHHPGLIHFTVGQRRGVGIGGSAEPLYVIALDTATHRLVVGPHAALARREIAV 295

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVP--VFVQRNDDGVYVDFEKSEVGVASGQ 363
             +NWLG+G  E     G +  +KIR +  P P  +F         V  ++   GVA GQ
Sbjct: 296 SGLNWLGEG--EGPASAGTRARIKIRHASPPFPGQIFPGAAAGEARVVLDEPAHGVAPGQ 353

Query: 364 ACVFYTSDSNEARVLGGGIISGSK 387
           A VFY  D N+ARVLGGG I  S+
Sbjct: 354 AAVFYGLDDNDARVLGGGWIGASR 377


>gi|83942322|ref|ZP_00954783.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sulfitobacter sp. EE-36]
 gi|83846415|gb|EAP84291.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sulfitobacter sp. EE-36]
          Length = 380

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 250/386 (64%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +     LNSL   K P D RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MPLDRTPPLNSLGFAKAPADTRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             RKG+CCAG D++DARRV +++   HYV DYE  F++AVI  FA SY  G TP+PC+ C
Sbjct: 61  LARKGACCAGIDIHDARRVAESMGFPHYVLDYENVFKDAVIDEFADSYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++  G DG    + C   D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRKM--GPDGA--ELHCA-ADANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++    
Sbjct: 176 TPEQLDYLRFPLGHLPSKNDTRALAAKYGLSVADKPDSQDICFVPNGDYASVIRKLRPEA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV  +G +L +H+G+INYTIGQRRGLG+  + +PL+VV LD ++++V+VGP+  L
Sbjct: 236 ANPGNIVDTDGNVLAQHDGVINYTIGQRRGLGIGGLADPLYVVKLDADNAQVVVGPKSML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + ++EINWLGD          +   V++RS++ P    ++  +D    V+    E 
Sbjct: 296 ATRTVPVKEINWLGDTPLMSQ--SEWPIAVRVRSTRPPTDAILRPISDTEATVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  D    R+ GGG I
Sbjct: 354 GISPGQACVFY--DPESTRIFGGGWI 377


>gi|310816020|ref|YP_003963984.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ketogulonicigenium vulgare Y25]
 gi|308754755|gb|ADO42684.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ketogulonicigenium vulgare Y25]
          Length = 379

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 195/378 (51%), Positives = 252/378 (66%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL + K   + RVVVAMSGGVDSSVVAA LKR+GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 7   LNSLGIAKPVAETRVVVAMSGGVDSSVVAAQLKREGYDVVGVTLQLYDHGAALAKKGACC 66

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV + +   HYV DYE  FR AVI  FA SY AG TP+PC+ CN  VKF D
Sbjct: 67  AGRDIHDARRVAEEMGFPHYVLDYENTFREAVIDEFADSYLAGATPVPCIRCNERVKFKD 126

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++  GD       +    D  RDQSYFLF+TT +QL  L
Sbjct: 127 LLQTAKDLDADCMATGHYIQRKM--GDYAPE---LHSAADPNRDQSYFLFSTTPEQLAYL 181

Query: 189 RFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +K K   R LA E GL +ADK DSQDICFV  G Y  V++++    A  G+IV 
Sbjct: 182 RFPLGHLKSKAETRALAAEFGLGVADKPDSQDICFVPDGNYAAVIEKLRPDAAQPGEIVD 241

Query: 248 LNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           +NG++LG+H G+I+YT+GQ R      +GEP++VV LD ++ RVIVGP+ +L   R+ LR
Sbjct: 242 MNGKVLGQHPGVIHYTVGQRRGLGVGGLGEPVYVVRLDVDTRRVIVGPKSALATRRVPLR 301

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           E+NWLGDG F D      +  V++RSS+ P    ++  +     V+    E GV+ GQAC
Sbjct: 302 EVNWLGDGAFTDMAERHIR--VRVRSSRPPAEAILRPLSATTAEVELLTPEEGVSIGQAC 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY ++ +  RVLGGG I
Sbjct: 360 VFYETEGS--RVLGGGWI 375


>gi|329849969|ref|ZP_08264815.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Asticcacaulis biprosthecum C19]
 gi|328841880|gb|EGF91450.1| tRNA 5-methylaminomethyl-2-thiouridylate-methyltransferase
           [Asticcacaulis biprosthecum C19]
          Length = 395

 Score =  362 bits (930), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 252/371 (67%), Gaps = 7/371 (1%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           P   R+V AMSGGVDS+VVAALL   GY+VIGVTLQLY+   A K+ G+CCAGQD++DAR
Sbjct: 28  PAGARIVAAMSGGVDSTVVAALLAAAGYEVIGVTLQLYDHGAALKKTGACCAGQDIHDAR 87

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
              + I + HYV DYE RFR+ VI  FA SY  GETP+PC+ CN++VKF+DLL V R LG
Sbjct: 88  MASEKIGIPHYVLDYESRFRDQVIEEFADSYLRGETPVPCIRCNQSVKFNDLLQVARDLG 147

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY+       +DG     + R  D  RDQSYFLFATT++QL  LRFPL  + K
Sbjct: 148 AEAMATGHYVERS---DEDGVVS--LRRAADQSRDQSYFLFATTREQLDYLRFPLAGIPK 202

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VRD+A ++GL +A K DSQDICFV +GKY +++ R+      +G I H++G++LG H+
Sbjct: 203 PQVRDIAVQLGLKVAQKPDSQDICFVPEGKYTNLIDRLRPQGREKGAIRHIDGRVLGTHD 262

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI  YTIGQRRGL VA+GEPLFVV +D ++  ++VGPRE+L    + L+E NWLG     
Sbjct: 263 GITGYTIGQRRGLNVAVGEPLFVVKIDPDAKEILVGPREALLTRALTLKETNWLGSETDV 322

Query: 318 DAVVDGFK-CFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           DA     K    ++RS++ PV   +     G+ V+F+ +E GVA GQACV Y  + +  R
Sbjct: 323 DAAAGLRKPVLARVRSTRPPVAARLVAGVSGIEVEFDDAEEGVAPGQACVLYDVE-DSGR 381

Query: 377 VLGGGIISGSK 387
           VLGGG I+ ++
Sbjct: 382 VLGGGFIAATR 392


>gi|163731902|ref|ZP_02139349.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter litoralis Och 149]
 gi|161395356|gb|EDQ19678.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseobacter litoralis Och 149]
          Length = 380

 Score =  362 bits (929), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 186/386 (48%), Positives = 249/386 (64%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +  +  LNSL   K P   RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MPLDPSPMLNSLGFAKPPAQTRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D++DARRV + +   HYV DYE  F++AVI  FA SY  G TP+PC+ C
Sbjct: 61  LAKKGACCAGLDIHDARRVSEKMGFPHYVLDYENIFKDAVIDEFAESYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ +      G     +    D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRK-----SGPCGAELHSAADANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  KE  R LA + GL +A+K DSQDICFV  G Y  V++++    
Sbjct: 176 TPEQLAFLRFPLGHLPSKEDTRALAEKYGLSVANKPDSQDICFVPNGDYASVIRKLRPEA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV ++G++L  H+G+IN+TIGQRRGLG+  +  PL+V+ LD  + +V+VGP+  L
Sbjct: 236 AAPGNIVDVDGRVLATHDGVINFTIGQRRGLGIGGLATPLYVIKLDAQTRQVVVGPKSML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + +REINWLGD   +    D +   VK+RS++ P    ++  ++    V+    E 
Sbjct: 296 STRTVPVREINWLGDEPLQSR--DEWHLAVKVRSTRPPTDAIIRPISETEATVELTSPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY +DS+  R+ GGG I
Sbjct: 354 GVSPGQACVFYDTDSS--RIYGGGWI 377


>gi|294010267|ref|YP_003543727.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Sphingobium japonicum UT26S]
 gi|292673597|dbj|BAI95115.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Sphingobium japonicum UT26S]
          Length = 373

 Score =  362 bits (928), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 195/373 (52%), Positives = 240/373 (64%), Gaps = 21/373 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
            DL   P   R+VVAMSGGVDSSVVAAL  R G + IGVTLQLY+   A  R GSCCAGQ
Sbjct: 10  FDLKAPPDARRIVVAMSGGVDSSVVAALAARTGAETIGVTLQLYDHGAAVGRTGSCCAGQ 69

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V D I ++HYVFDYE RFR++VI  FA  Y AG TP+PCV CN  VKF+DL  
Sbjct: 70  DIRDARAVADRIGIAHYVFDYESRFRDSVIADFADEYMAGRTPIPCVKCNMGVKFTDLFQ 129

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R LGAD LATGHY+R       +G +   + R  D  RDQSYFLFATTQ QL  LRFP
Sbjct: 130 IARDLGADCLATGHYVRRV-----EGPQGAELHRAADSARDQSYFLFATTQAQLDYLRFP 184

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG + K  VR++A E+GL +A K DSQDICFV  G Y  +V+++       GDIVH++G+
Sbjct: 185 LGGLPKPQVREIAAELGLSVALKPDSQDICFVPDGDYAKIVRKLRPDADEGGDIVHIDGR 244

Query: 252 ILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           ++G H G+I+YT+GQR+GL +    EPL+VV LD  + RVIVGP+ +L V    L +INW
Sbjct: 245 LMGTHKGMIHYTVGQRKGLEIGGQAEPLYVVRLDAEARRVIVGPKAALAVSAARLSDINW 304

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
           LG G F   +        K+RS   PVP  ++    G  + F+  E GVA GQA V Y  
Sbjct: 305 LG-GDFAGPLT------AKVRSMAKPVPARLE----GDRLVFDAPEYGVAPGQAAVLYAG 353

Query: 371 DSNEARVLGGGII 383
           D    RVLGGG I
Sbjct: 354 D----RVLGGGWI 362


>gi|83953541|ref|ZP_00962262.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sulfitobacter sp. NAS-14.1]
 gi|83841486|gb|EAP80655.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sulfitobacter sp. NAS-14.1]
          Length = 380

 Score =  362 bits (928), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 189/386 (48%), Positives = 250/386 (64%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M +     LNSL   K P D RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MPLDRTPPLNSLGFAKAPADTRVVVAMSGGVDSSVVAAMLAEEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             RKG+CCAG D++DARRV +++   HYV DYE  F++AVI  FA SY  G TP+PC+ C
Sbjct: 61  LARKGACCAGIDIHDARRVAESMGFPHYVLDYENVFKDAVIDEFADSYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++  G DG    + C   D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLDADCMATGHYIQRKM--GLDGA--ELHCA-ADANRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T +QL  LRFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++    
Sbjct: 176 TPEQLDYLRFPLGHLPSKNDTRALAAKYGLSVADKPDSQDICFVPNGDYASVIRKLRPEA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV  +G +L +H+G+INYTIGQRRGLG+  + +PL+VV LD ++++V+VGP+  L
Sbjct: 236 ANPGNIVDTDGNVLAQHDGVINYTIGQRRGLGIGGLADPLYVVKLDADNAQVVVGPKSML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
               + ++EINWLGD          +   V++RS++ P    ++  +D    V+    E 
Sbjct: 296 ATRTVPVKEINWLGDTPLMSQ--SEWPIAVRVRSTRPPTDAILRPISDTEATVELLTPEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           G++ GQACVFY  D    R+ GGG I
Sbjct: 354 GISPGQACVFY--DPESTRIFGGGWI 377


>gi|229586563|ref|YP_002845064.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia africae ESF-5]
 gi|259495837|sp|C3PN11|MNMA_RICAE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|228021613|gb|ACP53321.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia africae ESF-5]
          Length = 365

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 242/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 7   KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K+
Sbjct: 127 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKD 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICF+  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 182 ETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNVVYVGPESALNVQEFIIRDVNWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y      ARV
Sbjct: 302 ---EKLEVAVKIRSTRPPRLAEISKFGDDKMKVKFLCEEKAVAPGQACVIYAG----ARV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|119386805|ref|YP_917860.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paracoccus denitrificans PD1222]
 gi|205816904|sp|A1B9H0|MNMA_PARDP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|119377400|gb|ABL72164.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Paracoccus denitrificans PD1222]
          Length = 389

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 193/381 (50%), Positives = 251/381 (65%), Gaps = 14/381 (3%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           + +NSL   K P   RVVVAMSGGVDSSVVAA+L   GYDVIGVTLQLY+   A  +KG+
Sbjct: 15  STVNSLGFPKPPAQTRVVVAMSGGVDSSVVAAMLAAQGYDVIGVTLQLYDHGAALAKKGA 74

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD++DARRV + I   HYV DYE +FR +VI  FA +Y AG TP+PC+ CN  VKF
Sbjct: 75  CCAGQDIHDARRVAERIGFPHYVLDYENKFRESVIEEFADAYLAGATPVPCIRCNERVKF 134

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DLL   R+L AD +ATGHYIR RL +G  G    +   P    RDQSYFLF+TTQ+QL 
Sbjct: 135 RDLLQTARELDADCMATGHYIR-RL-MGPKGAELHMAADPA---RDQSYFLFSTTQEQLD 189

Query: 187 DLRFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
            LRFPLG +  K   R LA + GL +ADK DSQDICFV  G Y  V++++  G A  G+I
Sbjct: 190 FLRFPLGGLASKAETRALAAQYGLAVADKPDSQDICFVPNGDYASVIEKLRPGAADPGEI 249

Query: 246 VHLNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           V ++G +LG H G+I+YTIGQ R      +G+PL+VV L+ ++ RV+VGP+++L    + 
Sbjct: 250 VDMDGNVLGSHRGVIHYTIGQRRGLGIGGLGDPLYVVRLEPDTRRVVVGPKQALATKIVP 309

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQ 363
           + E+NWLGD  FED +        +IRS++ P P  ++        ++    E GV+ GQ
Sbjct: 310 VTEVNWLGDEPFEDEIA----VTARIRSTRPPRPAILRVTGKHRAEIELLDPEEGVSPGQ 365

Query: 364 ACVFYTSDSNEARVLGGGIIS 384
           ACVFY ++ +  RVLGGG IS
Sbjct: 366 ACVFYATEGS--RVLGGGWIS 384


>gi|205821554|sp|A8F172|MNMA_RICM5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 365

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 243/367 (66%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 7   KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVRCNKSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K+
Sbjct: 127 DKLATGHYVRK--INGDNGAE---LYTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKD 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICFV  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 182 ETRKLASKFGLEVADKPDSQDICFVPDGNYKSVINKIRPNSSESGKIIHVNGFKLGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F  +E  VA GQACV Y  +    RV
Sbjct: 302 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCAEKAVAPGQACVIYAGE----RV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|307293549|ref|ZP_07573393.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingobium chlorophenolicum L-1]
 gi|306879700|gb|EFN10917.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingobium chlorophenolicum L-1]
          Length = 376

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 192/367 (52%), Positives = 239/367 (65%), Gaps = 21/367 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+VVAMSGGVDSSVVAAL  R G + IGVTLQLY+   A  R GSCCAGQD+ DAR V D
Sbjct: 23  RIVVAMSGGVDSSVVAALAARTGAETIGVTLQLYDHGAAVGRTGSCCAGQDIRDARAVAD 82

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I ++HYVFDYE RFR +VI  FA  Y AG TP+PCV CN  VKF+DL  + R LGAD L
Sbjct: 83  RIGIAHYVFDYESRFRESVIADFADEYMAGRTPIPCVKCNMGVKFTDLFQIARDLGADCL 142

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R       +G +   + R  D  RDQSYFLFATTQ QL  LRFPLG + K  VR
Sbjct: 143 ATGHYVRRV-----EGPQGAELHRAADPARDQSYFLFATTQAQLDYLRFPLGGLPKPQVR 197

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A E+GL +A K DSQDICFV  G Y  +V+++       GDIVH++G+++G H G+I+
Sbjct: 198 EIAAELGLSVAMKPDSQDICFVPDGDYAKIVRKLRPDADAGGDIVHIDGRLMGTHKGMIH 257

Query: 262 YTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           YT+GQR+GL +    EPL+VV LD  + RVIVGP+ +L V    L +INWLG G F   +
Sbjct: 258 YTVGQRKGLEIGGQAEPLYVVRLDAEARRVIVGPKAALAVSAARLSDINWLG-GDFSGPL 316

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                   K+RS   PVP  ++    G  + F+  E GVA GQA V Y  D    RVLGG
Sbjct: 317 T------AKVRSMAKPVPARLE----GDRLLFDAPEYGVAPGQAAVLYAGD----RVLGG 362

Query: 381 GIISGSK 387
           G I+ ++
Sbjct: 363 GWIAATE 369


>gi|157828286|ref|YP_001494528.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia rickettsii str.
           'Sheila Smith']
 gi|166235079|sp|A8GRJ5|MNMA_RICRS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|205822057|sp|B0BWZ7|MNMA_RICRO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157800767|gb|ABV76020.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia rickettsii str. 'Sheila Smith']
          Length = 365

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 241/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 7   KQSTIVVAMSGGVDSSAVAAMLNEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K 
Sbjct: 127 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKG 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICF+  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 182 ETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y      ARV
Sbjct: 302 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCKEKAVAPGQACVIYAG----ARV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|71083529|ref|YP_266248.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|91762051|ref|ZP_01264016.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter ubique HTCC1002]
 gi|123646720|sp|Q4FME4|MNMA_PELUB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|71062642|gb|AAZ21645.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717853|gb|EAS84503.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter ubique HTCC1002]
          Length = 371

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 178/379 (46%), Positives = 252/379 (66%), Gaps = 13/379 (3%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
           T+LNS+ + K+PKD  V+VAMSGGVDSS VAA++K +GY+VIG+TL+LYN  K +     
Sbjct: 2   TKLNSIGIAKDPKDTLVIVAMSGGVDSSTVAAMMKNEGYNVIGITLKLYNDSKETASSKQ 61

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CCAGQD+ DA+RV D + + H +  Y+ +F+  VI  F  SY  GETP+PCV CN+TVKF
Sbjct: 62  CCAGQDIMDAKRVADKLKIEHKILYYQNKFKEGVIDNFIDSYLNGETPIPCVQCNKTVKF 121

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
           +DL    ++L AD L TGHY++S        K    M R +DL RDQSYFLF TT+ QL 
Sbjct: 122 TDLFEEAKRLNADALVTGHYVKSITE-----KDNTDMYRGIDLNRDQSYFLFNTTKDQLN 176

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLG++ K+  R++ARE+ L++ADK DSQDICFV  G Y  V+++       +G+I 
Sbjct: 177 FLRFPLGNLLKDETRNIARELDLNVADKPDSQDICFVPNGDYASVIEKFRPNSFSKGNIK 236

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           ++NG+++G H+GIINYTIGQR+G+GV+   PL+VV +  + + +IVG +E L   +I L+
Sbjct: 237 NMNGEVIGVHDGIINYTIGQRKGIGVSDKNPLYVVKIIADKNEIIVGAKEHLVKTKINLK 296

Query: 307 EINWLGDGLFEDAVVDGFK--CFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQA 364
           ++N + +        + FK   FVK+RS+   +   +  ND    V+  + E G+A GQA
Sbjct: 297 DLNIITNDQ------NDFKNELFVKVRSTGRLIKAKIDINDTNANVNLLEEEHGIAPGQA 350

Query: 365 CVFYTSDSNEARVLGGGII 383
           CVFY  ++N  +VLGGG I
Sbjct: 351 CVFYAKNNNGYKVLGGGWI 369


>gi|94498089|ref|ZP_01304652.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingomonas sp. SKA58]
 gi|94422524|gb|EAT07562.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingomonas sp. SKA58]
          Length = 368

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 244/373 (65%), Gaps = 22/373 (5%)

Query: 17  NPKDMR-VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYD 75
            P+D R +VVAMSGGVDSSVVAAL  + G +VIGVTLQLY+   A  R GSCCAGQD+ D
Sbjct: 9   EPRDQRRIVVAMSGGVDSSVVAALAAKTGAEVIGVTLQLYDHGAAVGRTGSCCAGQDIRD 68

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           AR V D I ++HYVFDYE RFR++VI  FA  Y AG TP+PCV CN  VKF+DL  + R 
Sbjct: 69  ARAVADRIGIAHYVFDYESRFRDSVIADFADEYMAGRTPIPCVKCNMGVKFTDLFQIARD 128

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           LGAD LATGHY+R       +G     + R  D  RDQSYFLFATTQ QL  LRFPLG +
Sbjct: 129 LGADCLATGHYVRRV-----EGAAGAELHRAADPARDQSYFLFATTQAQLDYLRFPLGGL 183

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGR 255
            K  VR++A E+GL +A K DSQDICFV  G Y  +V+++       G+IVH++G+++GR
Sbjct: 184 PKSQVREIAAELGLSVALKPDSQDICFVPDGDYAKIVRKLRPDADEGGEIVHVDGRVMGR 243

Query: 256 HNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
           H G+I+YT+GQR+GL +    EPL+VV LD  + RVIVGP+ +L V    L +INWLG G
Sbjct: 244 HRGLIHYTVGQRKGLEIGGQAEPLYVVRLDAEARRVIVGPKAALAVSGALLSDINWLG-G 302

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNE 374
            F   +        K+RS   PVP  ++    G  + F+  E GVA GQA V Y  D   
Sbjct: 303 DFAGPLT------AKVRSMARPVPARLE----GDRLIFDAPEYGVAPGQAAVLYAGD--- 349

Query: 375 ARVLGGGIISGSK 387
            RVLGGG I+ ++
Sbjct: 350 -RVLGGGWIASTQ 361


>gi|165932990|ref|YP_001649779.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia rickettsii str.
           Iowa]
 gi|165908077|gb|ABY72373.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia rickettsii str. Iowa]
          Length = 370

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 241/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 12  KQSTIVVAMSGGVDSSAVAAMLNEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 71

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 72  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 131

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K 
Sbjct: 132 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKG 186

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICF+  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 187 ETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSG 246

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 247 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 306

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y      ARV
Sbjct: 307 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCKEKAVAPGQACVIYAG----ARV 359

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 360 LGGGWIT 366


>gi|15892333|ref|NP_360047.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia conorii str. Malish 7]
 gi|20455354|sp|Q92IL0|MNMA_RICCN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|15619478|gb|AAL02948.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia conorii str. Malish 7]
          Length = 370

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/367 (49%), Positives = 242/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 12  KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 71

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 72  VANKLGIPHYVLDYENKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 131

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K+
Sbjct: 132 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKD 186

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICF+  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 187 ETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSG 246

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 247 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 306

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y  +    RV
Sbjct: 307 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCEEKAVAPGQACVIYAGE----RV 359

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 360 LGGGWIT 366


>gi|103487513|ref|YP_617074.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingopyxis alaskensis RB2256]
 gi|123379667|sp|Q1GRI1|MNMA_SPHAL RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|98977590|gb|ABF53741.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingopyxis alaskensis RB2256]
          Length = 382

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 244/366 (66%), Gaps = 18/366 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           KD R+VVAMSGGVDSSVVAAL  R G +VIGVTLQLY+    +KR G+CCAGQD+ DAR 
Sbjct: 27  KDRRIVVAMSGGVDSSVVAALAARSGAEVIGVTLQLYDHGAKAKRVGACCAGQDIRDARA 86

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V D +   H+V D+E RFR+ VI  FA  Y AG TP+PCV CN  VKF+DL  + R+LGA
Sbjct: 87  VADRLGFVHHVHDHESRFRDTVIDQFADEYLAGRTPIPCVRCNMGVKFTDLFQLARELGA 146

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R    +G DG     M R +D  RDQSYFLFATTQ+QL  LRFPLG ++K 
Sbjct: 147 DCLATGHYVRR--VMGPDGAE---MHRAVDPARDQSYFLFATTQEQLDFLRFPLGGLEKN 201

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR++AR++GL +A K DSQDICFV  G Y  +V+++      +GDIVH++G +LG H G
Sbjct: 202 VVREIARDLGLGVAGKPDSQDICFVPDGDYASLVRKLRPEAEDQGDIVHVDGTVLGAHKG 261

Query: 259 IINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           +I+YT+GQRRG+ +    EPL+VV L+  + +VIVGPR +L V    L + NWL D    
Sbjct: 262 LIHYTVGQRRGIDIGGQAEPLYVVRLNAATKQVIVGPRRALAVSGARLGDANWLAD---- 317

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              V+G     K+RS   PVP  V  N     + F   E GVA GQA V Y + ++++RV
Sbjct: 318 ---VEGRDVLAKVRSMAKPVPARVTAN----RLRFLSPEYGVAPGQAAVLYDA-ADKSRV 369

Query: 378 LGGGII 383
           LGGG I
Sbjct: 370 LGGGWI 375


>gi|157964381|ref|YP_001499205.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia massiliae MTU5]
 gi|157844157|gb|ABV84658.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia massiliae MTU5]
          Length = 374

 Score =  360 bits (923), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 243/367 (66%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 16  KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 75

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 76  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVRCNKSVKFRDLIKTARELGA 135

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K+
Sbjct: 136 DKLATGHYVRK--INGDNGAE---LYTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGLTKD 190

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICFV  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 191 ETRKLASKFGLEVADKPDSQDICFVPDGNYKSVINKIRPNSSESGKIIHVNGFKLGEHSG 250

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 251 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 310

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F  +E  VA GQACV Y  +    RV
Sbjct: 311 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCAEKAVAPGQACVIYAGE----RV 363

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 364 LGGGWIT 370


>gi|238650755|ref|YP_002916609.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia peacockii str. Rustic]
 gi|259495838|sp|C4K1W0|MNMA_RICPU RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|238624853|gb|ACR47559.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia peacockii str. Rustic]
          Length = 365

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 184/367 (50%), Positives = 241/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K SCCAGQD+YDA+ 
Sbjct: 7   KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNSCCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG + K 
Sbjct: 127 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFMTTKEQLEYLRFPLGGLTKG 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICF+  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 182 ETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y  +    RV
Sbjct: 302 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCEEKAVAPGQACVIYAGE----RV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|34580653|ref|ZP_00142133.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia sibirica 246]
 gi|28262038|gb|EAA25542.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia sibirica 246]
          Length = 365

 Score =  359 bits (922), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 183/367 (49%), Positives = 241/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 7   KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  LRFPLG   K+
Sbjct: 127 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLRFPLGGFTKD 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICF+  G Y  V+ +I    +  G I+H+NG  LG H+G
Sbjct: 182 ETRKLASKFGLEVADKPDSQDICFIPDGNYKSVINKIRPNSSESGKIIHVNGFELGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    +R++NWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALNVQEFIIRDVNWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y  +    RV
Sbjct: 302 ---EKLEVAVKIRSTRPPRLAEISKLGDDKMKVKFLCEEKAVAPGQACVIYAGE----RV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|67458888|ref|YP_246512.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia felis URRWXCal2]
 gi|75536671|sp|Q4UM73|MNMA_RICFE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|67004421|gb|AAY61347.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia felis URRWXCal2]
          Length = 365

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 183/367 (49%), Positives = 241/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 7   KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
             LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  L FPLG + K+
Sbjct: 127 AQLATGHYVRK--VNGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLSFPLGGLTKD 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICFV  G Y  V+ +I  G +  G I+H+NG  LG H+G
Sbjct: 182 ETRRLASKFGLEVADKPDSQDICFVPDGNYKSVINKIRPGASESGKIIHVNGFELGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    ++ INWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPESALHVQEFIIKNINWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + + +DD + V F   E  VA GQACV Y  +    RV
Sbjct: 302 ---EKLEVEVKIRSTRPPRLAEISKLDDDKMKVKFLSEEKAVAPGQACVIYAGE----RV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|241761211|ref|ZP_04759299.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|283856328|ref|YP_162504.2| tRNA-specific 2-thiouridylase MnmA [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|292495018|sp|Q5NPG7|MNMA_ZYMMO RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|241374118|gb|EER63615.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|283775325|gb|AAV89393.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 370

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 194/375 (51%), Positives = 249/375 (66%), Gaps = 25/375 (6%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
             +DK     R+VVAMSGGVDSSVVAAL K  G + IG+TLQLY+   A  RKGSCCAG+
Sbjct: 5   FQIDKPKSAQRIVVAMSGGVDSSVVAALAKATGAETIGITLQLYDHGAAVGRKGSCCAGK 64

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V + I + HYVFDYE  F+ +VI  F S Y AG TP+PC+ CN+ VKF+DLL+
Sbjct: 65  DIRDARAVAEKIGIPHYVFDYENNFKESVIDDFVSEYVAGRTPVPCIRCNQGVKFTDLLN 124

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           V R+LGAD LATGHY+R RL   D    R  M R +D  RDQSYFLFATT++QL  LRFP
Sbjct: 125 VARELGADCLATGHYVR-RLVNND----RVEMHRALDPARDQSYFLFATTKEQLDYLRFP 179

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG + K  VR++A E+GL +A K+DSQDICFV  G Y  +V+         GDIV + G+
Sbjct: 180 LGGLPKPKVREMAAELGLSVAMKADSQDICFVPDGDYARIVEEKCPESGQGGDIVDMQGR 239

Query: 252 ILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           +LG+H+G+I++T+GQRRGL +    EPL+V+ LD    +++VGPR++L V +  ++E+NW
Sbjct: 240 VLGKHSGLIHFTVGQRRGLEIGGQKEPLYVIRLDPAKKQLVVGPRQALAVAKAEIKEVNW 299

Query: 311 LGDGLFEDAVVDGF--KCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           L         VDGF  +  VKIRS+  PV        DG  + FEK E GV+ GQA VFY
Sbjct: 300 L---------VDGFDREMQVKIRSAAKPVSARF----DGKELVFEKPEYGVSPGQAAVFY 346

Query: 369 TSDSNEARVLGGGII 383
             D    +VLGGG I
Sbjct: 347 DGD----QVLGGGWI 357


>gi|157803967|ref|YP_001492516.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia canadensis str.
           McKiel]
 gi|166235078|sp|A8EZE8|MNMA_RICCK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157785230|gb|ABV73731.1| hypothetical protein A1E_04020 [Rickettsia canadensis str. McKiel]
          Length = 368

 Score =  357 bits (917), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 179/363 (49%), Positives = 242/363 (66%), Gaps = 13/363 (3%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           +VVAMSGGVDS+ VAA+L   GY+VIG+TLQLY+   A  +K +CCAGQD+YDA+ V + 
Sbjct: 11  IVVAMSGGVDSAAVAAMLHAQGYNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKMVANK 70

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   ++LGA  LA
Sbjct: 71  LGIPHYVLDYESKFKESVIENFVDSYLQGETPLPCVQCNKSVKFKDLIKTAKELGAAQLA 130

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY+R     GD+G    I   P    +DQSYFLF TT++QL  L FPLG   K+  R 
Sbjct: 131 TGHYVRK--INGDNGAELHIGIDPA---KDQSYFLFTTTKEQLDYLSFPLGWFTKDETRK 185

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA + GL++A+K DSQDICFV  G Y +V+ +I  G + +G I+H+NG  LG H+GIINY
Sbjct: 186 LASKFGLEVANKPDSQDICFVPDGNYKNVINKIRPGSSKKGKIIHVNGFELGEHSGIINY 245

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQRRGLG+A  EPL+V+ +D N++ V VGP  +L +    ++++NWL D + ++   +
Sbjct: 246 TIGQRRGLGIAYNEPLYVIKIDPNNNIVYVGPESALNMQEFIIKDVNWLADEIKDN---E 302

Query: 323 GFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +  VKIRS++ P    + +  DD + V F   E  VA GQACV Y  +    RVLGGG
Sbjct: 303 KLEVAVKIRSTRLPSLAEISKLGDDKMKVKFLSEEKAVAPGQACVIYDGE----RVLGGG 358

Query: 382 IIS 384
            I+
Sbjct: 359 WIT 361


>gi|260752750|ref|YP_003225643.1| tRNA-specific 2-thiouridylase MnmA [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|258552113|gb|ACV75059.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 370

 Score =  357 bits (915), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 194/375 (51%), Positives = 248/375 (66%), Gaps = 25/375 (6%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
             +DK     R+VVAMSGGVDSSVVAAL K  G + IG+TLQLY+   A  RKGSCCAG+
Sbjct: 5   FQIDKPKSAQRIVVAMSGGVDSSVVAALAKATGAETIGITLQLYDHGAAVGRKGSCCAGK 64

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V + I + HYVFDYE  F+ +VI  F S Y AG TP+PC+ CN+ VKF+DLL+
Sbjct: 65  DIRDARAVAEKIGIPHYVFDYENNFKESVIDDFVSEYVAGRTPVPCIRCNQGVKFTDLLN 124

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           V R+LGAD LATGHY+R RL   D    R  M R +D  RDQSYFLFATT++QL  LRFP
Sbjct: 125 VARELGADCLATGHYVR-RLVNND----RVEMHRALDPARDQSYFLFATTKEQLDYLRFP 179

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG + K  VR++A E+GL +A K+DSQDICFV  G Y  +V+         GDIV + G+
Sbjct: 180 LGGLPKPKVREMAAELGLSVAMKADSQDICFVPDGDYARIVEEKCPESGQGGDIVDMQGR 239

Query: 252 ILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           +LG+H+G+I++T+GQRRGL +    EPL+V+ LD    +++VGPR++L V +  ++E+NW
Sbjct: 240 VLGKHSGLIHFTVGQRRGLEIGGQKEPLYVIRLDPAKKQLVVGPRQALAVAKAEIKEVNW 299

Query: 311 LGDGLFEDAVVDGFK--CFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFY 368
           L         VDGF     VKIRS+  PV        DG  + FEK E GV+ GQA VFY
Sbjct: 300 L---------VDGFDRGMQVKIRSAAKPVSARF----DGKELVFEKPEYGVSPGQAAVFY 346

Query: 369 TSDSNEARVLGGGII 383
             D    +VLGGG I
Sbjct: 347 DGD----QVLGGGWI 357


>gi|239947878|ref|ZP_04699631.1| tRNA-methyltransferase [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239922154|gb|EER22178.1| tRNA-methyltransferase [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 370

 Score =  356 bits (913), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 182/367 (49%), Positives = 239/367 (65%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 12  KQSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 71

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV  YE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGA
Sbjct: 72  VANKLGIPHYVLGYESKFKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGA 131

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  L FPLG + K+
Sbjct: 132 DKLATGHYVRK--INGDNGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLSFPLGGLTKD 186

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++ADK DSQDICFV  G Y  V+ +I  G +  G IVH+NG  LG H+G
Sbjct: 187 ETRKLASKFGLEVADKPDSQDICFVPDGNYKSVINKIRPGSSESGKIVHVNGFELGEHSG 246

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  +PL+VV +D   + V VGP  +L V    ++++NWL D   E 
Sbjct: 247 IINYTIGQRRGLGIAYNKPLYVVKIDPKDNIVYVGPESALHVQEFIIKDVNWLAD---ET 303

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  +  VKIRS++ P    + +  DD + + F   E  VA GQACV Y  +    RV
Sbjct: 304 KDNEKLEVAVKIRSTRPPRLAEISKLGDDKMKIKFLSEEKAVAPGQACVIYAGE----RV 359

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 360 LGGGWIT 366


>gi|91205346|ref|YP_537701.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia bellii RML369-C]
 gi|157826947|ref|YP_001496011.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia bellii OSU 85-389]
 gi|122425762|sp|Q1RJ52|MNMA_RICBR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166235077|sp|A8GVU7|MNMA_RICB8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|91068890|gb|ABE04612.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia bellii RML369-C]
 gi|157802251|gb|ABV78974.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia bellii OSU 85-389]
          Length = 367

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 181/372 (48%), Positives = 246/372 (66%), Gaps = 13/372 (3%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           ++ N +   +VVAMSGGVDSSVVA +L   GY+VIG+TLQLY+   A+ +K +CCAGQD+
Sbjct: 2   INSNDRQSTLVVAMSGGVDSSVVAGILCEQGYNVIGITLQLYDHGMATAKKNACCAGQDI 61

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
           YDA+ V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL+   
Sbjct: 62  YDAKMVANKLGMPHYVLDYESKFKESVIDNFVDSYLRGETPLPCVQCNKSVKFRDLIKTA 121

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           ++LGAD L TGHY+R     GD+G    +   P+   +DQSYFLFATT++QL  L FPLG
Sbjct: 122 KELGADKLVTGHYVRK--INGDNGPELHMGLDPL---KDQSYFLFATTKEQLEYLDFPLG 176

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K+  R LA + GL++ADK DSQDICFV  G Y +V+ +I    +  G I+H+NG  L
Sbjct: 177 ALTKDETRKLASKFGLEVADKPDSQDICFVPDGNYKNVINKIRPNASESGKILHINGFEL 236

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+GIINYTIGQRRGLG++  EPL+V+ +D NS+ V VGP  +L V    ++++NWL  
Sbjct: 237 GTHSGIINYTIGQRRGLGISYHEPLYVIKIDPNSNIVYVGPESALNVQEFVIKDVNWLA- 295

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDS 372
           G  +D   +  +  VK+RS++ P    + +   D + V F   E  VA GQACV Y    
Sbjct: 296 GSLKDG--EKLEVSVKVRSTRPPRLAEISKLEGDRMKVKFLSEEKAVAPGQACVIY---- 349

Query: 373 NEARVLGGGIIS 384
           +  RVLGGG I+
Sbjct: 350 DGTRVLGGGWIT 361


>gi|163747144|ref|ZP_02154500.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanibulbus indolifex HEL-45]
 gi|161379705|gb|EDQ04118.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oceanibulbus indolifex HEL-45]
          Length = 380

 Score =  352 bits (903), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 187/386 (48%), Positives = 245/386 (63%), Gaps = 12/386 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           M + +   LNSL   K P D RVVVAMSGGVDSSVVAA+L  +GYDV+GVTLQLY+   A
Sbjct: 1   MALDQTPPLNSLGFAKAPADTRVVVAMSGGVDSSVVAAMLADEGYDVVGVTLQLYDHGAA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
             +KG+CCAG D+ DARRV + +   HYV DYE  F++AVI  FA SY  G TP+PC+ C
Sbjct: 61  LAKKGACCAGVDIQDARRVAEEMGFPHYVLDYENVFKDAVIDEFADSYLGGATPVPCIRC 120

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N  VKF DLL   + L AD +ATGHYI+ ++  G++G          D  RDQSYFLF+T
Sbjct: 121 NERVKFKDLLETAKDLEADCMATGHYIQRKM--GENGPELHAAA---DGNRDQSYFLFST 175

Query: 181 TQQQLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
           T++QL  LRFPLG +  K+  R LA + GL +ADK DSQDICFV  G Y  V++++    
Sbjct: 176 TEEQLDYLRFPLGHLPSKDDTRALAAKYGLVVADKPDSQDICFVPNGDYAAVIRKLRPEA 235

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESL 298
           A  G+IV   G +L +H G+I+YTIGQRRGLG+  + +PL+VV LD     V+VGP+  L
Sbjct: 236 ADPGNIVDTEGNVLAKHEGVIHYTIGQRRGLGIGGLADPLYVVKLDAERKEVVVGPKSML 295

Query: 299 EVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV 357
              +I +REINWLGD          +   V++RS++ P    ++  +     V+   +E 
Sbjct: 296 ATRKIPVREINWLGDEPLTSR--SEWNITVRVRSTRPPRDAILRPISATEAEVELLTAEE 353

Query: 358 GVASGQACVFYTSDSNEARVLGGGII 383
           GV+ GQACVFY  D    R+ GGG I
Sbjct: 354 GVSPGQACVFY--DPESTRIFGGGWI 377


>gi|126462045|ref|YP_001043159.1| tRNA-specific 2-thiouridylase MnmA [Rhodobacter sphaeroides ATCC
           17029]
 gi|205816923|sp|A3PJ71|MNMA_RHOS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|126103709|gb|ABN76387.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 379

 Score =  352 bits (902), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 191/383 (49%), Positives = 246/383 (64%), Gaps = 12/383 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 6   LNSLGFAKPPAATRVVVAMSGGVDSSVVAAELAAEGYDVVGVTLQLYDHGAALAKKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV +T+   HYV DYE  FR AVI  FA +Y AG TP+PC+ CN  VKF D
Sbjct: 66  AGRDIHDARRVAETMGFPHYVLDYENTFREAVIDEFADAYLAGATPVPCIRCNERVKFKD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++  G  G    + C   D  RDQSYFLF+TT +QL  L
Sbjct: 126 LLQTAKDLDADCMATGHYIQRKM--GPAGP--ELHCA-ADAARDQSYFLFSTTPEQLAFL 180

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA   GL +ADK DSQDICFV  G Y +V++++  G A  G+IV 
Sbjct: 181 RFPLGHLASKAETRALAARHGLPVADKPDSQDICFVPNGNYAEVIQKLRPGAADPGEIVD 240

Query: 248 LNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           L+G++LG H G+I+YTIGQ R      +G+PL+VV LD    +VIVGP+E+L    + +R
Sbjct: 241 LSGRVLGEHRGVIHYTIGQRRGLGIGGLGDPLYVVRLDPERRQVIVGPKEALSTRIVPVR 300

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD          ++   K+RS++ P    ++  +D    V+    E GV+ GQAC
Sbjct: 301 EINWLGDAPLTSR--SEWQVMAKVRSTRAPREAVIRPLSDTEAEVELIAPEDGVSPGQAC 358

Query: 366 VFYTSDSNEARVLGGGIISGSKR 388
           VFY     ++R+LGGG I    R
Sbjct: 359 VFYA--PGDSRILGGGWIWRGAR 379


>gi|239787342|emb|CAX83819.1| tRNA-specific 2-thiouridylase MnmA [uncultured bacterium]
          Length = 366

 Score =  352 bits (902), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 187/367 (50%), Positives = 241/367 (65%), Gaps = 17/367 (4%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           PK  RV VAMSGGVDSSVVAAL+ ++GY V+G+TLQLY+  +A ++  +CCAGQD+YDAR
Sbjct: 14  PKGARVAVAMSGGVDSSVVAALMHKEGYQVVGITLQLYDHGEAIQKTKTCCAGQDIYDAR 73

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV + I   HYV DYE  F+  VI  FA SY  GETP+PCV CN+ +KF DLL   R L 
Sbjct: 74  RVSEKIGFHHYVLDYESIFKEEVIDDFADSYLRGETPIPCVQCNQKIKFRDLLRTARDLD 133

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
              L TGHY+++      +G+    + +  D  RDQSYFLF+T QQ L  LRFPLG + K
Sbjct: 134 CAALVTGHYVQNI-----NGE----LHQAHDPSRDQSYFLFSTKQQDLNYLRFPLGGIPK 184

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
              R LA E GL+IA+K DSQDICFV  G Y   V ++     + GDIV+L+G+ILG+H 
Sbjct: 185 SQTRILAEEFGLEIANKPDSQDICFVPNGNYAQTVAKLRPEALIAGDIVNLDGKILGQHQ 244

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GII+YTIGQRRGLG+A  +PL+VV LD   ++VIVGPR +L V  I ++++NW  D    
Sbjct: 245 GIIHYTIGQRRGLGIASVDPLYVVALDPIHNQVIVGPRSALAVTHIPVQDVNWFVD---L 301

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEAR 376
                GF C VK+RS+   +   VQ  D+    V  ++ E GV+SGQACVFY    +  R
Sbjct: 302 SKYPCGFYCTVKVRSTGAALSAKVQMIDESHALVTLDQPEYGVSSGQACVFY----DGTR 357

Query: 377 VLGGGII 383
           V+GGG I
Sbjct: 358 VIGGGWI 364


>gi|77463173|ref|YP_352677.1| tRNA-specific 2-thiouridylase MnmA [Rhodobacter sphaeroides 2.4.1]
 gi|123592152|sp|Q3J358|MNMA_RHOS4 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|77387591|gb|ABA78776.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter sphaeroides 2.4.1]
          Length = 379

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 190/383 (49%), Positives = 244/383 (63%), Gaps = 12/383 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 6   LNSLGFAKPPAVTRVVVAMSGGVDSSVVAAELAAEGYDVVGVTLQLYDHGAALAKKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV +T+   HYV DYE  FR AVI  FA +Y AG TP+PC+ CN  VKF D
Sbjct: 66  AGRDIHDARRVAETMGFPHYVLDYENTFREAVIDEFADAYLAGATPVPCIRCNERVKFKD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++  G  G        P    RDQSYFLF+TT +QL  L
Sbjct: 126 LLQTAKDLDADCMATGHYIQRKM--GPAGPELHSAADPA---RDQSYFLFSTTPEQLAFL 180

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA   GL +ADK DSQDICFV  G Y +V++++  G A  G+IV 
Sbjct: 181 RFPLGHLASKAETRALAARHGLPVADKPDSQDICFVPNGNYAEVIQKLRPGAADPGEIVD 240

Query: 248 LNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           L+G++LG H G+I+YTIGQ R      +G+PL+VV LD    +VIVGP+E+L    + +R
Sbjct: 241 LSGRVLGEHRGVIHYTIGQRRGLGIGGLGDPLYVVRLDPERRQVIVGPKEALSTRIVPVR 300

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD          ++   K+RS++ P    ++  +D    V+    E GV+ GQAC
Sbjct: 301 EINWLGDAPLTSR--SEWQVMAKVRSTRAPREAVIRPLSDTEAEVELIAPEDGVSPGQAC 358

Query: 366 VFYTSDSNEARVLGGGIISGSKR 388
           VFY     ++R+LGGG I    R
Sbjct: 359 VFYA--PGDSRILGGGWIWRGAR 379


>gi|15604175|ref|NP_220690.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia prowazekii str.
           Madrid E]
 gi|6226259|sp|Q9ZDM1|MNMA_RICPR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|3860867|emb|CAA14767.1| unknown [Rickettsia prowazekii]
 gi|292571906|gb|ADE29821.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia prowazekii Rp22]
          Length = 358

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 182/367 (49%), Positives = 237/367 (64%), Gaps = 17/367 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ V + 
Sbjct: 4   IVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDYGIAVGKKNACCAGQDIYDAKMVANK 63

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN++VKF DL++  ++LGAD LA
Sbjct: 64  LGIPHYVLDYENKFKESVIDNFVDSYLHGETPLPCVQCNKSVKFRDLINTAKELGADKLA 123

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY+R       +G     +   +D  +DQSYFLF  T++QL  L FPLG   K   R 
Sbjct: 124 TGHYVRKI-----NGYNGAELHTGLDTTKDQSYFLFTITREQLEYLSFPLGGFTKYETRK 178

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA + GLDIADK DSQDICFV  G Y  V+ +I       G IVH+NG  LG H+GIINY
Sbjct: 179 LASKFGLDIADKPDSQDICFVPDGNYKTVINKIRPEANTSGKIVHINGFELGEHSGIINY 238

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL--FEDAV 320
           TIGQRRGLG+A  EPL+VV +D +++ V VG   +L VH   ++++NWL D +   E   
Sbjct: 239 TIGQRRGLGIAYNEPLYVVKIDPSNNIVYVGQESALHVHEFIIKDVNWLADEIKDHEKLA 298

Query: 321 VDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           VD     VKIRS++ P    + +  +D + V F   E  VA GQACV Y  +    RVLG
Sbjct: 299 VD-----VKIRSTRPPCHAEISKLCNDRIKVKFLSKEKAVAPGQACVIYAGE----RVLG 349

Query: 380 GGIISGS 386
           GG I+ +
Sbjct: 350 GGWITSN 356


>gi|157825546|ref|YP_001493266.1| tRNA-specific 2-thiouridylase MnmA [Rickettsia akari str. Hartford]
 gi|166235076|sp|A8GMY3|MNMA_RICAH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|157799504|gb|ABV74758.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia akari str. Hartford]
          Length = 365

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 237/367 (64%), Gaps = 13/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   +VVAMSGGVDSS VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ 
Sbjct: 7   KHSTIVVAMSGGVDSSAVAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKM 66

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + HYV DYE +F+ +VI  F  SY  GETPLPCV CN +VKF DL+   R+LGA
Sbjct: 67  VANKLGIPHYVLDYESKFKESVIDNFVDSYLQGETPLPCVQCNNSVKFRDLIKTARELGA 126

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
             LATGHY+R     GD+G     +   +D  +DQSYFLF TT++QL  L FPLG   K+
Sbjct: 127 SQLATGHYVRK--VSGDNGVE---LHTGLDPAKDQSYFLFTTTKEQLEYLSFPLGWFTKD 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R LA + GL++A K DSQDICFV  G Y  V+  I    +  G I+H+NG  LG H+G
Sbjct: 182 ETRKLASKFGLEVAYKPDSQDICFVPDGNYKSVINTIRPNASESGKIIHINGFALGEHSG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYTIGQRRGLG+A  EPL+VV +D   + V VGP  +L V    ++++NWL D + ++
Sbjct: 242 IINYTIGQRRGLGIAYNEPLYVVKIDPKDNIVYVGPEAALHVQEFIIKDVNWLADEIKDN 301

Query: 319 AVVDGFKCFVKIRSSQDP-VPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
             ++     VKIRS++ P +    +  DD + + F  +E  VA GQACV Y  +    RV
Sbjct: 302 KKLE---VAVKIRSTRPPRLAAISKLGDDKMKIRFLSAEKAVAPGQACVIYAGE----RV 354

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 355 LGGGWIT 361


>gi|148557644|ref|YP_001265226.1| tRNA-specific 2-thiouridylase MnmA [Sphingomonas wittichii RW1]
 gi|148502834|gb|ABQ71088.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingomonas wittichii RW1]
          Length = 463

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 197/366 (53%), Positives = 246/366 (67%), Gaps = 20/366 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+VVAMSGGVDSSVVAAL    G + IGVTLQLY+   A  R GSCCAGQD+ DAR V D
Sbjct: 108 RIVVAMSGGVDSSVVAALAAASGAETIGVTLQLYDHGAAVGRTGSCCAGQDIRDARAVAD 167

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + ++HYVFDYE RFR++VI  FA  YAAG TP+PCV CN+ VKF+DL  + R LGAD L
Sbjct: 168 RLGIAHYVFDYESRFRDSVIADFADEYAAGRTPIPCVRCNQGVKFTDLFGIARDLGADCL 227

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R    VG  G  R  + R  D  RDQSYFLFATT+ QL  LRFPLG M K  VR
Sbjct: 228 ATGHYVRR--VVGAGG--RAELHRAADPARDQSYFLFATTRDQLDYLRFPLGAMPKPRVR 283

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A E+GL +A K DSQDICFV  G Y  +VKR+    A EG+IV L+G++LGRH G+I+
Sbjct: 284 EIAAELGLGVAAKPDSQDICFVPDGDYASIVKRLRPEAAEEGEIVGLDGRVLGRHRGLIH 343

Query: 262 YTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +T+GQRRG+ +    EPL+VV L+  + R++VGPR +L V    L ++NW+G+G +E  +
Sbjct: 344 FTVGQRRGIEIGGSPEPLYVVRLEPETKRLVVGPRRALAVSAAMLDDVNWIGEG-YEGPL 402

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                   K+RS   PVP    R +DG  V F++ E GVA GQA V Y  D    RVLGG
Sbjct: 403 T------AKVRSLAKPVPA---RFEDGA-VRFDQPEYGVAPGQAAVLYAGD----RVLGG 448

Query: 381 GIISGS 386
           G I  +
Sbjct: 449 GWIRAT 454


>gi|146277942|ref|YP_001168101.1| tRNA-specific 2-thiouridylase MnmA [Rhodobacter sphaeroides ATCC
           17025]
 gi|205817026|sp|A4WTT2|MNMA_RHOS5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|145556183|gb|ABP70796.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 378

 Score =  350 bits (897), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 192/378 (50%), Positives = 243/378 (64%), Gaps = 12/378 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L  DGYDV+GVTLQLY+   A  +KG+CC
Sbjct: 6   LNSLGFAKPPSATRVVVAMSGGVDSSVVAAELAADGYDVVGVTLQLYDHGAALAKKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV +T+   HYV DYE  FR AVI  FA +Y AG TP+PC+ CN  VKF D
Sbjct: 66  AGRDIHDARRVAETMGFPHYVLDYENTFREAVIDEFADAYLAGATPVPCIRCNERVKFKD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++  G  G    + C   D  RDQSYFLF+TT++QL  L
Sbjct: 126 LLQTAKDLDADCMATGHYIQRKM--GAAGP--ELHCA-ADAARDQSYFLFSTTREQLDYL 180

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA   GL +ADK DSQDICFV  G Y  V++++  G A  G+IV 
Sbjct: 181 RFPLGHLASKAETRALAARHGLPVADKPDSQDICFVPNGNYAAVIEKLRPGAADPGEIVD 240

Query: 248 LNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           L G +LG H G+I+YTIGQ R      +G+PLFVV LD    +VIVGPRE+L    + +R
Sbjct: 241 LAGNVLGAHRGVIHYTIGQRRGLGIGGLGDPLFVVRLDPERRQVIVGPREALSTRIVPVR 300

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD          ++   K+RS++ P    ++  +D    V+    E GV+ GQAC
Sbjct: 301 EINWLGDAPLTSQA--EWQVMAKVRSTRAPREAVIRPISDTEAEVELIAPEDGVSPGQAC 358

Query: 366 VFYTSDSNEARVLGGGII 383
           VF+     ++R+LGGG I
Sbjct: 359 VFHV--PGDSRILGGGWI 374


>gi|205829107|sp|A5VFM2|MNMA_SPHWW RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 378

 Score =  349 bits (896), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 197/366 (53%), Positives = 246/366 (67%), Gaps = 20/366 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+VVAMSGGVDSSVVAAL    G + IGVTLQLY+   A  R GSCCAGQD+ DAR V D
Sbjct: 23  RIVVAMSGGVDSSVVAALAAASGAETIGVTLQLYDHGAAVGRTGSCCAGQDIRDARAVAD 82

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + ++HYVFDYE RFR++VI  FA  YAAG TP+PCV CN+ VKF+DL  + R LGAD L
Sbjct: 83  RLGIAHYVFDYESRFRDSVIADFADEYAAGRTPIPCVRCNQGVKFTDLFGIARDLGADCL 142

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R    VG  G  R  + R  D  RDQSYFLFATT+ QL  LRFPLG M K  VR
Sbjct: 143 ATGHYVRR--VVGAGG--RAELHRAADPARDQSYFLFATTRDQLDYLRFPLGAMPKPRVR 198

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A E+GL +A K DSQDICFV  G Y  +VKR+    A EG+IV L+G++LGRH G+I+
Sbjct: 199 EIAAELGLGVAAKPDSQDICFVPDGDYASIVKRLRPEAAEEGEIVGLDGRVLGRHRGLIH 258

Query: 262 YTIGQRRGLGVAMG-EPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +T+GQRRG+ +    EPL+VV L+  + R++VGPR +L V    L ++NW+G+G +E  +
Sbjct: 259 FTVGQRRGIEIGGSPEPLYVVRLEPETKRLVVGPRRALAVSAAMLDDVNWIGEG-YEGPL 317

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                   K+RS   PVP    R +DG  V F++ E GVA GQA V Y  D    RVLGG
Sbjct: 318 T------AKVRSLAKPVPA---RFEDGA-VRFDQPEYGVAPGQAAVLYAGD----RVLGG 363

Query: 381 GIISGS 386
           G I  +
Sbjct: 364 GWIRAT 369


>gi|221639030|ref|YP_002525292.1| tRNA-specific 2-thiouridylase MnmA [Rhodobacter sphaeroides KD131]
 gi|254811459|sp|B9KR64|MNMA_RHOSK RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|221159811|gb|ACM00791.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter sphaeroides KD131]
          Length = 379

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 189/383 (49%), Positives = 243/383 (63%), Gaps = 12/383 (3%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCC 68
           LNSL   K P   RVVVAMSGGVDSSVVAA L  +GYDV+GVTLQLY+   A  +KG+CC
Sbjct: 6   LNSLGFAKPPAATRVVVAMSGGVDSSVVAAELAAEGYDVVGVTLQLYDHGAALAKKGACC 65

Query: 69  AGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSD 128
           AG+D++DARRV +T+   HYV DYE  FR AVI  FA +Y AG TP+PC+ CN  VKF D
Sbjct: 66  AGRDIHDARRVAETMGFPHYVLDYENTFREAVIDEFADAYLAGATPVPCIRCNERVKFKD 125

Query: 129 LLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
           LL   + L AD +ATGHYI+ ++  G  G        P    RDQSYFLF+TT +QL  L
Sbjct: 126 LLQTAKDLDADCMATGHYIQRKM--GPAGPELHCAADPA---RDQSYFLFSTTPEQLAFL 180

Query: 189 RFPLGDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           RFPLG +  K   R LA   GL +ADK DSQDICFV  G Y +V++++  G A  G+IV 
Sbjct: 181 RFPLGHLASKAETRALAARHGLPVADKPDSQDICFVPNGNYAEVIQKLRPGAADPGEIVD 240

Query: 248 LNGQILGRHNGIINYTIGQ-RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           L+G++LG H G+I+YTIGQ R      +G+PL+VV LD    +VIVGP+E+L    + +R
Sbjct: 241 LSGRVLGEHRGVIHYTIGQRRGLGIGGLGDPLYVVRLDPERRQVIVGPKEALSTRIVPVR 300

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
           EINWLGD          ++   K+RS++      ++  +D    V+    E GV+ GQAC
Sbjct: 301 EINWLGDAPLTSR--SEWQVMAKVRSTRASREAVIRPLSDTEAEVELIAPEDGVSPGQAC 358

Query: 366 VFYTSDSNEARVLGGGIISGSKR 388
           VFY     ++R+LGGG I    R
Sbjct: 359 VFYA--PGDSRILGGGWIWRGAR 379


>gi|225631290|ref|ZP_03787968.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Wolbachia endosymbiont of Muscidifurax uniraptor]
 gi|225591011|gb|EEH12215.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Wolbachia endosymbiont of Muscidifurax uniraptor]
          Length = 370

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 181/372 (48%), Positives = 242/372 (65%), Gaps = 19/372 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR-KASKRKGSCCAGQDV 73
           DK P   + VVAMSGGVDSSV AALL   GY VIGVTLQLY +   A+ RKG+CCAGQD+
Sbjct: 13  DKTPHQTKAVVAMSGGVDSSVAAALLHNLGYQVIGVTLQLYGTDGNANARKGACCAGQDI 72

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
           YDA+RV +++   HY+ +YEE F+  VI  FAS+Y  GETP+PCV CN+TVKF DLL VT
Sbjct: 73  YDAKRVAESVGFPHYILNYEEIFKKEVIEDFASTYMRGETPIPCVRCNQTVKFRDLLQVT 132

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           + LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATTQ+QL  LRFPLG
Sbjct: 133 KNLGADVLVTGHYVR-RLEKNGEVK----LCRSIDKSKDQSYFLFATTQEQLKLLRFPLG 187

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
              K  +R LA+   L I++K DSQDICFV +  Y   + ++      +G IV +NG++L
Sbjct: 188 GFYKSDIRKLAKYFSLQISEKPDSQDICFVSES-YSKTIAKLAPQSVQKGKIVDVNGKVL 246

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+GI+N+T+GQR+GLG+A  EPL+V+ ++  ++ VIVGP   L   +I ++E+NWL  
Sbjct: 247 GEHSGIVNFTVGQRKGLGIAHNEPLYVIKINTENNEVIVGPINVLMQKKILIKELNWL-- 304

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACVFYTSD 371
               +   +G +  VK+RSS       +   D+     V       G++ GQACV Y  +
Sbjct: 305 ----EQPKEGMEVTVKLRSSHAGSLATIHSTDEKNKACVILNDDYFGISPGQACVAYKDE 360

Query: 372 SNEARVLGGGII 383
               +V+GGG I
Sbjct: 361 ----QVIGGGWI 368


>gi|58698498|ref|ZP_00373403.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225630917|ref|YP_002727708.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Wolbachia sp. wRi]
 gi|254811470|sp|C0R4S5|MNMA_WOLWR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|58534992|gb|EAL59086.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Drosophila ananassae]
 gi|225592898|gb|ACN95917.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Wolbachia sp. wRi]
          Length = 370

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 243/372 (65%), Gaps = 19/372 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR-KASKRKGSCCAGQDV 73
           DK P  ++ +VAMSGGVDSSV AALL   GY VIGVTLQLY +   A+ RKG+CCAGQD+
Sbjct: 13  DKAPHQIKAIVAMSGGVDSSVAAALLHNLGYQVIGVTLQLYGTDGNANARKGACCAGQDI 72

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
           YDA+RV +++   HY+ +YEE F+  VI  FAS+Y  GETP+PCV CN+TVKF DLL VT
Sbjct: 73  YDAKRVAESVGFPHYILNYEEIFKKEVIEDFASTYMRGETPIPCVRCNQTVKFRDLLQVT 132

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           + LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATTQ+QL  LRFPLG
Sbjct: 133 KNLGADVLVTGHYVR-RLEKNGEVK----LCRSIDKSKDQSYFLFATTQEQLKLLRFPLG 187

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
              K  +R LA+   L I++K DSQDICFV +  Y   + ++      +G IV +NG++L
Sbjct: 188 GFYKSDIRKLAKYFSLQISEKPDSQDICFVSES-YSKTIAKLAPQSVQKGKIVDVNGKVL 246

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+GI+N+T+GQR+GLG+A  EPL+V+ ++  ++ VIVGP   L   +I ++E+NWL  
Sbjct: 247 GEHSGIVNFTVGQRKGLGIAHNEPLYVIKINTENNEVIVGPINVLMQKKILIKELNWL-- 304

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACVFYTSD 371
               +   +G +  VK+RSS       +   D+     V       G++ GQACV Y  +
Sbjct: 305 ----EQPKEGMEVTVKLRSSHAGSLATIHSTDEKNKACVILNDDYFGISPGQACVAYKGE 360

Query: 372 SNEARVLGGGII 383
               +V+GGG I
Sbjct: 361 ----QVIGGGWI 368


>gi|51473501|ref|YP_067258.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia typhi str. Wilmington]
 gi|73920129|sp|Q68X66|MNMA_RICTY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|51459813|gb|AAU03776.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rickettsia typhi str. Wilmington]
          Length = 358

 Score =  347 bits (890), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 181/369 (49%), Positives = 239/369 (64%), Gaps = 17/369 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           +VVAMSGGVDSS VAA+L   G+ VIG+TLQLY+   A  +K +CCAG+D+YDA+ V + 
Sbjct: 4   IVVAMSGGVDSSAVAAMLHEQGHHVIGITLQLYDYGIAVGKKNACCAGKDIYDAKMVANK 63

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + HYV DYE +F+ +VI  F +SY  GETPLPCV CN+ VKF DL++  ++LGAD LA
Sbjct: 64  LGIPHYVLDYENKFKESVIDNFVNSYLHGETPLPCVQCNKLVKFRDLINTAKELGADKLA 123

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY+R       +G     +   +D  +DQSYFLF  T++QL  L FPLG   K   R 
Sbjct: 124 TGHYVRKI-----NGYNGAELHTGLDAAKDQSYFLFTITREQLEYLIFPLGGFTKYETRK 178

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA + GLD+ADK DSQDICFV  G Y  V+ +I    +  G IVH+NG  LG H+GIINY
Sbjct: 179 LASKFGLDVADKPDSQDICFVPDGNYKTVINKIRPEASTSGKIVHINGFELGEHSGIINY 238

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL--FEDAV 320
           TIGQRRGLG+A  EPL+VV +D +++ V VG   +L VH   ++++NWL D +   E   
Sbjct: 239 TIGQRRGLGIAYNEPLYVVKIDPSNNIVYVGQESALHVHEFIIKDVNWLADEIKDNEKLA 298

Query: 321 VDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           VD     VKIRS++ P    + +  +D + V F  +E  VA GQACV Y  +    RVLG
Sbjct: 299 VD-----VKIRSTRPPCHAEISKLCNDKIKVQFLSAEKAVAPGQACVIYAGE----RVLG 349

Query: 380 GGIISGSKR 388
           GG I+ + R
Sbjct: 350 GGWITRNIR 358


>gi|144899505|emb|CAM76369.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 360

 Score =  345 bits (886), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 191/368 (51%), Positives = 245/368 (66%), Gaps = 17/368 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+VVAMSGGVDSS  AALLK  G+DV+GVTLQLY+  +A  R  +CCAG+D++DAR V D
Sbjct: 6   RIVVAMSGGVDSSATAALLKEQGWDVVGVTLQLYDHGQAVCRPNTCCAGKDIHDARTVAD 65

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV D E  F   V+  FA SY  GETP+PCV CN+TVKF DL S+ R LGAD L
Sbjct: 66  VLGIPHYVMDMESTFHADVVDKFAESYIRGETPIPCVLCNQTVKFRDLFSIARDLGADAL 125

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD-MKKESV 200
           ATGHY++ +     D     IM +  D  RDQSYFLF+TT++QL  LRFPLG  + K+  
Sbjct: 126 ATGHYVQRQ-----DSANGAIMLKGADPGRDQSYFLFSTTREQLEFLRFPLGGFLSKDET 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQILGRHNGI 259
           R +A    L +A K DSQDICFV  G Y  +V+R+  G    G IVH+ +G+ LGRH GI
Sbjct: 181 RAIAARYNLPVAAKRDSQDICFVPDGDYAGLVQRLKPGAIRPGAIVHVEDGRELGRHQGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQR+GLG+  G+PL+V+ L+   ++V+VGPRE+L   RI +R +NWLGDG   D 
Sbjct: 241 IHYTIGQRKGLGLGGGDPLYVIRLEAEKAQVVVGPREALGRSRITVRGVNWLGDGDGAD- 299

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
               F C V++RS++ P+P  V+ +   G  V  +  E GVA GQACVFY  D    RVL
Sbjct: 300 ----FVCQVRVRSTRPPMPARVRLDGQGGGLVMLDMPEQGVAPGQACVFYDGD----RVL 351

Query: 379 GGGIISGS 386
           GGG I G+
Sbjct: 352 GGGWIVGA 359


>gi|296535629|ref|ZP_06897808.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseomonas cervicalis ATCC 49957]
 gi|296264053|gb|EFH10499.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseomonas cervicalis ATCC 49957]
          Length = 368

 Score =  345 bits (885), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 188/369 (50%), Positives = 234/369 (63%), Gaps = 21/369 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR+VVAMSGGVDSSVVA LLK  G++VIG TLQLY+   A ++KG+CCAGQD++DAR V 
Sbjct: 1   MRIVVAMSGGVDSSVVAGLLKEQGHEVIGATLQLYDHGAAIEKKGACCAGQDIHDARDVA 60

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + + HYV D E RFR+AVI  FA +YA GETP+PCV CN+TVKF DL+ + R LGAD 
Sbjct: 61  DRLGIPHYVLDRERRFRDAVIEDFAEAYARGETPIPCVRCNQTVKFQDLVELARDLGADA 120

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD-MKKES 199
           LATGHY+R     G+ G   R   R  D  RDQSYFLFATT+ QL   RFPLGD   K  
Sbjct: 121 LATGHYVRR--TEGEAGAELR---RAADPARDQSYFLFATTRAQLEFCRFPLGDYTSKAE 175

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A  +GL +A+K DSQDICFV QGKY D+V ++      EG I H++G++LG H G+
Sbjct: 176 VRAEALRLGLAVAEKPDSQDICFVPQGKYADLVAKLRPEAVAEGSIEHVDGRVLGTHKGV 235

Query: 260 INYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
             YT+GQ RGLG+A     EPL+V  LD    RV+V PR +L    + + E+NWL     
Sbjct: 236 ARYTVGQGRGLGMASRDGEEPLYVTALDPARKRVVVAPRGALASPEVLVGEVNWL----- 290

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVFYTSDSNE 374
            DA      C VK+R+ + P P       +   + V  E+  +  A GQ CV Y  D   
Sbjct: 291 IDAPAVPLPCQVKLRAREMPQPAIAHWQPESGLLRVVLEQPAI-AAPGQGCVLYDGD--- 346

Query: 375 ARVLGGGII 383
            RVLGGG I
Sbjct: 347 -RVLGGGFI 354


>gi|42521055|ref|NP_966970.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Drosophila melanogaster]
 gi|81652123|sp|Q73FR5|MNMA_WOLPM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|42410796|gb|AAS14904.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Drosophila melanogaster]
          Length = 370

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 242/372 (65%), Gaps = 19/372 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR-KASKRKGSCCAGQDV 73
           DK P   + VVAMSGGVDSSV AALL   GY V+GVTLQLY +   A+ RKG+CCAGQD+
Sbjct: 13  DKAPHQTKAVVAMSGGVDSSVAAALLHNLGYKVVGVTLQLYGTDGNANARKGACCAGQDI 72

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
           YDA+RV +++   HY+ +YEE F+  VI  FAS+Y  GETP+PCV CN+TVKF DLL VT
Sbjct: 73  YDAKRVAESVGFPHYLLNYEEIFKKEVIEDFASTYMRGETPIPCVRCNQTVKFRDLLQVT 132

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           + LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATTQ+QL  LRFPLG
Sbjct: 133 KNLGADVLVTGHYVR-RLEKNGEVK----LCRSIDKSKDQSYFLFATTQEQLKLLRFPLG 187

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
              K  +R LA+   L I++K DSQDICFV +  Y   + ++      +G IV +NG++L
Sbjct: 188 GFYKSDIRKLAKYFSLQISEKQDSQDICFVSES-YSKTIAKLAPQSVQKGKIVDVNGKVL 246

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+GI+N+T+GQR+GLG+A  EPL+V+ ++  ++ VIVGP   L   +I ++E+NWL  
Sbjct: 247 GEHSGIVNFTVGQRKGLGIAHNEPLYVIKINTENNEVIVGPINVLMQKKILIKELNWL-- 304

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACVFYTSD 371
               +   +G +  VK+RSS       +   D+     V       G++ GQACV Y  +
Sbjct: 305 ----EQPKEGMEVTVKLRSSHVGSLATIHSTDEKNKACVILNDDYFGISPGQACVAYKDE 360

Query: 372 SNEARVLGGGII 383
               +V+GGG I
Sbjct: 361 ----QVIGGGWI 368


>gi|99035878|ref|ZP_01314930.1| hypothetical protein Wendoof_01000225 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 370

 Score =  344 bits (883), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 242/372 (65%), Gaps = 19/372 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR-KASKRKGSCCAGQDV 73
           DK P   + VVAMSGGVDSSV AALL   GY V+G+TLQLY +   A+ RKG+CCAGQD+
Sbjct: 13  DKAPHQTKAVVAMSGGVDSSVAAALLHNLGYKVVGMTLQLYGTDGNANARKGACCAGQDI 72

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
           YDA+RV +++   HY+ +YEE F+  VI  FAS+Y  GETP+PCV CN+TVKF DLL VT
Sbjct: 73  YDAKRVAESVGFPHYILNYEEIFKKEVIEDFASTYMRGETPIPCVRCNQTVKFRDLLQVT 132

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           + LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATTQ+QL  LRFPLG
Sbjct: 133 KNLGADVLVTGHYVR-RLEKNGEVK----LCRSIDKSKDQSYFLFATTQEQLKLLRFPLG 187

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
              K  +R LA+   L I++K DSQDICFV +  Y   + ++      +G IV +NG++L
Sbjct: 188 GFYKSDIRKLAKYFSLQISEKQDSQDICFVSES-YSKTIAKLAPQSVQKGKIVDVNGKVL 246

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+GI+N+T+GQR+GLG+A  EPL+V+ ++  ++ VIVGP   L   +I ++E+NWL  
Sbjct: 247 GEHSGIVNFTVGQRKGLGIAHNEPLYVIKINTENNEVIVGPINVLMQKKILIKELNWL-- 304

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDD--GVYVDFEKSEVGVASGQACVFYTSD 371
               +   +G +  VK+RSS       +   D+     V       G++ GQACV Y  +
Sbjct: 305 ----EQPKEGMEVTVKLRSSHVGSLATIHSTDEKNKACVILNDDYFGISPGQACVAYKDE 360

Query: 372 SNEARVLGGGII 383
               +V+GGG I
Sbjct: 361 ----QVIGGGWI 368


>gi|83312118|ref|YP_422382.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Magnetospirillum magneticum AMB-1]
 gi|123541366|sp|Q2W2V2|MNMA_MAGMM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|82946959|dbj|BAE51823.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Magnetospirillum magneticum AMB-1]
          Length = 373

 Score =  344 bits (882), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 196/388 (50%), Positives = 246/388 (63%), Gaps = 22/388 (5%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-----RKASKR 63
           +N+LD+DK P   RVVVAMSGGVDSS VAALLK  GYDV+GVTLQLY+         + R
Sbjct: 1   MNTLDIDKPPSSTRVVVAMSGGVDSSAVAALLKEQGYDVVGVTLQLYDLATSGIEPGACR 60

Query: 64  KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRT 123
             +CCAG+D++DAR V D + + HYV D+EE FR  V+  FA +Y    TP+PC++CNRT
Sbjct: 61  PNTCCAGKDIHDARAVADALGIPHYVLDFEETFRRDVVERFAQTYLEARTPVPCIECNRT 120

Query: 124 VKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQ 183
           VKF DLL V + LG D LATGHY+R R   G DG     +    D  RDQSYFLFATT+ 
Sbjct: 121 VKFRDLLGVAKDLGGDALATGHYVRRR--PGVDGPE---LWTGRDPGRDQSYFLFATTRD 175

Query: 184 QLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
           QL  LRFPLGDM  KE  R +A    L +A K DSQDICFV  G Y  +V R++   A  
Sbjct: 176 QLDFLRFPLGDMAGKEETRAIAARHHLPVAAKRDSQDICFVPDGDYAALVTRLHPDAARP 235

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           G+IV   G++LGRH G+I+YTIGQRRGLG+  G PL+VV L+  + RV+VG RE L    
Sbjct: 236 GEIVDTAGKVLGRHGGLIHYTIGQRRGLGLGGGPPLYVVALEPETGRVVVGSREDLNCLT 295

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVAS 361
           I +  +NWLG    E       +  VK+RS++   P  ++R + D   V  +  E GVA 
Sbjct: 296 IQVEAVNWLGGDETE------LRVAVKVRSTRPAAPALLRRLSGDRAQVILDHPEQGVAP 349

Query: 362 GQACVFYTSDSNEARVLGGGIISGSKRS 389
           GQACVFY  +    RVLGGG I  S+ +
Sbjct: 350 GQACVFYQGE----RVLGGGWICPSREA 373


>gi|162148152|ref|YP_001602613.1| tRNA-specific 2-thiouridylase MnmA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|205816818|sp|A9HMI3|MNMA_GLUDA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|161786729|emb|CAP56312.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 361

 Score =  343 bits (881), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 186/367 (50%), Positives = 245/367 (66%), Gaps = 20/367 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSSVVAA L  +G++V+G TLQLY+SR+ S RKG+CCAG+D++DARRV 
Sbjct: 1   MRIMVAMSGGVDSSVVAARLVAEGHEVVGATLQLYDSRE-SARKGACCAGRDIHDARRVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + + HYV D E RFR +VI  FA +YA GETP+PCV CN+ VKF+DLL + R LGA+ 
Sbjct: 60  DRLGIPHYVIDAETRFRQSVIETFADAYAGGETPVPCVACNQGVKFTDLLGIARDLGAEA 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY+R     G DG     + RP+D  RDQS+FLFATT+QQL  LRFPLGDM  K +
Sbjct: 120 MATGHYVRR--IEGPDGAE---LHRPVDEGRDQSWFLFATTRQQLEFLRFPLGDMPDKAA 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A   GL +A K DSQD+CFV  G Y  VV+ +   +A EG+IV  +G+++GRH+G+
Sbjct: 175 VRAEAERFGLSVAAKPDSQDLCFVPDGSYARVVEALRPEMAGEGEIVDGSGRVVGRHDGV 234

Query: 260 INYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
             +T+GQ R LG A    G    VV +D  S RV++GPR    V  + LR++NWL D   
Sbjct: 235 TRFTVGQSRRLGDAAMRDGARQMVVGIDPASRRVVIGPRTGSAVRDLSLRDMNWLIDPPE 294

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            D      +C V+IR+ +   P  V+R  DG  V  +++ +  A GQACV Y    + +R
Sbjct: 295 GD-----LRCLVQIRAREAARPATVRRTADGASVTLDEAAM-PAPGQACVLY----DGSR 344

Query: 377 VLGGGII 383
           VLGGG I
Sbjct: 345 VLGGGFI 351


>gi|189183712|ref|YP_001937497.1| tRNA-specific 2-thiouridylase MnmA [Orientia tsutsugamushi str.
           Ikeda]
 gi|189180483|dbj|BAG40263.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Orientia tsutsugamushi str. Ikeda]
          Length = 369

 Score =  343 bits (880), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 178/374 (47%), Positives = 236/374 (63%), Gaps = 13/374 (3%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+L    +   +VVAMSGGVDSS VAA+LK DGY+VIG+T+QLYN   A  RKG+CCAGQ
Sbjct: 2   LNLKVAKEQATIVVAMSGGVDSSTVAAILKEDGYNVIGITMQLYNHDTAINRKGACCAGQ 61

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+YDA+ V + + + HYV +Y+++F+ +VI  F  SY  GETPLPCV CN++VKF DLL+
Sbjct: 62  DIYDAKFVANQLQIPHYVLNYKDKFKKSVIDNFIESYINGETPLPCVQCNQSVKFHDLLN 121

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
             + L AD L TGHY+R R+    D      + + +D ++DQSYFLFATT+ QL  L FP
Sbjct: 122 FAKDLQADALVTGHYVR-RI----DTANGIELHKAVDSKKDQSYFLFATTKSQLQYLHFP 176

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG+M K+  R  A   GL IADK DSQDICFV  G Y +VV R+       G IVH++G 
Sbjct: 177 LGNMTKDETRYHANRYGLHIADKPDSQDICFVADGSYHNVVARLKPNAKKPGKIVHIDGY 236

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           ILG H GIIN+TIGQRR +G++  +PL+V+ +D   + V VGP   L      +  +NWL
Sbjct: 237 ILGEHQGIINFTIGQRRRIGISFSDPLYVINIDAQQNIVYVGPESKLFKTTFMIHSLNWL 296

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
           G G   + +V+     VK+RS+   V       ++  V V   + E  +A GQACV Y  
Sbjct: 297 GPG---NMLVEPLDVEVKVRSTHSAVQAKLYPYSNSMVKVILNEPEKAIAPGQACVIYKG 353

Query: 371 DSNEARVLGGGIIS 384
           D     VLGGG I+
Sbjct: 354 D----LVLGGGWIA 363


>gi|326386236|ref|ZP_08207860.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326209461|gb|EGD60254.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 401

 Score =  342 bits (877), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 187/383 (48%), Positives = 241/383 (62%), Gaps = 19/383 (4%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
            DL +  +D R+VVAMSGGVDSSVVAAL  R G +VIGVTLQLY+   A+ RKG+CCAG+
Sbjct: 30  FDLPRPAQDCRIVVAMSGGVDSSVVAALAARSGAEVIGVTLQLYDHGAATGRKGACCAGE 89

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V D +  +HYVFD+E  FR AV+  FA  Y +G TP+PC+ CN   KF+DL++
Sbjct: 90  DIRDARAVADRLGFAHYVFDHESDFREAVVERFADDYLSGRTPIPCIRCNMGPKFTDLMA 149

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R LGAD LATGHY+R R+      +    + R +D  RDQSYFL+ TT +QL  LRFP
Sbjct: 150 MARDLGADCLATGHYVR-RVMTATGPE----LHRAVDPARDQSYFLYGTTDEQLAFLRFP 204

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH-LNG 250
           LG + K  VR +A E+GL +A K DSQDICFV  G Y  VV  I    ++ GDIVH   G
Sbjct: 205 LGGLAKPDVRRIAGELGLGVAAKPDSQDICFVPDGDYARVVSAIRPEGSVAGDIVHAATG 264

Query: 251 QILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           ++LG+H GII+YT+GQRRGL +    EPL+VV LD  + RV+VGP+  L V R ++ E N
Sbjct: 265 EVLGQHKGIIHYTVGQRRGLEIGGQAEPLYVVALDAPARRVLVGPKAMLAVDRAHIVETN 324

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ---RNDDGVYVDFEKSEVGVASGQACV 366
            +G     D  +       K+RS   PVPV V+          + F   E GVA GQA V
Sbjct: 325 RIGPMPGPDEALT-----AKVRSLAKPVPVAVEGPFGEGAATTIRFFAPEYGVAPGQAAV 379

Query: 367 FYTSDSNEARVLGGGIISGSKRS 389
            Y  D    RV+GGG I  ++ +
Sbjct: 380 IYAGD----RVVGGGWIESTENA 398


>gi|148285130|ref|YP_001249220.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Orientia tsutsugamushi str. Boryong]
 gi|205816896|sp|A5CFJ6|MNMA_ORITB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146740569|emb|CAM81183.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Orientia tsutsugamushi str. Boryong]
          Length = 369

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 236/374 (63%), Gaps = 13/374 (3%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+L    +   +VVAMSGGVDSS VAA+LK DGY+VIG+T+QLYN   A  RKG+CCAGQ
Sbjct: 2   LNLKVAKEQATIVVAMSGGVDSSTVAAILKEDGYNVIGITMQLYNHDTAINRKGACCAGQ 61

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+YDA+ V + + + HYV +Y+++F+ +VI  F  SY  GETPLPCV CN++VKF DLL+
Sbjct: 62  DIYDAKFVANQLQIPHYVLNYKDKFKESVIDNFIESYINGETPLPCVQCNQSVKFHDLLN 121

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
             + L AD L TGHY+R R+    D      + + +D ++DQSYFLFATT+ QL  L FP
Sbjct: 122 FAKDLQADALVTGHYVR-RI----DTANGIELHKAVDSKKDQSYFLFATTKSQLQYLHFP 176

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG+M K+  R  A   GL IADK DSQDICFV  G Y +VV ++       G IVH++G 
Sbjct: 177 LGNMTKDETRYHANRYGLHIADKPDSQDICFVADGAYHNVVAKLKPNAKKPGKIVHIDGY 236

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           ILG H GIIN+TIGQRR +G++  +PL+V+ +D   + V VGP   L      +  +NWL
Sbjct: 237 ILGEHQGIINFTIGQRRRIGISFSDPLYVINIDAQQNIVYVGPESKLFKTTFMIHSLNWL 296

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
           G G   + +V+     VK+RS+   V       ++  V V   + E  +A GQACV Y  
Sbjct: 297 GPG---NMLVEPLDVEVKVRSTHSAVRAKLYPYSNSMVKVILNEPEKAIAPGQACVIYKG 353

Query: 371 DSNEARVLGGGIIS 384
           D     VLGGG I+
Sbjct: 354 D----LVLGGGWIA 363


>gi|46202527|ref|ZP_00053063.2| COG0482: Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Magnetospirillum magnetotacticum MS-1]
          Length = 373

 Score =  341 bits (875), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 193/383 (50%), Positives = 246/383 (64%), Gaps = 22/383 (5%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-----RKASKR 63
           +NSLD+DK     RVVVAMSGGVDSS VAALLK  GYDV+GVTLQLY+         + R
Sbjct: 1   MNSLDIDKPASATRVVVAMSGGVDSSAVAALLKEQGYDVVGVTLQLYDLATSGIEPGACR 60

Query: 64  KGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRT 123
             +CCAG+D++DAR V D + + HYV D+EE FR  V+  FA +Y   +TP+PC++CNRT
Sbjct: 61  PNTCCAGKDIHDARAVADALGIPHYVLDFEETFRRDVVERFAQTYLEAKTPVPCIECNRT 120

Query: 124 VKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQ 183
           VKF DLL V + LGAD LATGHY+R R      G +   M    D  RDQSYFL+ATT+ 
Sbjct: 121 VKFRDLLGVAKDLGADALATGHYVRRR-----SGPQGPEMWAGRDPGRDQSYFLYATTRA 175

Query: 184 QLCDLRFPLGDMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
           QL  LRFPLGDM  KE  R +A    L +A K DSQDICFV  G Y  +V R++   A  
Sbjct: 176 QLDFLRFPLGDMSGKEETRAIAARHHLPVAAKRDSQDICFVPDGDYAALVTRLHPEAARP 235

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           G+IV  +G++LGRH G+I+YTIGQRRGLG+  G PL+VV L+  + RV+VG R+ L+   
Sbjct: 236 GEIVDSSGKVLGRHEGLIHYTIGQRRGLGLGGGPPLYVVALEPETDRVVVGGRQDLDCPV 295

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVAS 361
           + +  +NWLG    E       +  VK+RS++   P  ++R  +G   V  +  E GVA 
Sbjct: 296 VPVEAVNWLGGDETE------LRVAVKVRSTRPAAPALLRRLPNGRAEVILDHPEQGVAP 349

Query: 362 GQACVFYTSDSNEARVLGGGIIS 384
           GQACVFY  +    RVLGGG IS
Sbjct: 350 GQACVFYQGE----RVLGGGWIS 368


>gi|209542792|ref|YP_002275021.1| tRNA-specific 2-thiouridylase MnmA [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530469|gb|ACI50406.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 361

 Score =  341 bits (874), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 185/367 (50%), Positives = 245/367 (66%), Gaps = 20/367 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSSVVAA L  +G++V+G TLQLY+SR+ S RKG+CCAG+D++DARRV 
Sbjct: 1   MRIMVAMSGGVDSSVVAARLVAEGHEVVGATLQLYDSRE-SARKGACCAGRDIHDARRVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + + HYV D E RFR +VI  FA +YA GETP+PCV CN+ VKF+DLL + R LGA+ 
Sbjct: 60  DRLGIPHYVIDAETRFRQSVIETFADAYAGGETPVPCVACNQGVKFTDLLGMARDLGAEA 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY+R     G DG     + RP+D  RDQS+FLFATT++QL  LRFPLGDM  K +
Sbjct: 120 MATGHYVRR--IEGPDGAE---LHRPVDEGRDQSWFLFATTRRQLEFLRFPLGDMPDKAA 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A   GL +A K DSQD+CFV  G Y  VV+ +   +A EG+IV  +G+++GRH+G+
Sbjct: 175 VRAEAERFGLSVAAKPDSQDLCFVPDGSYARVVEALRPEMAGEGEIVDGSGRVVGRHDGV 234

Query: 260 INYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
             +T+GQ R LG A    G    VV +D  S RV++GPR    V  + LR++NWL D   
Sbjct: 235 TRFTVGQSRRLGDAAMRDGARQMVVGIDPASRRVVIGPRTGSAVRDLSLRDMNWLIDPPE 294

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            D      +C V+IR+ +   P  V+R  DG  V  +++ +  A GQACV Y    + +R
Sbjct: 295 GD-----LRCLVQIRAREAARPATVRRTADGASVTLDEAAM-PAPGQACVLY----DGSR 344

Query: 377 VLGGGII 383
           VLGGG I
Sbjct: 345 VLGGGFI 351


>gi|58584415|ref|YP_197988.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418731|gb|AAW70746.1| Predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contain the PP-loop ATPase domain
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 385

 Score =  340 bits (872), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 240/373 (64%), Gaps = 20/373 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQD 72
           DK P   + VVAMSGGVDSSV A LL R GY VIGVTLQLY +     +++KG CCAGQD
Sbjct: 27  DKVPHQTKAVVAMSGGVDSSVAAVLLHRLGYQVIGVTLQLYGADGNSNTRKKGVCCAGQD 86

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           +YDA+RV +     HY+ +YEE F+  VI  FA +Y  G+TP+PC+ CN+TVKF DLL V
Sbjct: 87  IYDAKRVAEGTGFPHYILNYEEIFKKEVIESFAQTYIQGKTPIPCIKCNQTVKFRDLLQV 146

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
           TR LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATT++QL  LRFPL
Sbjct: 147 TRNLGADVLITGHYVR-RLEKNGEVK----LCRGIDKSKDQSYFLFATTKEQLKLLRFPL 201

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G   K +VR LAR   L I++K DSQDICFV +  Y   + ++      +G IV +NG++
Sbjct: 202 GGFYKCNVRKLARYFSLPISEKPDSQDICFVSEN-YSKTIAKLAPQSIQKGKIVDVNGKV 260

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LG HNGI+N+T+GQR+GLG+A  EPL+VV ++  ++ ++VGP  +L   +I ++E+NWL 
Sbjct: 261 LGEHNGIVNFTVGQRKGLGIAYSEPLYVVRINTKNNEIVVGPVNALMQRKILVKELNWL- 319

Query: 313 DGLFEDAVVDGFKCFVKIRS--SQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
                +    G +  VK+RS  S     ++  +  +  YV        ++ GQACV Y  
Sbjct: 320 -----EQPKKGMEVTVKLRSLHSGSLAKIYPAKEQNKAYVILNDDYFSISPGQACVAYKD 374

Query: 371 DSNEARVLGGGII 383
           +    +V+GGG I
Sbjct: 375 E----QVIGGGWI 383


>gi|254456653|ref|ZP_05070082.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083655|gb|EDZ61081.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 372

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 169/378 (44%), Positives = 242/378 (64%), Gaps = 11/378 (2%)

Query: 7   TRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS 66
             LNS+ ++K P+D  VVVAMSGGVDSS VA ++K +GY VIG+TL+LY+  K   +   
Sbjct: 3   NELNSIGINKKPEDTTVVVAMSGGVDSSTVAGMMKNEGYKVIGITLKLYDDGKEVAKSKQ 62

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CC+GQD+ DA+RV   +N+ H +  Y+++F+  VI  F  SY  GETP+PCV CN+TVKF
Sbjct: 63  CCSGQDIMDAKRVAHKLNIEHKILYYQDKFKQGVIDNFVDSYLNGETPIPCVQCNQTVKF 122

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
            DL  V+++L AD L TGHY++S             M R +D  RDQSYFLF TT++QL 
Sbjct: 123 KDLFEVSKELNADALVTGHYVKSIT-----SNNTTNMYRAIDENRDQSYFLFNTTREQLD 177

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
            LRFPLG M K+  R++A+++ L++ADK DSQDICFV  G Y  V+++       +G+I 
Sbjct: 178 YLRFPLGGMLKDETREIAKDLDLNVADKPDSQDICFVPNGDYASVIRKFRPDSFQKGNIK 237

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
           +L+G ++G H+GIIN+TIGQR+G+ V+  EPL+V+ ++  ++ ++VGP+E L    I L+
Sbjct: 238 NLDGDVIGVHDGIINFTIGQRKGIKVSDKEPLYVLKINSENNEIVVGPKEKLGKKSITLK 297

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQAC 365
           ++N L D       +     FVK+RS+   +   +   DD    V     E G++ GQAC
Sbjct: 298 DLNLLTDKKELKKNI-----FVKVRSTGSLLEAKIDLKDDNTANVSLISPEDGISPGQAC 352

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  D    +VLGGG I
Sbjct: 353 VFYNKDQYGHKVLGGGWI 370


>gi|190571202|ref|YP_001975560.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|213018602|ref|ZP_03334410.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|229487430|sp|B3CLZ0|MNMA_WOLPP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|190357474|emb|CAQ54908.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|212995553|gb|EEB56193.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 368

 Score =  340 bits (871), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 173/371 (46%), Positives = 244/371 (65%), Gaps = 19/371 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
           DK P   + +VAMSGGVDSSV AALL   GY+VIGVTLQLY S   + RKG+CCAGQD+Y
Sbjct: 13  DKAPHQTKAIVAMSGGVDSSVAAALLYNLGYEVIGVTLQLYGS-DGNARKGACCAGQDIY 71

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ V +++   HY+ +YEE F+  VI  FA++Y  GETP+PCV CN+TVKF DLL VT+
Sbjct: 72  DAKYVAESVGFPHYILNYEEIFKKEVIEDFANTYMRGETPIPCVRCNQTVKFRDLLQVTK 131

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LGADVL TGHY+R    + ++G+ +  +CR +D  +DQSYFLFATT++QL  LRFPLG 
Sbjct: 132 NLGADVLVTGHYVRR---LEENGEVK--LCRSIDKSKDQSYFLFATTEEQLKLLRFPLGG 186

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
             K  +R LA+  GL I++K DSQDICFV +  Y   + ++      +G IV ++G++LG
Sbjct: 187 FYKSDIRKLAKYFGLQISEKPDSQDICFVSES-YSKTIAKLAPQSVQKGKIVDIHGKVLG 245

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            H+GI+N+T+GQRRGL +A  EPL+V+ ++  ++ V+VGP  +L   +I ++E+NWL   
Sbjct: 246 EHSGIVNFTVGQRRGLCIAHNEPLYVIKINTENNEVVVGPINALMQKKILVKELNWL--- 302

Query: 315 LFEDAVVDGFKCFVKIRSSQ--DPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
              +   +G +  VK+RSS       ++     +   V       G++ GQACV Y  + 
Sbjct: 303 ---EQPKEGMEVTVKLRSSHAGSSATIYSTDEKNKACVILNDDYFGISPGQACVAYKGE- 358

Query: 373 NEARVLGGGII 383
              +V+GGG I
Sbjct: 359 ---QVIGGGWI 366


>gi|205829099|sp|Q5GTC8|MNMA_WOLTR RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 371

 Score =  339 bits (870), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 177/373 (47%), Positives = 240/373 (64%), Gaps = 20/373 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQD 72
           DK P   + VVAMSGGVDSSV A LL R GY VIGVTLQLY +     +++KG CCAGQD
Sbjct: 13  DKVPHQTKAVVAMSGGVDSSVAAVLLHRLGYQVIGVTLQLYGADGNSNTRKKGVCCAGQD 72

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           +YDA+RV +     HY+ +YEE F+  VI  FA +Y  G+TP+PC+ CN+TVKF DLL V
Sbjct: 73  IYDAKRVAEGTGFPHYILNYEEIFKKEVIESFAQTYIQGKTPIPCIKCNQTVKFRDLLQV 132

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
           TR LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATT++QL  LRFPL
Sbjct: 133 TRNLGADVLITGHYVR-RLEKNGEVK----LCRGIDKSKDQSYFLFATTKEQLKLLRFPL 187

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G   K +VR LAR   L I++K DSQDICFV +  Y   + ++      +G IV +NG++
Sbjct: 188 GGFYKCNVRKLARYFSLPISEKPDSQDICFVSEN-YSKTIAKLAPQSIQKGKIVDVNGKV 246

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LG HNGI+N+T+GQR+GLG+A  EPL+VV ++  ++ ++VGP  +L   +I ++E+NWL 
Sbjct: 247 LGEHNGIVNFTVGQRKGLGIAYSEPLYVVRINTKNNEIVVGPVNALMQRKILVKELNWL- 305

Query: 313 DGLFEDAVVDGFKCFVKIRS--SQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
                +    G +  VK+RS  S     ++  +  +  YV        ++ GQACV Y  
Sbjct: 306 -----EQPKKGMEVTVKLRSLHSGSLAKIYPAKEQNKAYVILNDDYFSISPGQACVAYKD 360

Query: 371 DSNEARVLGGGII 383
           +    +V+GGG I
Sbjct: 361 E----QVIGGGWI 369


>gi|332187411|ref|ZP_08389149.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingomonas sp. S17]
 gi|332012572|gb|EGI54639.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sphingomonas sp. S17]
          Length = 365

 Score =  338 bits (868), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 186/374 (49%), Positives = 236/374 (63%), Gaps = 22/374 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
             L  +P+  R+VVAMSGGVDSSVVAAL    G + IGVTLQLY+  +A  R G+CCAG+
Sbjct: 4   FQLGGDPRAKRIVVAMSGGVDSSVVAALAHATGAETIGVTLQLYDHGEAVGRAGACCAGR 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR VCD + ++HYVFD+E+ FR  V+  FA  Y AG TP+PCV CN   KF+DLL 
Sbjct: 64  DIRDARAVCDRLGIAHYVFDHEDSFRTQVVDRFADEYLAGRTPIPCVQCNMGPKFTDLLK 123

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R LGAD LATGHY+R       +G     + R  D  RDQSYFLFATTQ+QL  LRFP
Sbjct: 124 LARDLGADCLATGHYVRRV-----EGTHGAELHRGADPARDQSYFLFATTQEQLNFLRFP 178

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG + K  VR++A E+ L +A K DSQDICFV  G Y  +VK++       GDI+ L+G 
Sbjct: 179 LGALPKSRVREIAAELSLSVAAKPDSQDICFVPDGDYAGLVKKLRPEADTRGDIIDLSGA 238

Query: 252 ILGRHNGIINYTIGQRRGLGVAMG-EPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
            LG H G+I+YT+GQRRGL +    EPL+VV L+ ++ RV+VGPR +L V    L  +N 
Sbjct: 239 KLGEHRGLIHYTVGQRRGLEIGGSPEPLYVVRLEPDTKRVVVGPRTALAVEAARLTGMNI 298

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
           LG        +DG   F K+RS   PVP  +     G  + F+  E GV+ GQA V Y  
Sbjct: 299 LGP-------LDG-PLFAKVRSMAKPVPARMV----GDRLVFDAPEYGVSPGQAAVLYDG 346

Query: 371 DSNEARVLGGGIIS 384
           D    RVLGGG I+
Sbjct: 347 D----RVLGGGWIA 356


>gi|258543643|ref|YP_003189076.1| tRNA-specific 2-thiouridylase MnmA [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634721|dbj|BAI00697.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256637777|dbj|BAI03746.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256640831|dbj|BAI06793.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256643886|dbj|BAI09841.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646941|dbj|BAI12889.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649994|dbj|BAI15935.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652984|dbj|BAI18918.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656038|dbj|BAI21965.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 360

 Score =  337 bits (864), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 183/367 (49%), Positives = 244/367 (66%), Gaps = 20/367 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSSVVAA L  +G++V+G TLQLY+SR A+K KG+CCAGQD+ DAR V 
Sbjct: 1   MRILVAMSGGVDSSVVAARLLEEGHEVVGATLQLYDSRGAAK-KGACCAGQDIRDARAVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D +   HYV D E RF+++VI  FA +YA+GETP+PCV CN+ VKF+DLL + R++GAD 
Sbjct: 60  DLLGFPHYVIDAERRFKDSVIERFADAYASGETPVPCVACNQGVKFTDLLGLAREIGADA 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY+R     G DG     + RP D +RDQS+FLFATT+ QL  LRFPLGDM  K +
Sbjct: 120 MATGHYVRR--VEGPDGAE---LHRPCDEDRDQSWFLFATTRDQLEFLRFPLGDMPDKAA 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A   GL +A K DSQD+CFV  G Y D+V++++  +A  G+IV   GQI+G+H G+
Sbjct: 175 VRKEAERFGLVVAGKPDSQDLCFVSDGSYVDLVEKMHPEMAGPGEIVDQQGQIVGQHEGV 234

Query: 260 INYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           + +T+GQ + LG A    GE   VV ++    RVI+GPRE   V  + +R++NWL     
Sbjct: 235 MRFTVGQSKRLGNAARLNGERQMVVGVEPGRRRVIIGPREKSFVTALSVRDVNWL----- 289

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            DA  +G  C V++R+ ++P    V    DG  V  E+  +  A GQACVFY       R
Sbjct: 290 VDAPPEGLVCRVQMRAREEPRAARVVPTPDGAMVYLEEPAM-PAPGQACVFYQG----TR 344

Query: 377 VLGGGII 383
           +LGGG I
Sbjct: 345 ILGGGFI 351


>gi|330993151|ref|ZP_08317089.1| tRNA-specific 2-thiouridylase mnmA [Gluconacetobacter sp. SXCC-1]
 gi|329759921|gb|EGG76427.1| tRNA-specific 2-thiouridylase mnmA [Gluconacetobacter sp. SXCC-1]
          Length = 376

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 251/388 (64%), Gaps = 23/388 (5%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           + K  + MR++VAMSGGVDSSVVAA L  +G++VIG TLQLY+SR+++K KG+CCAG+D+
Sbjct: 4   IGKWNQAMRILVAMSGGVDSSVVAARLVDEGHEVIGATLQLYDSRESTK-KGACCAGRDI 62

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
           +DARRV D + + HYV D E RF ++VI  FA +YAAGETP+PCV CN+ VKF+DLL + 
Sbjct: 63  HDARRVADRLGIPHYVIDAERRFHDSVIGTFADAYAAGETPVPCVACNQGVKFTDLLGMA 122

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           R+LG D +ATGHY+R     G DG     M RP+D  RDQS+FLFATT+ QL  LRFPLG
Sbjct: 123 RELGVDAMATGHYVRR--VEGPDGPE---MHRPVDAGRDQSWFLFATTRDQLDFLRFPLG 177

Query: 194 DMK-KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           DM  K +VR  A   GL +A K DSQD+CFV  G Y  +V+++   +   G+IV  +GQ+
Sbjct: 178 DMPDKAAVRAEAERFGLAVAAKPDSQDLCFVTDGSYAGLVEKLRPDVTGAGEIVDQSGQV 237

Query: 253 LGRHNGIINYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           +GRH G+  YT+GQ R LG A    G    VV +   S RV++GPR       + LR++N
Sbjct: 238 VGRHEGVTRYTVGQSRRLGNAAMRDGARQMVVGIQPASRRVVIGPRAQAVTRTLMLRDMN 297

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFY 368
           W    L      DG +C V+IR+ +   P  + Q  + G  V+ ++  V  A GQACV Y
Sbjct: 298 W----LVSPPGPDGLRCAVQIRAREAARPATIWQAGNGGARVELDEGAV-PAPGQACVLY 352

Query: 369 TSDSNEARVLGGGIISGSKRSDAVEESL 396
               + +RVLGGG I   +R D+ E+ +
Sbjct: 353 ----DGSRVLGGGFI---RRPDSEEKGV 373


>gi|296282975|ref|ZP_06860973.1| tRNA-specific 2-thiouridylase MnmA [Citromicrobium bathyomarinum
           JL354]
          Length = 384

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 184/385 (47%), Positives = 234/385 (60%), Gaps = 21/385 (5%)

Query: 10  NSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCA 69
           N  DL +   + R+VVAMSGGVDSSVVAAL  + G DV+G+TLQLY+   A+ RKG+CCA
Sbjct: 15  NLFDLPRPASECRIVVAMSGGVDSSVVAALAAKTGADVVGITLQLYDYGAATGRKGACCA 74

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
           G D+ DAR V D + ++HYVFD+E  FR +V+  FA  Y AG TP+PC+ CN   KF+DL
Sbjct: 75  GDDIADARAVADRLGIAHYVFDHESAFRESVVEQFADDYLAGRTPVPCIRCNMGPKFTDL 134

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L++ R+L AD LATGHY+R  +  G        + R  D  RDQSYFLFATTQ QL  LR
Sbjct: 135 LTMARELDADCLATGHYVRRVMGAGGS-----ELHRAEDAGRDQSYFLFATTQPQLDFLR 189

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL- 248
           FPLG M K  VR LA E GL  A K DSQDICFV  G Y  +VK++    A  G IVH  
Sbjct: 190 FPLGGMPKSQVRALAEEAGLRNAAKPDSQDICFVPDGNYAGIVKKLRPEGATPGAIVHAR 249

Query: 249 NGQILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            G+ LG H G++++T+GQRRGL +    EPL+VV LD NS+ V VGP+  L      L +
Sbjct: 250 TGETLGEHAGVVHFTVGQRRGLEIGGQPEPLYVVELDANSAEVRVGPKAMLATASAQLVD 309

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN---DDGVYVDFEKSEVGVASGQA 364
            N +G        +       K+RS   PVPV ++ +      V + FE  E GVA GQA
Sbjct: 310 TNRIGP-------LPDLPLTAKVRSLAKPVPVTLEGSLGEGSPVTITFETPEYGVAPGQA 362

Query: 365 CVFYTSDSNEARVLGGGIISGSKRS 389
            V Y  D    R +GGG I  ++ +
Sbjct: 363 AVIYAGD----RAVGGGWIDSTRPA 383


>gi|254796826|ref|YP_003081663.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Neorickettsia risticii str. Illinois]
 gi|254590056|gb|ACT69418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Neorickettsia risticii str. Illinois]
          Length = 368

 Score =  335 bits (860), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 175/370 (47%), Positives = 240/370 (64%), Gaps = 15/370 (4%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVY 74
           K  +D++V+VAMSGGVDSS VAA L R GY VIGVTLQL+ NS      + +CCAG D++
Sbjct: 11  KASRDIKVMVAMSGGVDSSTVAAYLHRAGYKVIGVTLQLHSNSTSTQTNRKTCCAGSDIF 70

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+RV       HYV + EE FR  VI  FA SY  GETP+PCV CN+TVKF DL+ + +
Sbjct: 71  DAKRVAAQFGFLHYVVNMEETFRKEVIEDFAKSYLRGETPIPCVKCNQTVKFRDLMKIAK 130

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            L  D L TGHY+R RL   +  +    + + +D  +DQSYFLF TT++QL  LRFPLG+
Sbjct: 131 NLSVDALVTGHYVR-RLTTTNGVE----LHKGIDPSKDQSYFLFNTTREQLEFLRFPLGN 185

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           +KK   RDLAR++ +DI++K +SQDICFV    Y DV+K+        G I+  NG++LG
Sbjct: 186 LKKSETRDLARKLSVDISEKPESQDICFVNGKSYADVIKKFRPDAQKPGKILSTNGEVLG 245

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            HNG I+YTIGQR GL ++   PL+VV +D  ++ +IVG R+ L+   +Y++E+NWL DG
Sbjct: 246 THNGTIHYTIGQRHGLQLSSPTPLYVVKIDAQNNIIIVGTRDKLQQRSLYVKEVNWL-DG 304

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDF-EKSEVGVASGQACVFYTSDSN 373
                +  G +C VK+RS  D V  ++  + D + V   E+ +  +A GQACV Y    +
Sbjct: 305 ---KELTAGLECEVKLRSGADTVKGYLYPSSDLLKVSLAEEPKCAIAPGQACVMY----H 357

Query: 374 EARVLGGGII 383
            ++VLGGG I
Sbjct: 358 GSKVLGGGWI 367


>gi|296114840|ref|ZP_06833488.1| tRNA-specific 2-thiouridylase MnmA [Gluconacetobacter hansenii ATCC
           23769]
 gi|295978546|gb|EFG85276.1| tRNA-specific 2-thiouridylase MnmA [Gluconacetobacter hansenii ATCC
           23769]
          Length = 358

 Score =  334 bits (857), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 180/367 (49%), Positives = 243/367 (66%), Gaps = 20/367 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSSVVAA L  +G++V+G TLQLY+SR+ S RKG+CCAG+D++DARRV 
Sbjct: 1   MRILVAMSGGVDSSVVAARLVEEGHEVVGATLQLYDSRE-SARKGACCAGRDIHDARRVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + ++HYV D E RFR++VI  FA +YA GETP+PCV CN+ VKF+DLL + R LG D 
Sbjct: 60  DRLGIAHYVIDAERRFRDSVIETFADAYAEGETPVPCVACNQGVKFTDLLGMARDLGVDA 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY+R R+    +G +   + RP+D  RDQS+FLFATT QQL  LRFPLGDM  K++
Sbjct: 120 MATGHYVR-RI----EGPQGVELHRPVDAGRDQSWFLFATTLQQLGFLRFPLGDMPDKDA 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A   GL +A K DSQD+CF+  G Y  +V+++    +  G+IV L+G ++G H G+
Sbjct: 175 VRAEAERFGLAVAGKPDSQDLCFIPDGSYARLVEKLRPQTSGAGEIVDLSGNVVGTHEGV 234

Query: 260 INYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
             YT+GQ R LG A    GE   VV ++    RV++GPR       + LR +NWL     
Sbjct: 235 ARYTVGQSRRLGDATMQGGERQMVVGIEPGRRRVVIGPRTQGVTRELRLRNMNWL----- 289

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            +    G +C V+IR+ +   P  V+R +DG  V  +++ V  A GQACV Y    +  R
Sbjct: 290 VEPPAQGLRCSVQIRAREAVRPATVRRTEDGASVLLDEAAV-PAPGQACVMY----DGTR 344

Query: 377 VLGGGII 383
           VLGGG I
Sbjct: 345 VLGGGFI 351


>gi|241116858|ref|XP_002401642.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase,
           putative [Ixodes scapularis]
 gi|215493186|gb|EEC02827.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase,
           putative [Ixodes scapularis]
          Length = 343

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 170/350 (48%), Positives = 226/350 (64%), Gaps = 13/350 (3%)

Query: 36  VAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEER 95
           VAA+L   G++VIG+TLQLY+   A  +K +CCAGQD+YDA+ V + + + HYV  YE +
Sbjct: 2   VAAMLHEQGHNVIGITLQLYDHGMAVGKKNACCAGQDIYDAKMVANKLGIPHYVLGYESK 61

Query: 96  FRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGD 155
           F+ +VI  F  SY  GETPLPCV CN++VKF DL+   R+LGAD LATGHY+R     GD
Sbjct: 62  FKESVIDNFVDSYLQGETPLPCVQCNKSVKFRDLIKTARELGADKLATGHYVRK--INGD 119

Query: 156 DGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKS 215
           +G     +   +D  +DQSYFLF TT++QL  L FPLG + K+  R LA + GL++ADK 
Sbjct: 120 NGAE---LHTGLDPAKDQSYFLFTTTKEQLEYLSFPLGGLTKDETRKLASKFGLEVADKP 176

Query: 216 DSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMG 275
           DSQDICFV  G Y  V+ +I  G +  G IVH+NG  LG H+GIINYTIGQRRGLG+A  
Sbjct: 177 DSQDICFVPDGNYKSVINKIRPGSSESGKIVHVNGFELGEHSGIINYTIGQRRGLGIAYN 236

Query: 276 EPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQD 335
           +PL+VV +D   + V VGP  +L V    ++++NWL D   E    +  +  VKIRS++ 
Sbjct: 237 KPLYVVKIDPKDNIVYVGPESALHVQEFIIKDVNWLAD---ETKDNEKLEVAVKIRSTRP 293

Query: 336 PVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
           P    + +  DD + + F   E  VA GQACV Y  +    RVLGGG I+
Sbjct: 294 PRLAEISKLGDDKMKIKFLSEEKAVAPGQACVIYAGE----RVLGGGWIT 339


>gi|56416599|ref|YP_153673.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaplasma marginale str. St. Maries]
 gi|222474965|ref|YP_002563380.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (trmU)
           [Anaplasma marginale str. Florida]
 gi|269958985|ref|YP_003328774.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaplasma centrale str. Israel]
 gi|81359210|sp|Q5PBB1|MNMA_ANAMM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|56387831|gb|AAV86418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaplasma marginale str. St. Maries]
 gi|222419101|gb|ACM49124.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (trmU)
           [Anaplasma marginale str. Florida]
 gi|269848816|gb|ACZ49460.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaplasma centrale str. Israel]
          Length = 387

 Score =  334 bits (856), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 245/383 (63%), Gaps = 13/383 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MV   +  L+ L   K P++  VVVAMSGGVDSSVVAALL   GY VIG T+QL++S  A
Sbjct: 9   MVFDGSLNLDPLVSGKPPEETTVVVAMSGGVDSSVVAALLHERGYKVIGATMQLHSSSPA 68

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           S  K SCC   D+YDA+RV  T+   HYV DYEE FR  VI  F +SY  GETP+PCV C
Sbjct: 69  SGAK-SCCGSVDIYDAKRVASTLGFPHYVLDYEEVFRREVIDDFINSYKRGETPIPCVKC 127

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N+TVKF D+L   R +G DV+ATGHY+R     G+     + + R  D ++DQSYFLF+ 
Sbjct: 128 NQTVKFRDMLKAARAIGGDVVATGHYVRRVEIAGE-----QQILRGKDPQKDQSYFLFSV 182

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           T +QL  LRFPLGD+ K +VR LA+++ L++ADK DSQDICFV +  Y +V++ ++    
Sbjct: 183 TSEQLKFLRFPLGDLAKSNVRLLAQQLNLEVADKPDSQDICFVPENSYREVLRNLDPASV 242

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
            +G IVH++G++LG H+GI N+T+GQRRGL ++   PL+VV LD   + V+VGP+ +L  
Sbjct: 243 KKGKIVHVDGRLLGEHDGISNFTVGQRRGLNISAPYPLYVVRLDAAQNTVVVGPQSALMK 302

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
             ++++ +NWL D    +    G     ++RSS   V   +  + DG      + +  V+
Sbjct: 303 RALFVKNLNWLPD---YNIPKRGLAVDARLRSSGATVRATITSDGDGYGTVVLEEDCVVS 359

Query: 361 SGQACVFYTSDSNEARVLGGGII 383
            GQACV Y    ++ R+LGGG I
Sbjct: 360 PGQACVLY----DKERLLGGGWI 378


>gi|294677198|ref|YP_003577813.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter capsulatus SB 1003]
 gi|294476018|gb|ADE85406.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhodobacter capsulatus SB 1003]
          Length = 354

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 186/361 (51%), Positives = 237/361 (65%), Gaps = 14/361 (3%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSSVVAA+LK +GYDVIGVTLQLY+   A  +KG+CCAGQD++DARRV + +N  
Sbjct: 1   MSGGVDSSVVAAMLKEEGYDVIGVTLQLYDHGAALAKKGACCAGQDIHDARRVAEAMNFP 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HYV DYE  FR AVI  FA +Y AG TP+PC+ CN  VKF DLL   R L AD +ATGHY
Sbjct: 61  HYVLDYENTFREAVIEEFADAYLAGATPVPCIRCNERVKFKDLLETARDLDADCMATGHY 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KESVRDLAR 205
           I+ +L  G  G        PM   RDQSYFLF+TT +QL  LRFPLG +  K   R LA 
Sbjct: 121 IQRKL--GAHGPELHSAADPM---RDQSYFLFSTTPEQLAFLRFPLGHLPSKAETRKLAA 175

Query: 206 EMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIG 265
             GL +ADK DSQDICFV   +  +  +++  G A  G+IV L G++LG H G+I+YTIG
Sbjct: 176 RFGLIVADKPDSQDICFVPT-ELCERHRKLRPGAADPGEIVDLAGKVLGHHKGVIHYTIG 234

Query: 266 QRRGLGVAMG--EPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDG 323
           QRRGLG+      PL+VV LD ++ RVIVGP+E+L    + + EINWLGD  FE      
Sbjct: 235 QRRGLGIGGLGDHPLYVVKLDPDTRRVIVGPKEALATRLLRVAEINWLGDEPFESH--PE 292

Query: 324 FKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGI 382
            +  V+IRS++ P P  ++  +     V+  + E GV+ GQACVFY ++ +  R+ GGG 
Sbjct: 293 REVSVRIRSTRAPRPAILRPLSATTAEVELIEPEEGVSPGQACVFYETEGS--RIFGGGW 350

Query: 383 I 383
           I
Sbjct: 351 I 351


>gi|329113810|ref|ZP_08242581.1| tRNA-specific 2-thiouridylase MnmA [Acetobacter pomorum DM001]
 gi|326696820|gb|EGE48490.1| tRNA-specific 2-thiouridylase MnmA [Acetobacter pomorum DM001]
          Length = 360

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 181/367 (49%), Positives = 243/367 (66%), Gaps = 20/367 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSSVVAA L  +G++V+G TLQLY+SR A+K KG+CCAGQD+ DAR V 
Sbjct: 1   MRILVAMSGGVDSSVVAARLLEEGHEVVGATLQLYDSRGAAK-KGACCAGQDIRDARAVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D +   HYV D E RF+++VI  FA +YA+GETP+PCV CN+ VKF+DLL + R++GAD 
Sbjct: 60  DLLGFPHYVIDAERRFKDSVIERFADAYASGETPVPCVACNQGVKFTDLLGLAREIGADA 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY+R     G +G     + RP D +RDQS+FLFATT+ QL  LRFPLGDM  K +
Sbjct: 120 MATGHYVRR--VEGPEGAE---LHRPCDEDRDQSWFLFATTRDQLEFLRFPLGDMPDKAA 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A   GL +A K DSQD+CFV  G Y D+V++++  +A  G+IV   GQI+G+H G+
Sbjct: 175 VRKEAERFGLVVAGKPDSQDLCFVSDGSYVDLVEKMHPEMAGPGEIVDQQGQIVGQHEGV 234

Query: 260 INYTIGQRRGLGVAM---GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           + +T+GQ + LG A    GE   VV ++    RVI+GPRE   V  + +R +NWL     
Sbjct: 235 MRFTVGQSKRLGNAARLNGERQMVVGVEPGRRRVIIGPREKSFVTALSVRNVNWL----- 289

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            DA  +G  C V++R+ ++P    V    +G  V  E+  +  A GQACVFY       R
Sbjct: 290 VDAPPEGLFCRVQMRAREEPRAARVVPTPEGAMVYLEEPAM-PAPGQACVFYQG----TR 344

Query: 377 VLGGGII 383
           +LGGG I
Sbjct: 345 ILGGGFI 351


>gi|255002942|ref|ZP_05277906.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (trmU)
           [Anaplasma marginale str. Puerto Rico]
 gi|255004068|ref|ZP_05278869.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (trmU)
           [Anaplasma marginale str. Virginia]
          Length = 379

 Score =  333 bits (855), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 245/383 (63%), Gaps = 13/383 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MV   +  L+ L   K P++  VVVAMSGGVDSSVVAALL   GY VIG T+QL++S  A
Sbjct: 1   MVFDGSLNLDPLVSGKPPEETTVVVAMSGGVDSSVVAALLHERGYKVIGATMQLHSSSPA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           S  K SCC   D+YDA+RV  T+   HYV DYEE FR  VI  F +SY  GETP+PCV C
Sbjct: 61  SGAK-SCCGSVDIYDAKRVASTLGFPHYVLDYEEVFRREVIDDFINSYKRGETPIPCVKC 119

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N+TVKF D+L   R +G DV+ATGHY+R     G+     + + R  D ++DQSYFLF+ 
Sbjct: 120 NQTVKFRDMLKAARAIGGDVVATGHYVRRVEIAGE-----QQILRGKDPQKDQSYFLFSV 174

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           T +QL  LRFPLGD+ K +VR LA+++ L++ADK DSQDICFV +  Y +V++ ++    
Sbjct: 175 TSEQLKFLRFPLGDLAKSNVRLLAQQLNLEVADKPDSQDICFVPENSYREVLRNLDPASV 234

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
            +G IVH++G++LG H+GI N+T+GQRRGL ++   PL+VV LD   + V+VGP+ +L  
Sbjct: 235 KKGKIVHVDGRLLGEHDGISNFTVGQRRGLNISAPYPLYVVRLDAAQNTVVVGPQSALMK 294

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
             ++++ +NWL D    +    G     ++RSS   V   +  + DG      + +  V+
Sbjct: 295 RALFVKNLNWLPD---YNIPKRGLAVDARLRSSGATVRATITSDGDGYGTVVLEEDCVVS 351

Query: 361 SGQACVFYTSDSNEARVLGGGII 383
            GQACV Y    ++ R+LGGG I
Sbjct: 352 PGQACVLY----DKERLLGGGWI 370


>gi|254994811|ref|ZP_05277001.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase (trmU)
           [Anaplasma marginale str. Mississippi]
          Length = 379

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 177/383 (46%), Positives = 245/383 (63%), Gaps = 13/383 (3%)

Query: 1   MVVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA 60
           MV   +  L+ L   K P++  VVVAMSGGVDSSVVAALL   GY VIG T+QL++S  A
Sbjct: 1   MVFDGSLNLDPLVSGKPPEETTVVVAMSGGVDSSVVAALLHERGYKVIGATMQLHSSSPA 60

Query: 61  SKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDC 120
           S  K SCC   D+YDA+RV  T+   HYV DYEE FR  VI  F +SY  GETP+PCV C
Sbjct: 61  SGAK-SCCGSVDIYDAKRVASTLGFPHYVLDYEEVFRREVIDDFINSYKRGETPIPCVKC 119

Query: 121 NRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFAT 180
           N+TVKF D+L   R +G DV+ATGHY+R     G+     + + R  D ++DQSYFLF+ 
Sbjct: 120 NQTVKFRDMLKAARAIGGDVVATGHYVRRVEIAGE-----QQILRGKDPQKDQSYFLFSV 174

Query: 181 TQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA 240
           T +QL  LRFPLGD+ K +VR LA+++ L++ADK DSQDICFV +  Y +V++ ++    
Sbjct: 175 TSEQLKFLRFPLGDLAKSNVRLLAQQLNLEVADKPDSQDICFVPENSYREVLRNLDPASV 234

Query: 241 LEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
            +G IVH++G++LG H+GI N+T+GQRRGL ++   PL+VV LD   + V+VGP+ +L  
Sbjct: 235 KKGKIVHVDGRLLGEHDGISNFTVGQRRGLNISAPYPLYVVRLDAAQNAVVVGPQSALMK 294

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVA 360
             ++++ +NWL D    +    G     ++RSS   V   +  + DG      + +  V+
Sbjct: 295 RALFVKNLNWLPD---YNIPKRGLAVDARLRSSGATVRATITSDGDGYGTVVLEEDCVVS 351

Query: 361 SGQACVFYTSDSNEARVLGGGII 383
            GQACV Y    ++ R+LGGG I
Sbjct: 352 PGQACVLY----DKERLLGGGWI 370


>gi|85375520|ref|YP_459582.1| tRNA-specific 2-thiouridylase MnmA [Erythrobacter litoralis
           HTCC2594]
 gi|122543295|sp|Q2N6A6|MNMA_ERYLH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|84788603|gb|ABC64785.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erythrobacter litoralis HTCC2594]
          Length = 384

 Score =  333 bits (854), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 184/383 (48%), Positives = 238/383 (62%), Gaps = 21/383 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
            DL +   + R+VVAMSGGVDSSVVAAL    G +VIG+TLQLY+   A+ RKG+CCAG 
Sbjct: 17  FDLPRPAAESRIVVAMSGGVDSSVVAALAHASGAEVIGITLQLYDYGAATGRKGACCAGD 76

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V D + ++HYVFD+E  FR  V+  FA  Y +G TP+PC+ CN   KF+DLL 
Sbjct: 77  DIQDARAVADRLGIAHYVFDHESAFREDVVEQFADDYLSGRTPVPCIRCNMGPKFTDLLR 136

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R+LGAD LATGHY+R     G+ G     + R +D  RDQSYFL+ TT+ QL  LRFP
Sbjct: 137 MARELGADCLATGHYVRR--VAGEHGPE---LHRALDPARDQSYFLYGTTETQLDFLRFP 191

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NG 250
           LGD+ K +VR+LA   GL  A K DSQDICFV  G Y  +VK +       GDIVH   G
Sbjct: 192 LGDLPKTAVRELAEAAGLRNAAKPDSQDICFVPDGDYAKIVKTMRPEGGTPGDIVHAQTG 251

Query: 251 QILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           ++LG+H GI++YT+GQRRGL +    EPL+VV LD  +SRV VGP+  L V    + E N
Sbjct: 252 EVLGQHKGIVHYTVGQRRGLEIGGQPEPLYVVGLDAAASRVKVGPKRLLAVQAASVIETN 311

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVY--VDFEKSEVGVASGQACV 366
            +G        +       K+RS   PVP+ +  +  DG    + FE+ E GVA GQA V
Sbjct: 312 RIGP-------LPDVPLTAKVRSLAKPVPITLDGSLGDGATTRITFEQPEFGVAPGQAGV 364

Query: 367 FYTSDSNEARVLGGGIISGSKRS 389
            Y  D    RV+GGG I  ++ +
Sbjct: 365 IYAGD----RVIGGGWIDSTESA 383


>gi|85709728|ref|ZP_01040793.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erythrobacter sp. NAP1]
 gi|85688438|gb|EAQ28442.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erythrobacter sp. NAP1]
          Length = 390

 Score =  332 bits (851), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 186/380 (48%), Positives = 238/380 (62%), Gaps = 20/380 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
            DL +   + R+VVAMSGGVDSSVVAAL    G +VIG+TLQLY+   A+ RKG+CCAG 
Sbjct: 21  FDLPRPASECRIVVAMSGGVDSSVVAALAADTGAEVIGITLQLYDYGAATGRKGACCAGD 80

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V D + ++HYVFD+E  FR  V+  FA  Y AG TP+PC+ CN   KF+DL  
Sbjct: 81  DIADARAVSDRLGIAHYVFDHESAFREDVVEQFADEYLAGRTPVPCIRCNMGPKFTDLFR 140

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R+LGAD LATGHY+R    V  +G     + R  D  RDQSYFL+ATTQ+QL  +RFP
Sbjct: 141 MARELGADCLATGHYVRR---VEAEGGPH--LYRANDPSRDQSYFLYATTQEQLDFIRFP 195

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH-LNG 250
           LG + K  VR+LA   GL  A K DSQDICFV  G Y  +VK++     + G IVH   G
Sbjct: 196 LGGLPKTKVRELAEAAGLRNAAKPDSQDICFVPDGNYAGIVKKLRPEGGVPGAIVHAATG 255

Query: 251 QILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           + LG H GII+YT+GQR+GL +    EPL+V+ LD  S  V VGP+  L V    + E N
Sbjct: 256 ETLGDHKGIIHYTVGQRKGLEIGGQPEPLYVISLDAESREVRVGPKRMLGVESAEVIETN 315

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDG--VYVDFEKSEVGVASGQACV 366
            +G      A+ DG +   K+RS   PVPV ++ +  DG  V + FE+ E GVA GQA V
Sbjct: 316 RIG------AIPDGAQLTAKVRSLAKPVPVTLEGDLGDGATVTLHFEQPEFGVAPGQAAV 369

Query: 367 FYTSDSNEARVLGGGIISGS 386
            Y  D    RV+GGG I+ +
Sbjct: 370 IYADD----RVIGGGWINAT 385


>gi|58616948|ref|YP_196147.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia ruminantium str. Gardel]
 gi|75432674|sp|Q5FFJ0|MNMA_EHRRG RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|58416560|emb|CAI27673.1| Probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia ruminantium str. Gardel]
          Length = 370

 Score =  332 bits (851), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 170/377 (45%), Positives = 237/377 (62%), Gaps = 14/377 (3%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           +++ L  +K P     VVAMSGGVDSSV AALL + GY VIG+TLQLYN+ K S  KG+C
Sbjct: 6   KIDLLVKNKPPTSTTAVVAMSGGVDSSVAAALLHKLGYKVIGITLQLYNNNKNSNTKGAC 65

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           C   D  DA++V  ++   HY  +YE+ FR  VI  F  +Y  G+TP+PC+ CN+ +KF 
Sbjct: 66  CGSLDTKDAKQVASSMGFPHYTLNYEKVFREEVIEDFIDTYTQGKTPIPCIKCNQVIKFR 125

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DLL+ T+ LGADVL TGHYIR ++   DD      +    D ++DQSYFLFATT +QL  
Sbjct: 126 DLLNATKSLGADVLVTGHYIR-KIEQDDD----IYVYSSKDTKKDQSYFLFATTVEQLRL 180

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLG+  KE +R LA+   L +A+K DSQ+ICFV    Y   +  +      +G+I+ 
Sbjct: 181 LRFPLGNFHKEDIRKLAKYFNLQVANKPDSQNICFVTD-TYKKTIAELRPHTIKKGNIID 239

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           +NG IL +HNGI+N+TIGQR+G+G++   PL+V+ L+ +++ V VGP+ +L  +++Y+RE
Sbjct: 240 INGNILSQHNGIVNFTIGQRKGIGISSKAPLYVIKLNPDTNEVTVGPKSALLQNKLYIRE 299

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACV 366
           INWL     E    +G    VK+RSS    P  +   N++   +  + S   V  GQACV
Sbjct: 300 INWLAK---EKIPHNGLNVKVKLRSSHSGSPATIFPNNNNTATILLQDSYCTVTPGQACV 356

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D    R+LGGG I
Sbjct: 357 IYDHD----RMLGGGWI 369


>gi|87198069|ref|YP_495326.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Novosphingobium aromaticivorans DSM 12444]
 gi|123487802|sp|Q2G2Z1|MNMA_NOVAD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|87133750|gb|ABD24492.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 384

 Score =  332 bits (851), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 185/382 (48%), Positives = 236/382 (61%), Gaps = 21/382 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
            DLD      R+VVAMSGGVDSSVVA L    G +VIGVTLQLY+   A+ RKG+CCAG 
Sbjct: 14  FDLDGPMSARRIVVAMSGGVDSSVVAGLAAATGAEVIGVTLQLYDYGAATGRKGACCAGD 73

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V D + ++HYVFD+E  FR  V+  FA  Y +G TP+PCV CN   KF+DLL+
Sbjct: 74  DIRDARAVADRLGIAHYVFDHESSFREEVVERFADDYLSGRTPIPCVRCNMGPKFTDLLA 133

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R+LGAD LATGHY+R    +G  G     + R +D  RDQSYFL+ TT++QL  LRFP
Sbjct: 134 MARELGADCLATGHYVRR--VMGPAGPE---LHRAVDPARDQSYFLYGTTEEQLAFLRFP 188

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH-LNG 250
           LG + K   R +A E+GL +A K DSQDICFV  G Y  VV+ +       G+IVH   G
Sbjct: 189 LGGLPKTETRLIAEELGLAVAAKPDSQDICFVPDGDYARVVRSVRPEGDAPGEIVHAATG 248

Query: 251 QILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           ++LG H GII+YT+GQRRGL +    EPL+V+ LD  S RV+VGPR  L V    + E N
Sbjct: 249 EVLGTHRGIIHYTVGQRRGLEIGGQPEPLYVIGLDAPSRRVLVGPRPMLAVASATIVETN 308

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN---DDGVYVDFEKSEVGVASGQACV 366
            +G     DA +       K+RS   PVPV ++ +        + F + E GVA GQA V
Sbjct: 309 RIGP--LPDAPLT-----AKVRSLARPVPVVLEGSFGEGASARIRFSQPEYGVAPGQAAV 361

Query: 367 FYTSDSNEARVLGGGIISGSKR 388
            Y  D    RV+GGG I  ++R
Sbjct: 362 LYAGD----RVVGGGWIDSTER 379


>gi|205822510|sp|Q5FR73|MNMA_GLUOX RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 361

 Score =  331 bits (849), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 248/373 (66%), Gaps = 25/373 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSSVVAALLKR G++VIG TLQLY+  +A+K  G+CCAG+D+ DAR V 
Sbjct: 1   MRILVAMSGGVDSSVVAALLKRQGHEVIGATLQLYDHGQAAK-PGACCAGRDIMDARAVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D +   HYV D E RFR++V+  FA +YA GETP+PCV CN+ VKF+DLL + R LG + 
Sbjct: 60  DRLGFPHYVIDAESRFRDSVVESFADAYARGETPVPCVACNQGVKFTDLLGMARDLGCEA 119

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY+R     G +G     M RP+D ERDQ++FLFATT+ QL  LRFPLG+M  K  
Sbjct: 120 MATGHYVRR--VEGPEGAE---MHRPVDAERDQTWFLFATTKDQLDYLRFPLGEMPDKAH 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR LA+E+GL+IA K DSQDICFV  G Y ++V+++   +  EG+IV  +G++LGRH G+
Sbjct: 175 VRALAQELGLEIAAKPDSQDICFVPSGSYAELVEKLRPEVRGEGEIVDEDGRVLGRHEGV 234

Query: 260 INYTIGQRRGLG---VAMGEPLFVVYLDKNSSRVIVGPR----ESLEVHRIYLREINWLG 312
             YT+GQ + LG    A GE   V  +D    R++VGPR    E+     + LR++NWL 
Sbjct: 235 ARYTVGQSKRLGDIHTATGERQMVTRIDVPKRRIVVGPRVQVSEADSRRSVRLRDMNWL- 293

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGV-ASGQACVFYTSD 371
                DA  +G +C V+IR+ +      V+  ++G  +  E +E  + A GQACV Y   
Sbjct: 294 ----IDAPAEGVRCGVQIRAREKLREALVKPLENGGAL-VELTEAAMPAPGQACVLY--- 345

Query: 372 SNEARVLGGGIIS 384
            + +RVLGGG I+
Sbjct: 346 -DGSRVLGGGFIT 357


>gi|88608438|ref|YP_506353.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Neorickettsia sennetsu str. Miyayama]
 gi|123491921|sp|Q2GDU3|MNMA_NEOSM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|88600607|gb|ABD46075.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Neorickettsia sennetsu str. Miyayama]
          Length = 371

 Score =  330 bits (847), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 171/366 (46%), Positives = 240/366 (65%), Gaps = 15/366 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK-RKGSCCAGQDVYDARR 78
           D++V+VAMSGGVDSS VAA L R GY VIGVTLQL+N+  +++  + +CCAG D++DA+R
Sbjct: 18  DVKVMVAMSGGVDSSTVAAYLHRVGYKVIGVTLQLHNNFTSTQTNRKTCCAGSDIFDAKR 77

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V       HYV + EE FR  VI  FA SY  GETP+PCV CN+TVKF DL+ + + L  
Sbjct: 78  VAAQFGFLHYVVNMEETFRKEVIENFAESYLKGETPVPCVKCNQTVKFRDLMKIAKSLSV 137

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY+R RL   +  +    + + +D  +DQSYFLF TT++QL  LRFPLG++KK 
Sbjct: 138 DALATGHYVR-RLTTTNGVE----LHKGIDPSKDQSYFLFNTTREQLEFLRFPLGNLKKS 192

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             RDLAR++ +DI++K +SQDICFV    Y DV+K+        G I+  +G++LG HNG
Sbjct: 193 ETRDLARKLSVDISEKPESQDICFVNGKSYADVIKKFRPDAQRPGKILSTDGEVLGTHNG 252

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
            I+YTIGQR GL ++   PL+VV +D  ++ +IVG R+ L+   +Y++E+NWL       
Sbjct: 253 TIHYTIGQRHGLQLSAPIPLYVVKIDAQNNIIIVGTRDKLQQRSLYVKEVNWLD----RK 308

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDF-EKSEVGVASGQACVFYTSDSNEARV 377
            +  G +C VK+RS  D V  ++  N + + V   E+ +  +A GQACV Y    + ++V
Sbjct: 309 ELTAGLECEVKLRSGADTVKGYLYPNGELLKVSLAEEPKCAIAPGQACVMY----HGSKV 364

Query: 378 LGGGII 383
           LGGG I
Sbjct: 365 LGGGWI 370


>gi|149185324|ref|ZP_01863641.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erythrobacter sp. SD-21]
 gi|148831435|gb|EDL49869.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Erythrobacter sp. SD-21]
          Length = 383

 Score =  329 bits (843), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 235/384 (61%), Gaps = 21/384 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
            DL+K   + R+VVAMSGGVDSSVVAAL  + G +VIG+TLQLY+   A+ RKG+CCAG 
Sbjct: 16  FDLEKPASESRIVVAMSGGVDSSVVAALAAKSGAEVIGITLQLYDYGAATGRKGACCAGD 75

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D+ DAR V D + ++HYV D+E  FR  V+  FA  Y AG TP+PC+ CN   KF+DL +
Sbjct: 76  DIADARAVADRLGIAHYVSDHESAFREEVVETFADEYLAGRTPVPCIRCNMGPKFTDLFA 135

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
           + R+LGAD LATGHY++ RL +G  G     + R  D  RDQSYFL+ATT+ QL  LRFP
Sbjct: 136 MARELGADCLATGHYVQ-RL-MGPAGPE---LHRANDPARDQSYFLYATTEDQLNFLRFP 190

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH-LNG 250
           LG + K  VR+LA   GL  A K DSQDICFV  G Y  +VK++    A  G IVH   G
Sbjct: 191 LGGLPKAQVRELAEAAGLRNAAKPDSQDICFVPDGDYAKIVKKMRPEGAAPGAIVHAATG 250

Query: 251 QILGRHNGIINYTIGQRRGLGV-AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           + LG H G+++YT+GQRRGL +    EPL+VV +D + ++V VGP+  L V   +L E N
Sbjct: 251 EELGTHKGVVHYTVGQRRGLEIGGQPEPLYVVGIDADQAQVKVGPKRMLAVSAAHLVETN 310

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ---RNDDGVYVDFEKSEVGVASGQACV 366
            +G        +       K+RS   PVP+ +           + FE  E GVA GQA V
Sbjct: 311 RIGP-------LPDVPLTAKVRSLAKPVPITLDGPLGEGAATTLRFETPEFGVAPGQAAV 363

Query: 367 FYTSDSNEARVLGGGIISGSKRSD 390
            Y  D    RVLGGG I  + R D
Sbjct: 364 IYAGD----RVLGGGWIDSTTRCD 383


>gi|57238956|ref|YP_180092.1| tRNA-specific 2-thiouridylase MnmA [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578889|ref|YP_197101.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
 gi|81557340|sp|Q5HBV2|MNMA_EHRRW RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|57161035|emb|CAH57941.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58417515|emb|CAI26719.1| Probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia ruminantium str. Welgevonden]
          Length = 370

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 169/377 (44%), Positives = 236/377 (62%), Gaps = 14/377 (3%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           +++ L  +K P     VVAMSGGVDSSV AALL + GY VIG+TLQLYN+   S  KG+C
Sbjct: 6   KIDLLVKNKPPTSTTAVVAMSGGVDSSVAAALLHKLGYKVIGITLQLYNNNNNSNTKGAC 65

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           C   D  DA++V  ++   HY  +YE+ FR  VI  F  +Y  G+TP+PC+ CN+ +KF 
Sbjct: 66  CGSLDTQDAKQVASSMGFPHYTLNYEKVFREEVIEDFIDTYTQGKTPIPCIKCNQVIKFR 125

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DLL+ T+ LGADVL TGHYIR ++   DD      +    D ++DQSYFLFATT +QL  
Sbjct: 126 DLLNATKSLGADVLVTGHYIR-KIEQDDD----IYVYSSKDTKKDQSYFLFATTVEQLRL 180

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLG+  KE +R LA+   L +A+K DSQ+ICFV    Y   +  +      +G+I+ 
Sbjct: 181 LRFPLGNFHKEDIRKLAKYFNLQVANKPDSQNICFVTD-TYKKTIAELRPHTIKKGNIID 239

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           +NG IL +HNGI+N+TIGQR+G+G++   PL+V+ L+ +++ V VGP+ +L  +++Y+RE
Sbjct: 240 INGNILSQHNGIVNFTIGQRKGIGISSKAPLYVIKLNPDTNEVTVGPKSALLQNKLYIRE 299

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACV 366
           INWL     E    +G    VK+RSS    P  +   N++   +  + S   V  GQACV
Sbjct: 300 INWLAK---EKIPHNGLNVKVKLRSSHSGSPATIFPNNNNTATILLQDSYCTVTPGQACV 356

Query: 367 FYTSDSNEARVLGGGII 383
            Y  D    R+LGGG I
Sbjct: 357 IYDHD----RMLGGGWI 369


>gi|256092379|ref|XP_002581921.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methy lt ransferase
           [Schistosoma mansoni]
 gi|238668268|emb|CAZ38161.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methy lt
           ransferase,putative [Schistosoma mansoni]
          Length = 313

 Score =  323 bits (827), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 158/299 (52%), Positives = 209/299 (69%), Gaps = 8/299 (2%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQD 72
           DK P   + VVAMSGGVDSSV A LL R GY VIGVTLQLY +     +++KG CCAGQD
Sbjct: 13  DKVPHQTKAVVAMSGGVDSSVAAVLLHRLGYQVIGVTLQLYGADGNSNTRKKGVCCAGQD 72

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           +YDA+RV +     HY+ +YEE F+  VI  FA +Y  G+TP+PC+ CN+TVKF DLL V
Sbjct: 73  IYDAKRVAEGTGFPHYILNYEEIFKKEVIESFAQTYIQGKTPIPCIKCNQTVKFRDLLQV 132

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
           TR LGADVL TGHY+R RL    + K    +CR +D  +DQSYFLFATT++QL  LRFPL
Sbjct: 133 TRNLGADVLITGHYVR-RLEKNGEVK----LCRGIDKSKDQSYFLFATTKEQLKLLRFPL 187

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G   K +VR LAR   L I++K DSQDICFV +  Y   + ++      +G IV +NG++
Sbjct: 188 GGFYKCNVRKLARYFSLPISEKPDSQDICFVSEN-YSKTIAKLAPQSIQKGKIVDVNGKV 246

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           LG HNGI+N+T+GQR+GLG+A  EPL+VV ++  ++ ++VGP  +L   +I ++E+NWL
Sbjct: 247 LGEHNGIVNFTVGQRKGLGIAYSEPLYVVRINTKNNEIVVGPVNALMQRKILVKELNWL 305


>gi|58039815|ref|YP_191779.1| tRNA-specific 2-thiouridylase MnmA [Gluconobacter oxydans 621H]
 gi|58002229|gb|AAW61123.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Gluconobacter oxydans 621H]
          Length = 355

 Score =  322 bits (826), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 179/367 (48%), Positives = 242/367 (65%), Gaps = 25/367 (6%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSSVVAALLKR G++VIG TLQLY+  +A+K  G+CCAG+D+ DAR V D +   
Sbjct: 1   MSGGVDSSVVAALLKRQGHEVIGATLQLYDHGQAAK-PGACCAGRDIMDARAVADRLGFP 59

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HYV D E RFR++V+  FA +YA GETP+PCV CN+ VKF+DLL + R LG + +ATGHY
Sbjct: 60  HYVIDAESRFRDSVVESFADAYARGETPVPCVACNQGVKFTDLLGMARDLGCEAMATGHY 119

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KESVRDLAR 205
           +R     G +G     M RP+D ERDQ++FLFATT+ QL  LRFPLG+M  K  VR LA+
Sbjct: 120 VRR--VEGPEGAE---MHRPVDAERDQTWFLFATTKDQLDYLRFPLGEMPDKAHVRALAQ 174

Query: 206 EMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIG 265
           E+GL+IA K DSQDICFV  G Y ++V+++   +  EG+IV  +G++LGRH G+  YT+G
Sbjct: 175 ELGLEIAAKPDSQDICFVPSGSYAELVEKLRPEVRGEGEIVDEDGRVLGRHEGVARYTVG 234

Query: 266 QRRGLG---VAMGEPLFVVYLDKNSSRVIVGPR----ESLEVHRIYLREINWLGDGLFED 318
           Q + LG    A GE   V  +D    R++VGPR    E+     + LR++NWL      D
Sbjct: 235 QSKRLGDIHTATGERQMVTRIDVPKRRIVVGPRVQVSEADSRRSVRLRDMNWL-----ID 289

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGV-ASGQACVFYTSDSNEARV 377
           A  +G +C V+IR+ +      V+  ++G  +  E +E  + A GQACV Y    + +RV
Sbjct: 290 APAEGVRCGVQIRAREKLREALVKPLENGGAL-VELTEAAMPAPGQACVLY----DGSRV 344

Query: 378 LGGGIIS 384
           LGGG I+
Sbjct: 345 LGGGFIT 351


>gi|326403958|ref|YP_004284040.1| tRNA-specific 2-thiouridylase MnmA [Acidiphilium multivorum AIU301]
 gi|325050820|dbj|BAJ81158.1| tRNA-specific 2-thiouridylase MnmA [Acidiphilium multivorum AIU301]
          Length = 345

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 177/364 (48%), Positives = 226/364 (62%), Gaps = 21/364 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MRVVVAMSGGVDSSVVA L+   G++VIGVTLQLY+   A+ RKG+CCAGQD++DAR V 
Sbjct: 1   MRVVVAMSGGVDSSVVAGLMHEAGHEVIGVTLQLYDHGAATSRKGACCAGQDIHDARNVA 60

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + ++HYV D E  FR AVI  FA SYA G TP+PCV CN+ +KF DLL + R LGA+ 
Sbjct: 61  DRLGIAHYVIDAEAAFRAAVIGDFAESYAEGRTPVPCVRCNQHLKFGDLLGLARDLGAEA 120

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           LATGHY+R      +DG     + R +D  RDQS+FLFATT+ QL   RFPLG M  K++
Sbjct: 121 LATGHYVRR-----EDGPEGAELHRAVDARRDQSWFLFATTRDQLAFSRFPLGTMPDKDA 175

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A  M L +A+K DSQDICFV  G Y D+V ++    A  G+IV  +G +L RH GI
Sbjct: 176 VRAEAARMNLPVAEKPDSQDICFVPSGTYADIVAKLRPDAAAPGEIVTEDGAVLDRHQGI 235

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YT+GQ + LG A G    V  +D    R++VGPR +     + + E NWL      D 
Sbjct: 236 ARYTVGQAKRLGAASGH--VVTRIDAARRRIVVGPRGA-GGREVRIAEPNWL-----IDP 287

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               F+  VK+R+ + P P  +    + V +D   +    A GQACV Y     E+RVLG
Sbjct: 288 PAAPFRASVKLRAGETPHPAEIDIARNLVTLD---TPALAAPGQACVVY----RESRVLG 340

Query: 380 GGII 383
           GG I
Sbjct: 341 GGFI 344


>gi|148260759|ref|YP_001234886.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidiphilium cryptum JF-5]
 gi|205811039|sp|A5FZD5|MNMA_ACICJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146402440|gb|ABQ30967.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidiphilium cryptum JF-5]
          Length = 345

 Score =  320 bits (819), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 177/364 (48%), Positives = 226/364 (62%), Gaps = 21/364 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MRVVVAMSGGVDSSVVA L+   G++VIGVTLQLY+   A+ RKG+CCAGQD++DAR V 
Sbjct: 1   MRVVVAMSGGVDSSVVAGLMHEAGHEVIGVTLQLYDHGAATGRKGACCAGQDIHDARNVA 60

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + ++HYV D E  FR AVI  FA SYA G TP+PCV CN+ +KF DLL + R LGA+ 
Sbjct: 61  DRLGIAHYVIDAEAAFRAAVIGDFAESYAEGRTPVPCVRCNQHLKFGDLLGLARDLGAEA 120

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           LATGHY+R      +DG     + R +D  RDQS+FLFATT+ QL   RFPLG M  K++
Sbjct: 121 LATGHYVRR-----EDGPEGAELHRAVDARRDQSWFLFATTRDQLAFSRFPLGTMPDKDA 175

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A  M L +A+K DSQDICFV  G Y D+V ++    A  G+IV  +G +L RH GI
Sbjct: 176 VRAEAARMNLPVAEKPDSQDICFVPSGTYADIVAKLRPDAAAPGEIVTEDGAVLDRHQGI 235

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YT+GQ + LG A G    V  +D    R++VGPR +     + + E NWL      D 
Sbjct: 236 ARYTVGQAKRLGAASGH--VVTRIDAARRRIVVGPRGA-GGREVRIAEPNWL-----IDP 287

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               F+  VK+R+ + P P  +    + V +D   +    A GQACV Y     E+RVLG
Sbjct: 288 PAAPFRASVKLRAGETPHPAEIDIARNLVTLD---TPALAAPGQACVVY----RESRVLG 340

Query: 380 GGII 383
           GG I
Sbjct: 341 GGFI 344


>gi|73666857|ref|YP_302873.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyl transferase
           [Ehrlichia canis str. Jake]
 gi|123615064|sp|Q3YSN0|MNMA_EHRCJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|72393998|gb|AAZ68275.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia canis str. Jake]
          Length = 367

 Score =  319 bits (818), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 170/382 (44%), Positives = 231/382 (60%), Gaps = 27/382 (7%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           +++ L  +K+P    VVVAMSGGVDSSV AALL + GY VIG+TLQLYN+      KG C
Sbjct: 6   KIDPLVKNKSPSSTTVVVAMSGGVDSSVAAALLHKLGYKVIGITLQLYNNTSG---KGGC 62

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           C   D  DA++V  ++   HY  +YE+ FR  VI  F  +Y  G+TP+PCV CN+ +KF 
Sbjct: 63  CGSTDTQDAKQVASSMGFPHYTLNYEKAFREEVIENFIDTYTQGKTPIPCVKCNQVIKFR 122

Query: 128 DLLSVTRQLGADVLATGHYIRS-----RLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQ 182
           DLL+ T+ LGADVL TGHYIR       +YV              D ++DQSYFLFATT 
Sbjct: 123 DLLNTTKSLGADVLVTGHYIRKVEQDDEIYVYSS----------KDTKKDQSYFLFATTI 172

Query: 183 QQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE 242
           +QL  LRFPLG+  K+++R LA+   L +A K DSQ+ICFV    Y + +  +      +
Sbjct: 173 EQLKFLRFPLGNFHKDNIRKLAKYFNLSVAAKPDSQNICFVTD-TYKNTIAHLRPQTVKK 231

Query: 243 GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHR 302
           G I+  NG ILG HNGI+N+TIGQRRG+G+A  EPL+V  L+ +++ V VGP+ +L  ++
Sbjct: 232 GHIIDTNGNILGEHNGIVNFTIGQRRGIGLASKEPLYVTKLNPDTNEVTVGPKSALLQNK 291

Query: 303 IYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVAS 361
           +++ +INWL   L +     G    VK+RSS       +  ND +   V  + +   V  
Sbjct: 292 LHIEDINWL---LKDKIPYSGLSVKVKLRSSHSGSTAIIYPNDMNKATVILQDTYCTVTP 348

Query: 362 GQACVFYTSDSNEARVLGGGII 383
           GQACV Y  D    R+LGGG I
Sbjct: 349 GQACVVYDGD----RMLGGGWI 366


>gi|88607883|ref|YP_505483.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaplasma phagocytophilum HZ]
 gi|123494742|sp|Q2GJG8|MNMA_ANAPZ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|88598946|gb|ABD44416.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaplasma phagocytophilum HZ]
          Length = 378

 Score =  318 bits (816), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 175/377 (46%), Positives = 241/377 (63%), Gaps = 15/377 (3%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           +L+SL   K P++  VVVAMSGGVDSSVVA LL + GY VIG T+QLY+S  AS  K SC
Sbjct: 6   QLDSLVPGKRPEETTVVVAMSGGVDSSVVAVLLHKMGYKVIGATMQLYSSPNASSGK-SC 64

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           C   D+YDA++V  +    HYV +YEE FR  VI  F +SY AGETP+PC+ CN+TVKF 
Sbjct: 65  CGNADIYDAKKVAASFGFPHYVLNYEEVFRKEVIEDFVNSYKAGETPIPCIKCNQTVKFR 124

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           D+L + R +G DV+ATGHY+R RL V  +G+ +  +    D  +DQSYFLF+ T +QL  
Sbjct: 125 DMLKMARTIGGDVVATGHYVR-RLEV--EGELQ--IWSGKDKNKDQSYFLFSMTLEQLKF 179

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           +RFPLG++ K  VR +A+ + +++ADK DSQDICFV +  Y   +  ++     +G I H
Sbjct: 180 VRFPLGNLVKGDVRKIAQYLNIEVADKPDSQDICFVPK-NYKKTLASLDPSAIKKGKIHH 238

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           ++G +LG H+GI N+T+GQR+GLG+A   PL+VV LD   + VIVGP  SL   +++LR+
Sbjct: 239 IDGSVLGEHDGIANFTVGQRKGLGIAYPYPLYVVALDPVKNTVIVGPSSSLVKTQLFLRD 298

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACV 366
           +NWL      +    G    V++RSS   V   + R+  DG           V+ GQACV
Sbjct: 299 LNWLSKDQIPE---HGLSASVRLRSSSSAVQATISRSAKDGKGRVVLHEGCVVSPGQACV 355

Query: 367 FYTSDSNEARVLGGGII 383
            Y ++    R+LGGG I
Sbjct: 356 IYDNE----RLLGGGWI 368


>gi|218506374|ref|ZP_03504252.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rhizobium etli Brasil 5]
          Length = 229

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 172/219 (78%)

Query: 94  ERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYV 153
           +RFR  VI PFA SY AGETP+PCV CN+TVKF+DLL+  ++LGAD LATGHYIRSR   
Sbjct: 11  KRFRETVINPFAESYVAGETPIPCVSCNQTVKFADLLATAKELGADALATGHYIRSRPNP 70

Query: 154 GDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIAD 213
             +   RR + RP D +RDQSYFLFATTQ+Q+  LRFPLG + K   R LA EMGL +A 
Sbjct: 71  SPEHPGRRALFRPADADRDQSYFLFATTQEQIDYLRFPLGGLPKAETRRLAEEMGLVVAK 130

Query: 214 KSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVA 273
           K+DSQDICFV QGKY D++ ++    AL G+IVHL+G++LG H GI+++TIGQRRG+G+A
Sbjct: 131 KADSQDICFVPQGKYSDIITKLKPNAALAGEIVHLDGRVLGSHEGILHFTIGQRRGIGIA 190

Query: 274 MGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
            GEPL+VVYLD  S RVIVGP+E+LE HR+YLR++NWLG
Sbjct: 191 TGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDVNWLG 229


>gi|68171265|ref|ZP_00544667.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88657652|ref|YP_507667.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia chaffeensis str. Arkansas]
 gi|123492948|sp|Q2GFW6|MNMA_EHRCR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|67999312|gb|EAM85959.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia chaffeensis str. Sapulpa]
 gi|88599109|gb|ABD44578.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ehrlichia chaffeensis str. Arkansas]
          Length = 367

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 164/378 (43%), Positives = 235/378 (62%), Gaps = 19/378 (5%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC 67
           +++ L  +K+P     VVAMSGGVDSSV AALL + GY VIG+TLQLYN+      KG+C
Sbjct: 6   KIDPLVKNKSPSATTAVVAMSGGVDSSVAAALLHKLGYKVIGITLQLYNNTTG---KGAC 62

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           C   D  DA++V   +   HY  +YE+ F+  VI  F  +Y  G+TP+PC+ CN+ VKF 
Sbjct: 63  CGSLDTQDAKQVASIMGFPHYTLNYEKVFKEEVIDDFIDTYMQGKTPIPCIKCNQVVKFR 122

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
           DLL+ T+ L AD+L TGHYIR ++   DD      +    D ++DQSYFLFATT +QL  
Sbjct: 123 DLLNATKSLDADILVTGHYIR-KIEQDDD----IYVYSSKDTKKDQSYFLFATTIEQLKF 177

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           LRFPLG+  K+++R LA    L IA+K DSQ+ICFV    Y + + ++      +G+I+ 
Sbjct: 178 LRFPLGNFHKDNIRKLAEHFNLPIANKPDSQNICFVAD-TYKNTIAQLRPNAIKKGNIID 236

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            +G ILG+H+GI+N+TIGQRRG+G++  EPL+V+ L+ +++ V VG + +L  +++++ +
Sbjct: 237 TSGNILGQHDGIVNFTIGQRRGIGLSSKEPLYVIKLNPDTNEVTVGHKSALLQNKLHIEK 296

Query: 308 INWLGDGLFEDAVVD-GFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
           INW    L +D +   G    VK+RSS       V  ND+    V  + +   V  GQAC
Sbjct: 297 INW----LVKDKIPHTGLNVKVKLRSSHSGSTAIVYPNDNNKATVLLQDTYCTVTPGQAC 352

Query: 366 VFYTSDSNEARVLGGGII 383
           V Y  D    R+LGGG I
Sbjct: 353 VIYDGD----RMLGGGWI 366


>gi|117924260|ref|YP_864877.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Magnetococcus sp. MC-1]
 gi|205816907|sp|A0L678|MNMA_MAGSM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|117608016|gb|ABK43471.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Magnetococcus sp. MC-1]
          Length = 358

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 163/368 (44%), Positives = 218/368 (59%), Gaps = 16/368 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDA 76
           +  RV VAMSGGVDSS  AALL   GY+VIG+T+QL++   + K  GS  CCA  D+YDA
Sbjct: 3   QPQRVAVAMSGGVDSSATAALLVEQGYEVIGLTMQLWD-HSSPKVAGSRSCCALDDLYDA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           R+V  T+ + +YV +YE  FR AV+  F  +YAAG+TP PCV CN+ +KF  LL     L
Sbjct: 62  RQVAQTLGIPYYVVNYEADFRQAVVDDFIQTYAAGQTPNPCVRCNQILKFDLLLKKALAL 121

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD LATGHY   R    +D +    + +  D  +DQSYFLF TT  QL  +RFPLG+M 
Sbjct: 122 GADFLATGHYAIRR----EDAQGVPQLWQGSDPAKDQSYFLFTTTMAQLAHVRFPLGEMD 177

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+  R LA+  GL ++ K +SQD+CFV  G Y     +    +   G IV   G  LG+H
Sbjct: 178 KQQTRQLAQRFGLHLSTKQESQDVCFVPDGDYSAFFAKQAPHLLTPGAIVDQQGHSLGQH 237

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            G+  YT+GQR+GLG+A   PL+V+ LD   ++VIVGP E+L   ++ L  +NWL     
Sbjct: 238 KGLGCYTVGQRKGLGIAHPTPLYVLALDAPHNQVIVGPAEALYQQQLTLHHVNWLE---- 293

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
                + F    KIR +  PV   V+   D G  + F + +  +  GQACVFY    + A
Sbjct: 294 PTPPTEPFASMAKIRYAAPPVEARVEPLPDGGAQIYFNQPQRAITPGQACVFY----DGA 349

Query: 376 RVLGGGII 383
           RV+GGG I
Sbjct: 350 RVVGGGWI 357


>gi|299138824|ref|ZP_07032001.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidobacterium sp. MP5ACTX8]
 gi|298598978|gb|EFI55139.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidobacterium sp. MP5ACTX8]
          Length = 375

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 155/385 (40%), Positives = 226/385 (58%), Gaps = 24/385 (6%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR-------KGSCCAG 70
           P +  + VAMSGGVDSS VAALL  +G D+IG+TLQL+N R+ + R       +G CC+ 
Sbjct: 2   PLNNTIAVAMSGGVDSSAVAALLHAEGRDLIGLTLQLWNQRRLAGREGMPETVQGRCCSI 61

Query: 71  QDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL 130
            DVYDARRV + I + +Y+ + +ERF N V+ PF   Y AG TP+PC  CN  +KF  LL
Sbjct: 62  DDVYDARRVAEQIGIPYYLVNAQERFENEVVRPFVDEYLAGRTPIPCTLCNNHLKFDQLL 121

Query: 131 SVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRF 190
              RQ+GAD +ATGHY R+     D+ + R ++ RP D  +DQ+YFLF  TQ QL    F
Sbjct: 122 LTARQIGADRIATGHYARNHY---DEARERWVLSRPADKSKDQTYFLFGLTQDQLSRTLF 178

Query: 191 PLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRI--NAGIAL---EGDI 245
           PLG+M+K +VR +A + GL++A K DSQ+ICF+  G Y   +K      G  L    G++
Sbjct: 179 PLGEMQKPAVRSMAADHGLELAQKPDSQEICFIPGGSYSQFLKAYLDEQGRELPDSSGEL 238

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
           V  +G++LG H GI  +T+GQR+GLG++  +PL+V+ +  +S  V VG  + L    +  
Sbjct: 239 VSASGEVLGHHEGIHGFTVGQRKGLGLSSPQPLYVLNIHPDSHAVQVGTDDQLLSRTLIA 298

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQA 364
             +NW+     ++ +    +  +KIR   +P P  ++    D V   F++ +  +  GQ+
Sbjct: 299 DRLNWVSIPEPKEEI----RVTIKIRHRHEPAPATLRVTAFDRVEATFDEPQRAITPGQS 354

Query: 365 CVFYTSDSNEARVLGGGIISGSKRS 389
            VFY  D     V GGG I    R+
Sbjct: 355 AVFYQGDE----VAGGGWIKAEDRA 375


>gi|322434612|ref|YP_004216824.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidobacterium sp. MP5ACTX9]
 gi|321162339|gb|ADW68044.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidobacterium sp. MP5ACTX9]
          Length = 379

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/389 (40%), Positives = 223/389 (57%), Gaps = 31/389 (7%)

Query: 13  DLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR-------KG 65
           DL + P+   + VAMSGGVDSS VAALL   GYD+IG+TLQL+N R+ +         +G
Sbjct: 3   DLSQIPET--IAVAMSGGVDSSAVAALLHEQGYDLIGLTLQLWNQRRLAGHEGMPESVQG 60

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
            CC+  DVYDARRV + I + +Y+ + +ERF   V+ PF S Y AG TP+PC  CN  +K
Sbjct: 61  RCCSIDDVYDARRVAEKIGIPYYLVNQQERFEADVVKPFVSEYLAGRTPIPCTLCNNHLK 120

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F  LL   RQ+GA  +ATGHY R+R    D+   R I+ RP D  +DQ+YFLF  TQ QL
Sbjct: 121 FDQLLLTARQVGATKIATGHYARNRF---DEATGRWILSRPADRSKDQTYFLFGLTQDQL 177

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRI--NAGIAL-- 241
               FPLG+M+K +VR +A E GLD+A K DSQ+ICF+  G Y   ++      G  L  
Sbjct: 178 AHTLFPLGEMQKPAVRVMATEAGLDVAAKPDSQEICFIPGGDYQTFLRAYLDEQGEELPD 237

Query: 242 -EGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
             G++V  +G+++GRH GI N+T+GQR+GLG+    PL+V+ +  +S +V VG    L  
Sbjct: 238 SSGELVTSSGEVVGRHTGIHNFTVGQRKGLGLTSANPLYVLAIHPDSHQVQVGSDAELMT 297

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVD------FEK 354
             +    +NW+        + +  +   K+R   +P P  +     G   D      F++
Sbjct: 298 RELRANRLNWISI----PEITEPIRVLAKVRHRHEPQPATLSSGGIGPDGDPIAIAIFDE 353

Query: 355 SEVGVASGQACVFYTSDSNEARVLGGGII 383
            +  +  GQA +FY  D     V+GGG I
Sbjct: 354 PQRAITPGQAAIFYREDD----VVGGGWI 378


>gi|308513324|ref|NP_953615.2| tRNA-specific 2-thiouridylase MnmA [Geobacter sulfurreducens PCA]
 gi|81701559|sp|Q74A22|MNMA_GEOSL RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|41152729|gb|AAR35942.2| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sulfurreducens PCA]
 gi|298506604|gb|ADI85327.1| tRNA (5-carboxymethylaminomethyl-2-thio-U34)-thioltransferase
           [Geobacter sulfurreducens KN400]
          Length = 365

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 166/369 (44%), Positives = 215/369 (58%), Gaps = 18/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG----SCCAGQDVYDAR 77
           R+V+AMSGGVDSSV AALLK +G++VIG+++Q+++    +  +G    +CC+  D++DAR
Sbjct: 8   RIVIAMSGGVDSSVAAALLKEEGHEVIGISMQVWDYANFAAPEGEKFDTCCSLDDIHDAR 67

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV + I +  YV ++EE FR  VI  F   Y  G TP PCV CN+ VKF  LL   R+LG
Sbjct: 68  RVAEQIGIPFYVVNFEEEFRRLVIDDFVDEYFRGRTPNPCVRCNQRVKFELLLHKARELG 127

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD LATGHY  +R   G+DG     + R +D  +DQSYFLF  TQ QL    FPLG+M K
Sbjct: 128 ADFLATGHY--ARRVRGEDGLYH--LLRGLDPAKDQSYFLFTLTQDQLARTLFPLGEMTK 183

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
           E VR LA E GL +A+K +SQ+ICFV    Y   ++       + G+IV   G +LGRH 
Sbjct: 184 EQVRRLAAERGLRVAEKGESQEICFVPDDDYVRFLEEERGTGLMAGEIVDRKGNVLGRHG 243

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           G   YT+GQRRGLG+A   PL+VV +D    +VIVGP E L    +   E+ W+     +
Sbjct: 244 GTYRYTVGQRRGLGIAHPTPLYVVGVDAERRQVIVGPAEELLATGLTATEVTWVVPPQGQ 303

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
                  +   KIR    PVP  V  R D    V F + E  V  GQA VFY  D     
Sbjct: 304 TV-----EASCKIRYRHQPVPCTVAVRADGSAEVRFRQPEKSVTPGQAVVFYRDDE---- 354

Query: 377 VLGGGIISG 385
           VLGGG I G
Sbjct: 355 VLGGGWIEG 363


>gi|148263558|ref|YP_001230264.1| tRNA-specific 2-thiouridylase MnmA [Geobacter uraniireducens Rf4]
 gi|205816712|sp|A5GE36|MNMA_GEOUR RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146397058|gb|ABQ25691.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter uraniireducens Rf4]
          Length = 375

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 162/374 (43%), Positives = 224/374 (59%), Gaps = 18/374 (4%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG----SCCAGQ 71
           KN K  RVV+AMSGGVDSSV AALLK +G++VIG+++Q+++  + +  +G    +CC+  
Sbjct: 3   KNNKRKRVVIAMSGGVDSSVAAALLKEEGHEVIGISMQVWDYTRFTAEEGEKFDTCCSLD 62

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D++DARRV + + +  YV ++EE F+N VI  F + Y  G TP PCV CN+ +KF  LL 
Sbjct: 63  DIHDARRVAEQLEIPFYVVNFEEEFQNLVIDDFVNEYLLGRTPNPCVRCNQWIKFELLLK 122

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
             R LGAD++ATGHY R+     D   R R+M + +D  +DQSYFLF  TQ+QL    FP
Sbjct: 123 KARGLGADMIATGHYARTE---QDADGRYRLM-KGVDPAKDQSYFLFTLTQEQLAMTLFP 178

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           LG M K+ VR LA   GL +A+K +SQ+ICFV    Y   ++       L G+IV   G+
Sbjct: 179 LGGMTKQEVRALAAGYGLRVAEKGESQEICFVPDNDYVRFIEEERGKQLLSGNIVDRKGK 238

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           +LG H+G   YT+GQR+GLG+A  EPL+V+ +D     V VGPR++L    +    INW+
Sbjct: 239 VLGVHDGTYRYTVGQRKGLGIAHPEPLYVLGVDAARKEVTVGPRDALYSDGLIATAINWI 298

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTS 370
                E A+    +   KIR    P+P   +   D+   V F + E  V  GQA VFY  
Sbjct: 299 AP-TPETAI----EASCKIRYRHHPIPCRILPLADNRAEVRFTEREKSVTPGQAVVFYDG 353

Query: 371 DSNEARVLGGGIIS 384
           D+    VLGGG I 
Sbjct: 354 DT----VLGGGWIE 363


>gi|296133414|ref|YP_003640661.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermincola sp. JR]
 gi|296031992|gb|ADG82760.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermincola potens JR]
          Length = 358

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 158/367 (43%), Positives = 220/367 (59%), Gaps = 14/367 (3%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           PK  +VVVAMSGGVDSS+ AALL+  GYDVIGVT+Q++ + + ++  G CC+   V DAR
Sbjct: 2   PKS-KVVVAMSGGVDSSLAAALLQEQGYDVIGVTMQIWPAEEQAE--GGCCSLAAVEDAR 58

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV DT+ + +YV ++ + FR  VI  F + Y AG TP PC+ CNR VKF  LL     LG
Sbjct: 59  RVADTLGIPYYVMNFRDLFRKTVIADFCAEYMAGRTPNPCIVCNRKVKFEALLQKALALG 118

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A+ +ATGHY R      D+ +RR +M R +D  +DQ+Y L+  TQ QL     PLG+  K
Sbjct: 119 AEYIATGHYARLSY---DEARRRYLMRRALDRGKDQTYALYNLTQYQLKHTLMPLGNYTK 175

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
              R++A ++GL +A+K DSQ+ICFV    Y   ++         G  + L G +LGRH 
Sbjct: 176 AEAREMAAKLGLRVANKPDSQEICFVTDNNYRRFLEENVDQEIKPGPFLDLEGNVLGRHE 235

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI  YTIGQR+GLG+A+G+P++VV +D   + VI+G  E +    +   + N+    ++ 
Sbjct: 236 GIPFYTIGQRKGLGIALGKPMYVVDIDPERNAVILGSNEDVFARGLISTDNNF----IYI 291

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
             + D  +  VKIR S  P    +  +DDGV V+FEK +  V  GQA VFY  D     V
Sbjct: 292 PELKDPMEVEVKIRYSAQPAKAIIYPHDDGVRVEFEKPQRAVTPGQAAVFYKDDY----V 347

Query: 378 LGGGIIS 384
           +GGG I 
Sbjct: 348 VGGGTIK 354


>gi|322419745|ref|YP_004198968.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M18]
 gi|320126132|gb|ADW13692.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M18]
          Length = 356

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 213/364 (58%), Gaps = 16/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRVC 80
           R+VVAMSGGVDSSV AALLK  G+DVIGV+LQLY   + +   G +CC+  DV DA RV 
Sbjct: 6   RIVVAMSGGVDSSVTAALLKEQGHDVIGVSLQLYERPEQTVSGGKTCCSLTDVMDAARVA 65

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +   V D  ERFR  VI  F + YAAG TP PC  CN  +KF  LL +T    AD+
Sbjct: 66  RRLGIPFQVIDLRERFRELVIDDFITEYAAGRTPNPCARCNERIKFGLLLELTASFDADL 125

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R    +  DG     + + +D  +DQ+YFLF   QQQL    FP+G ++K  V
Sbjct: 126 LATGHYAR----IEADGTGTYQLLKGLDPRKDQTYFLFGMNQQQLARTIFPVGRLEKHEV 181

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R+LA    L +A K +SQ+ICF+    Y   ++  +      G+IV  +G  LG H+GI 
Sbjct: 182 RELAARFNLPVAQKQESQEICFIPDNDYVRFLEE-HGVTPPAGEIVDSSGARLGTHDGIH 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQRRGLG+A  EPL+V  ++ +++RV+VGPRE L+   +   E+ W      +  +
Sbjct: 241 RYTVGQRRGLGIAWKEPLYVTSIETDTARVVVGPREELQRTGLLAEELTWT-----DSPI 295

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
              F+    IR  Q PVP      +DG + V+F+  + GV  GQA V Y +D    RV+G
Sbjct: 296 TGTFRGSCSIRYRQKPVPCSALMREDGRLQVEFDAPQSGVTPGQAVVLYDAD----RVVG 351

Query: 380 GGII 383
           GG I
Sbjct: 352 GGWI 355


>gi|291545182|emb|CBL18291.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus sp. 18P13]
          Length = 359

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 211/366 (57%), Gaps = 15/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR---KASKRKGSCCAGQDVYDARR 78
           +V++ MSGGVDSSV A  L+++GYDV GVTL+L+      +A     +CCA +DV DAR 
Sbjct: 3   KVMIGMSGGVDSSVAALRLQQEGYDVTGVTLKLFGDEDIIQAPDATRTCCALRDVEDARS 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +   H VF++++ FR+ V+ PF  SY  GETP PC+DCNR +KF  +L     LG 
Sbjct: 63  VAYRLGFEHLVFNFKDAFRSHVMQPFCDSYLRGETPNPCIDCNRHIKFDAMLRRAEALGY 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY   R    D    R ++CRP D  +DQ+Y L+  TQ QL    FPLGD++K 
Sbjct: 123 DYIATGHYAVRRQ---DPATGRYLLCRPKDRSKDQTYVLYNLTQHQLAHTLFPLGDLEKA 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A   GL  + K DSQDICFV  G Y   ++         GD +   G  +GRH G
Sbjct: 180 QVRQMAEAAGLVNSHKPDSQDICFVPDGDYAGYIRHATGAEIQPGDFLDTTGNPIGRHRG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           +I+YTIGQR+GLG+++G P +VV  D  S+ V +G    L      +RE+NW+       
Sbjct: 240 LIHYTIGQRKGLGLSLGRPAYVVGKDAASNTVTIGAESDLYTDSFTVRELNWIS----IP 295

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFYTSDSNEARV 377
           A+    +  VK R SQ  VP  ++  +DG     FE  +  V +GQ+ VFY  D+    V
Sbjct: 296 ALTAPMQVTVKTRYSQTEVPCRIEPMEDGTCRAVFEAPQRAVTAGQSAVFYDGDT----V 351

Query: 378 LGGGII 383
           +GGGII
Sbjct: 352 VGGGII 357


>gi|116619734|ref|YP_821890.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Solibacter usitatus
           Ellin6076]
 gi|122255775|sp|Q02BG1|MNMA_SOLUE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|116222896|gb|ABJ81605.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 371

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 154/372 (41%), Positives = 217/372 (58%), Gaps = 18/372 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK------RKGSCCAGQDVYDA 76
           + VAMSGGVDSSVVAA+L R+G  V+G+T+QL+N R+  +        G CC+  DVYDA
Sbjct: 6   IAVAMSGGVDSSVVAAMLVREGRTVVGMTMQLWNQRRLPELAVEGATTGRCCSLDDVYDA 65

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + + + +YV ++EE+F   V+ PF   Y AG TP+PC  CN  +KF   L +   +
Sbjct: 66  RRVAEQVGIPYYVVNFEEQFEEHVVKPFVDEYLAGRTPIPCTLCNNYIKFDRFLEMADSV 125

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GA  +ATGHY R R    D+   R  + R +D  +DQ+YFLF  TQ QL    FPLG++ 
Sbjct: 126 GAYHMATGHYARIR---HDEATGRYQLLRAVDDSKDQTYFLFGLTQAQLARTLFPLGELN 182

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKY--FDVVKRINAGIALE---GDIVHLNGQ 251
           K  VRD+AR M L +A K DSQ+ICFV  G Y  F        G+A+E   G+IV  +G+
Sbjct: 183 KPEVRDMARSMDLAVAAKGDSQEICFVPNGDYAAFMSAYLKEKGVAVEETSGEIVTTDGR 242

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
            LGRH G+  +T+GQR+GLGVA GEPL+V+  +  + +V+VG  + L       +++NW+
Sbjct: 243 TLGRHEGVHRFTVGQRKGLGVATGEPLYVISTNPANHQVVVGGNDDLLRGGFTAKDVNWI 302

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSD 371
                E       +  ++ R +  P  +    + D V V F++++  V  GQ  VFY  D
Sbjct: 303 SIAGVEPGAPVRAQVKIRNRHAAAPARLVATSDRDRVEVVFDEAQRAVTPGQGAVFYAGD 362

Query: 372 SNEARVLGGGII 383
                VLGGG I
Sbjct: 363 ----LVLGGGWI 370


>gi|225873266|ref|YP_002754725.1| (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidobacterium capsulatum ATCC 51196]
 gi|259495822|sp|C1F792|MNMA_ACIC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|225792803|gb|ACO32893.1| (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidobacterium capsulatum ATCC 51196]
          Length = 374

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 157/378 (41%), Positives = 217/378 (57%), Gaps = 28/378 (7%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR-------KGSCCAGQDVYD 75
           V VAMSGGVDSS VAA+L+ +GYD+IG+TLQL+N R+ + +       +G CC+  DVYD
Sbjct: 7   VAVAMSGGVDSSTVAAMLREEGYDLIGLTLQLWNQRRLAGKDGMPEPVQGRCCSIDDVYD 66

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           ARRV +T+ + +Y+ + +ERF + V+ PF S Y  G TP+PC  CN  +KF  LL   RQ
Sbjct: 67  ARRVAETLGIPYYLVNEQERFESDVVRPFVSEYLHGRTPIPCSLCNNHLKFDQLLLRARQ 126

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
            GAD +ATGHY R+     D  + R I+ RP D  +DQ++FLF  TQ+QL    FPLG  
Sbjct: 127 FGADRIATGHYARNEY---DPARGRWILKRPADRSKDQTWFLFGLTQEQLSRTLFPLGGY 183

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRI--NAGIALE---GDIVHLNG 250
            K  VR++A    L +A K DSQ+ICF+  G Y   +       G ++    G++V   G
Sbjct: 184 TKPEVREIAATHKLALAAKPDSQEICFIPNGDYKRFIDAYLDEQGESIPDSAGELVSTTG 243

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           ++LGRH GI N+T+GQR+GLGV    PL+V+ +D  S RV VG    L       R+ NW
Sbjct: 244 EVLGRHAGIHNFTVGQRKGLGVTAPNPLYVLQIDPASHRVTVGSDTELATETFRARDCNW 303

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQ--RNDDGVY---VDFEKSEVGVASGQAC 365
           +        +    +  VKIR   +P    V+  R  DG     + F++ +  V  GQ+ 
Sbjct: 304 ISIA----DLTGERRAQVKIRHRHEPAWATVRPVRGADGTAEAEITFDEPQRAVTPGQSA 359

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  D     V+GGG I
Sbjct: 360 VFYDEDE----VIGGGWI 373


>gi|222055075|ref|YP_002537437.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. FRC-32]
 gi|221564364|gb|ACM20336.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. FRC-32]
          Length = 370

 Score =  281 bits (720), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 161/376 (42%), Positives = 221/376 (58%), Gaps = 18/376 (4%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG----SCCA 69
           ++K     RVV+AMSGGVDSSV AALL+  G++VIG+++Q+++  K +  +G    +CC+
Sbjct: 1   MNKEKSKKRVVIAMSGGVDSSVSAALLQEQGFEVIGISMQVWDYGKFAAAEGEKFDTCCS 60

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
             D++DARRV + + +  YV ++E+ F + VI  F   Y  G TP PCV CN+ +KF  L
Sbjct: 61  LDDIHDARRVAEQLGIPFYVVNFEDEFEDLVIKDFVDEYLKGRTPNPCVRCNQWIKFELL 120

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L   R LGAD +ATGHY R+   + DD  R  ++ + +D  +DQSYFLF  TQ+QL    
Sbjct: 121 LKKARGLGADFIATGHYART---LRDDTGRFHLL-KGVDQTKDQSYFLFTLTQEQLAMTL 176

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
           FPLG+M K  VR LA    L +A+K +SQ+ICFV    Y   ++       L G+IV  +
Sbjct: 177 FPLGEMTKTQVRALAARYNLRVAEKGESQEICFVPDNDYVRFIEEERGKELLSGNIVDRS 236

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G+ILGRH G   YTIGQRRGLG+A  EPL V+ L+  +  V+VGP+++L  H +     N
Sbjct: 237 GKILGRHRGTYRYTIGQRRGLGIAHPEPLHVLELNAETKEVVVGPKDALFSHGLVAANTN 296

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFY 368
           W+      DA +    C  KIR    PV   V+      V V F + E  V  GQA VFY
Sbjct: 297 WINPA--PDAAIVA-TC--KIRYRHQPVSCTVKPLPCSRVEVRFAEREKSVTPGQAVVFY 351

Query: 369 TSDSNEARVLGGGIIS 384
             D+    VLGGG I 
Sbjct: 352 EGDT----VLGGGWIE 363


>gi|78222093|ref|YP_383840.1| tRNA-specific 2-thiouridylase MnmA [Geobacter metallireducens
           GS-15]
 gi|123572471|sp|Q39XA9|MNMA_GEOMG RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|78193348|gb|ABB31115.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter metallireducens GS-15]
          Length = 368

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 162/370 (43%), Positives = 214/370 (57%), Gaps = 18/370 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG----SCCAGQDVYDAR 77
           R+VVAMSGGVDSSV AALLK +G++VIG+++Q+++  K S  +G    +CC+  D++DAR
Sbjct: 8   RIVVAMSGGVDSSVTAALLKEEGHEVIGISMQVWDYSKFSAPEGEKFDTCCSLDDIHDAR 67

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV + I +  YV ++EE F+  VI  F   Y  G TP PCV CN+ VKF  LL   R+LG
Sbjct: 68  RVAEQIGIPFYVVNFEEEFQRLVIDDFVDEYFRGRTPNPCVRCNQRVKFELLLRKARELG 127

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           AD+LATGHY  +R+  G DG     + R  D  +DQSYFLF  TQ+QL  + FPLG M K
Sbjct: 128 ADLLATGHY--ARIERGGDGLFH--LLRGDDPGKDQSYFLFTLTQEQLARVTFPLGGMTK 183

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             VR LA   GL +A+K +SQ+ICFV    Y   ++       L G+IV   G +LG H 
Sbjct: 184 PEVRQLATRFGLRVAEKGESQEICFVPDNDYVRFLEDERGAGQLVGEIVDRAGTVLGHHE 243

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           G   YT+GQRRGLG+A   PL+VV +D    +VIVGP+E L    +   ++ W+      
Sbjct: 244 GTYRYTVGQRRGLGIAHPHPLYVVGVDAERRQVIVGPKEELLAPGLVATDVTWV-----I 298

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
               +  +   KIR    PVP  V     +   V F + E  V  GQA VFY  D     
Sbjct: 299 ALATETLEAACKIRYRHHPVPCTVTVLAGNRAQVRFREPEKSVTPGQAVVFYHGDE---- 354

Query: 377 VLGGGIISGS 386
           VLGGG I  +
Sbjct: 355 VLGGGWIDAA 364


>gi|320108171|ref|YP_004183761.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Terriglobus saanensis SP1PR4]
 gi|319926692|gb|ADV83767.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Terriglobus saanensis SP1PR4]
          Length = 389

 Score =  281 bits (720), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 150/381 (39%), Positives = 214/381 (56%), Gaps = 28/381 (7%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK-------ASKRKGSCCAGQDVYD 75
           + VAMSGGVDSS VAALL+  G+ ++G+TLQL+N R+         + +G CC+  DVYD
Sbjct: 20  IAVAMSGGVDSSAVAALLRSQGHTLVGLTLQLWNQRRLAGHEGMPEQVRGRCCSIDDVYD 79

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           ARRV + + + +YV + +ERF   V+ PF + Y AG TP+PC  CN  +KF  LL   RQ
Sbjct: 80  ARRVAEQLEIPYYVVNQQERFEADVVKPFVAEYLAGRTPIPCTLCNNHLKFDQLLLTARQ 139

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           +GA+ +ATGHY R+     D  + R I+ RP D  +DQ+YFLF  TQ QL    FPLG M
Sbjct: 140 IGAEKIATGHYARNEF---DVARNRWILKRPTDRSKDQTYFLFGLTQPQLARTLFPLGHM 196

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVK-----RINAGIALEGDIVHLNG 250
           +K +VR +A E  L +A K DSQ+ICF+  G Y   +      +  A     G++V   G
Sbjct: 197 EKPAVRAMAEEHDLAVAHKPDSQEICFIPGGDYKAFLAAYLDDQDQAMPDTAGELVDTTG 256

Query: 251 QILGRHNGIINYTIGQRRG----LGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
             +G H GI N+T+GQR+G    L      P +V+ +D  +  V VG  + L V    + 
Sbjct: 257 NTVGHHTGIHNFTVGQRKGVQQNLNAHAASPFYVLGIDATTHNVTVGSDDDLFVRTARID 316

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQAC 365
            +NW+     E  +    +   KIR   +P P  +  N+DG + + F++ +  V  GQ+ 
Sbjct: 317 RLNWISIATLETPL----RVEAKIRHRHEPAPATIAPNEDGTITLTFDEPQRAVTPGQSA 372

Query: 366 VFYTSDSNEARVLGGGIISGS 386
           VFY  D     V+GGG IS +
Sbjct: 373 VFYQDDE----VVGGGWISSN 389


>gi|77919454|ref|YP_357269.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pelobacter carbinolicus DSM 2380]
 gi|123573968|sp|Q3A3F8|MNMA_PELCD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|77545537|gb|ABA89099.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pelobacter carbinolicus DSM 2380]
          Length = 352

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 157/366 (42%), Positives = 216/366 (59%), Gaps = 17/366 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K+  ++VAMSGGVDS+V AALL   G+ V GVT++++++       G       + DAR+
Sbjct: 4   KNKHILVAMSGGVDSTVAAALLLAQGHQVSGVTMRVWDTEPL----GDGREPAHIRDARK 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   + +  +V D  E F   V+ PF   Y +G TP PCV CNR  KFS LL    +LGA
Sbjct: 60  VAFDLGIPLHVVDLREEFLQQVVTPFCEEYLSGRTPNPCVLCNRVFKFSRLLREADRLGA 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY R    V  DG +  ++ +  + ++DQSYFLF  TQQQL  + FPLG+M KE
Sbjct: 120 DALATGHYAR---IVEHDGLK--VLAKGSNRQKDQSYFLFTLTQQQLQRVVFPLGEMSKE 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR  A  +GL +A K DSQDICF+  G Y   ++R +     EG IVH++G+ LG+H G
Sbjct: 175 EVRTHAERLGLHVAQKGDSQDICFIPDGDYIGFLERQSHATDTEGSIVHVSGKRLGKHRG 234

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
              +T+GQRRGLG+A  EPL+VV +D    +VIVG +E L V R+     NW+   + + 
Sbjct: 235 AYRFTVGQRRGLGIAWPEPLYVVAIDAAKKQVIVGEKEHLHVDRLVTTGTNWI---VAQP 291

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
                 +C ++ R  + P  + V  ND  V V F++ + GV+ GQA VFY  D    RVL
Sbjct: 292 QQPLQARCRIRYRHQEAPCTLVVLGNDR-VEVRFDEPQSGVSPGQAAVFYDED----RVL 346

Query: 379 GGGIIS 384
           GGG I+
Sbjct: 347 GGGWIA 352


>gi|302389695|ref|YP_003825516.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosediminibacter oceani DSM 16646]
 gi|302200323|gb|ADL07893.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosediminibacter oceani DSM 16646]
          Length = 364

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 160/376 (42%), Positives = 221/376 (58%), Gaps = 19/376 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN--SRKASKRKGSCCA 69
           + L+KN    RVVVAMSGGVDSS  A LLK+ GY+VIG+T+Q++   S   + R+G CC+
Sbjct: 1   MSLNKN----RVVVAMSGGVDSSTCAYLLKKQGYEVIGITMQIWQDPSEDYTYREGGCCS 56

Query: 70  GQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDL 129
              VYDAR+V + + + +YV +++E F   VI  F   Y  G TP PC+ CNR +KF  L
Sbjct: 57  IGAVYDARKVAEKLGIPYYVLNFKEEFNQKVIEYFIEEYLRGRTPNPCIACNRYIKFEAL 116

Query: 130 LSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLR 189
           L    ++ A  LATGHY R      D    R ++ + +D  +DQSY L+  TQ QL  L 
Sbjct: 117 LQKAMEVDAYYLATGHYARIEY---DSASGRYLLKKAVDKSKDQSYALYNLTQGQLEHLI 173

Query: 190 FPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLN 249
            PLG   K  +RD+A+E GL +A+K DSQ+ICFV    Y + +K   +G    G IV  N
Sbjct: 174 MPLGYFTKSQIRDIAKEAGLPVAEKPDSQEICFVND-DYKEFLKEKASGRIKPGPIVDKN 232

Query: 250 GQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREIN 309
           G+ILG+H GI  YTIGQRRGLG++ G+PL+V+ +D+  + V+VG  + L         +N
Sbjct: 233 GRILGQHKGIAFYTIGQRRGLGISAGKPLYVIDIDRKRNAVVVGEEKDLLTKEFTADHVN 292

Query: 310 WLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFY 368
           W+      D + D  + F KIR + D  P  +   + G V V F++ +  V  GQ+ VFY
Sbjct: 293 WIA----FDVLDDKKRVFAKIRYNFDEKPAQIMPLNSGMVKVVFDEPQKSVTPGQSVVFY 348

Query: 369 TSDSNEARVLGGGIIS 384
             D     VLGGGIIS
Sbjct: 349 DGDV----VLGGGIIS 360


>gi|197118358|ref|YP_002138785.1| tRNA (5-carboxymethylaminomethyl-2-thio-U34)-thioltransferase
           [Geobacter bemidjiensis Bem]
 gi|197087718|gb|ACH38989.1| tRNA (5-carboxymethylaminomethyl-2-thio-U34)-thioltransferase
           [Geobacter bemidjiensis Bem]
          Length = 359

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 157/365 (43%), Positives = 214/365 (58%), Gaps = 18/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRVC 80
           +++VAMSGGVDSSV AALLK  G+DV+GV+LQLY   +++   G +CC+  DV DA RV 
Sbjct: 9   QILVAMSGGVDSSVTAALLKEQGHDVMGVSLQLYERPESTPSGGKTCCSLTDVMDAARVA 68

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +   V D  ERF+  VI  F + YAAG TP PC  CN  +KF  LL +    GAD+
Sbjct: 69  KRLGIPFEVIDLRERFKELVIDNFTAEYAAGRTPNPCARCNERIKFGLLLDMAASFGADL 128

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R    +  D +    + + +D  +DQSYFLF   Q+QL  + FP+G+++K  V
Sbjct: 129 LATGHYAR----IEQDAEEIYQLLKGLDPGKDQSYFLFGMNQEQLSRIVFPVGNLEKRVV 184

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQILGRHNGI 259
           R+ A    L +A K +SQ+ICF+    Y   ++   AG+  E GDIV  +G  LG H GI
Sbjct: 185 REHAARFNLPVAQKQESQEICFIPDNDYVRFLE--EAGVRPEAGDIVDKSGNKLGSHVGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YTIGQRRGLG+A  EPL+V  +D  +SRV+VGP E L++  +   E+ W      +  
Sbjct: 243 HKYTIGQRRGLGIAWKEPLYVTAIDGATSRVVVGPEEDLKIGGLVAGELTWT-----DKP 297

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +  GF     IR    PVP   +  +DG + V+FE  +  V  GQA V Y  D    +V+
Sbjct: 298 ISGGFNGSCSIRYRMQPVPCSARLIEDGRMQVEFETPQRAVTPGQAVVLYQGD----KVV 353

Query: 379 GGGII 383
           GGG I
Sbjct: 354 GGGWI 358


>gi|262196730|ref|YP_003267939.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Haliangium ochraceum DSM 14365]
 gi|262080077|gb|ACY16046.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Haliangium ochraceum DSM 14365]
          Length = 391

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 160/378 (42%), Positives = 223/378 (58%), Gaps = 29/378 (7%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR-KGSCCAGQDVYDARRVCD 81
           +V A+SGGVDS+V AA+L   G+ V+G+T++LY++   S    G CC  +D+ DARRVC 
Sbjct: 7   IVAALSGGVDSAVTAAMLVEQGHRVVGMTMRLYDASGTSASVGGRCCGPRDIEDARRVCA 66

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + +  YV ++E  F + VI  F  +Y AGETP PCV CN+ +KF+ LL+  R LGA+ +
Sbjct: 67  HLGIPFYVVNFEVDFAHTVIDDFVDTYLAGETPNPCVKCNQHIKFTPLLARARALGAETV 126

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R    + D G   R+  R  D  +DQSYFLF+  +++L  +RFPLG M K+ VR
Sbjct: 127 ATGHYAR----LEDTGAGIRLR-RGRDASKDQSYFLFSMPREELASVRFPLGAMTKDEVR 181

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVK----RINAGIALEGDIVHLNGQILGRHN 257
           D AR  GL  A K+DSQ+ICFV  G Y   V+    R +  +   GDIV   GQ+LGRH 
Sbjct: 182 DKARAYGLPNAAKADSQEICFVPDGDYAGFVEAEALRRSRPVPASGDIVDGEGQVLGRHR 241

Query: 258 GIINYTIGQRRGLG-----VAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           G+ +YTIGQRRGLG          PL+V+ +D+   RV+VGPRE      + +R++ WL 
Sbjct: 242 GVHHYTIGQRRGLGNLRTQTRSPTPLYVIGVDRARDRVVVGPREQAARRSVPVRDVRWLS 301

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG------VYVDFEKSEVGVASGQACV 366
               E  +  G    V++R    P+P  ++   +G      V V F+ + V  + GQA V
Sbjct: 302 TPPAEGRLSAG----VQVRYRSSPLPATLELCGEGDERGKRVRVHFDDAAVIASPGQAAV 357

Query: 367 FYTSDSNEARVLGGGIIS 384
           FY  D+    VLGGG I+
Sbjct: 358 FYDGDT----VLGGGWIA 371


>gi|94969297|ref|YP_591345.1| tRNA-specific 2-thiouridylase MnmA [Candidatus Koribacter
           versatilis Ellin345]
 gi|189036216|sp|Q1IPC9|MNMA_ACIBL RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|94551347|gb|ABF41271.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Koribacter versatilis Ellin345]
          Length = 370

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 151/381 (39%), Positives = 220/381 (57%), Gaps = 30/381 (7%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-------SCCAGQ 71
           K   + VAMSGGVDSS VAA+L+ +GY+++G+T+QL+N R+ +  +G        CC+  
Sbjct: 3   KSETIAVAMSGGVDSSTVAAMLRAEGYNLVGLTMQLWNQRRLAHHEGFGEPGVGRCCSLD 62

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           DVYDARRV +T+ + +YV + E+RF   V+ PF   Y +G TP+PC  CN  +KF  LL 
Sbjct: 63  DVYDARRVAETLAIPYYVVNQEDRFERDVVKPFVEDYLSGRTPIPCSLCNNHLKFDQLLR 122

Query: 132 VTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
             +Q+GA+ +ATGHY R+     +    R  + RP D  +DQ+YFLF  TQ+QL    FP
Sbjct: 123 TAQQIGAEKIATGHYARNDF---NAQTGRWELKRPADRAKDQTYFLFGLTQEQLSRTLFP 179

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRI--NAGIAL---EGDIV 246
           LG   K  VR+ A+  GL + +K DSQ+ICF+  G Y   +       G +L    G++V
Sbjct: 180 LGHKTKPEVREDAKNHGLKLFEKPDSQEICFIPNGDYKKFLDAYLEEQGESLPDTSGELV 239

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
             +G+++G H GI N+T+GQR+GLGVA G PL+V+ L  +  +V+VG  + L    +  +
Sbjct: 240 TSSGEVVGHHTGIHNFTVGQRKGLGVATGSPLYVIELRGDKRQVVVGNNDELLTRNLRAK 299

Query: 307 EINWLGDGLFEDAVVD---GFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASG 362
            +NW+       AV D     +   KIR   +P    +++  DD V V F+  +  V  G
Sbjct: 300 RMNWI-------AVSDLAQPMRVHAKIRHKHEPAWATIEKTGDDEVLVTFDDPQRAVTPG 352

Query: 363 QACVFYTSDSNEARVLGGGII 383
           QA V Y  D     V+GGG I
Sbjct: 353 QAVVLYDGDV----VVGGGWI 369


>gi|317056376|ref|YP_004104843.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus albus 7]
 gi|315448645|gb|ADU22209.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus albus 7]
          Length = 360

 Score =  276 bits (706), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 153/367 (41%), Positives = 212/367 (57%), Gaps = 13/367 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V+ AMSGGVDSS    LL   GY+V G T+ LYN+     R+ SCC+  DV DAR V  
Sbjct: 5   KVLAAMSGGVDSSTAVKLLLDAGYEVAGATMHLYNNEDIGIREKSCCSLNDVEDARLVAL 64

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + +  +VF++ + F+  V+  F  +Y AG TP PC++CN+ +KF   L   R LG D +
Sbjct: 65  KLGIDFHVFNFSDEFKTCVMDNFVDTYLAGGTPNPCIECNKHLKFGRFLDRARMLGFDYI 124

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+ S     DD   R ++ R  D  +DQSY L+  TQ QL    FP+G+M K  +R
Sbjct: 125 ATGHYVTSHY---DDASGRWLLKRSADSSKDQSYVLYGMTQDQLAHTIFPVGEMSKPEIR 181

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A E GL  A K DSQDICF+  G Y   +    AG   EGDIV  +G +LGRH G+I+
Sbjct: 182 AIAEENGLINAHKRDSQDICFIPDGDYASFITE-RAGEQPEGDIVLSDGTVLGRHKGLIH 240

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQRRG+GV+  EPLFV   D  S+R+I+G  E +   R+   ++N++    FE    
Sbjct: 241 YTIGQRRGVGVSYSEPLFVTAKDMVSNRLIMGTAEQVCSKRLSAHDVNFI---TFEKLTA 297

Query: 322 DGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +C  + R  Q  VP  V    ++ V V+F+     V+ GQ+ VFY  +     V+GG
Sbjct: 298 P-LRCTAQTRYHQKDVPCTVFPTGENTVEVEFDTPHKAVSKGQSVVFYDGE----YVIGG 352

Query: 381 GIISGSK 387
           G ISG++
Sbjct: 353 GTISGTE 359


>gi|164688541|ref|ZP_02212569.1| hypothetical protein CLOBAR_02186 [Clostridium bartlettii DSM
           16795]
 gi|164602954|gb|EDQ96419.1| hypothetical protein CLOBAR_02186 [Clostridium bartlettii DSM
           16795]
          Length = 362

 Score =  275 bits (704), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 223/369 (60%), Gaps = 15/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK---RKGSCCAGQDVYDARR 78
           +V++ MSGGVDSSV A LLK  GYDVIGVT++L+   +  +     G CC+ + V DAR 
Sbjct: 4   KVMIGMSGGVDSSVAAYLLKEQGYDVIGVTMKLWQDDEEYELIENDGGCCSLEAVEDARS 63

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV +++E F+  VI  F   Y  G TP PC+ CN+ +KF DL    RQ+G 
Sbjct: 64  VAQKLDIPFYVLNFKEVFKEKVIDYFIDEYINGRTPNPCIACNKYIKFEDLYRRARQIGC 123

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R      D+   R ++ + +  ++DQ+Y L+  TQ QL     P+GD +KE
Sbjct: 124 DYVATGHYARIE---KDEETGRYLLTKSVTDKKDQTYALYNMTQDQLEHTLLPIGDFEKE 180

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR++A+E+GL + +K DSQ+ICFV+   Y + VKR +     EG+ V   G +LGRH G
Sbjct: 181 KVREMAKELGLVVHNKPDSQEICFVKDNDYANYVKRHSNASIKEGNFVDTKGNVLGRHKG 240

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+NYTIGQR+GLG+A G+P+FV+ ++  ++ VI+G  + L  H +  +++N++     ED
Sbjct: 241 IVNYTIGQRKGLGIAFGKPMFVIDINAKNNTVILGDNKDLFQHNLIAKDVNFIS---IED 297

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   K+R +  P    V +   D + + F++++  +  GQ+ V Y  D    +V
Sbjct: 298 -IKEPIRVKAKVRYAAKPADATVYKVGQDKIKIVFDEAQRAITKGQSVVMYDGD----KV 352

Query: 378 LGGGIISGS 386
           +GGGII  S
Sbjct: 353 VGGGIIESS 361


>gi|157273520|gb|ABV27419.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Candidatus Chloracidobacterium thermophilum]
          Length = 392

 Score =  275 bits (703), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 159/396 (40%), Positives = 218/396 (55%), Gaps = 45/396 (11%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK------ASKRKGSCCAGQDVYD 75
           R+ VAMSGGVDSS  AALLK  GYDV+G ++QL+N R+       +     CC+  D+YD
Sbjct: 4   RIAVAMSGGVDSSTAAALLKEQGYDVVGFSMQLWNQRRINVDAEGNPLPSRCCSLDDLYD 63

Query: 76  ARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ 135
           AR V + + +  YV ++EE F   V+ PF  SY  G TP PCV CN  +KF  L+++ R 
Sbjct: 64  ARAVAEALGIPFYVLNFEEEFEARVVRPFVVSYLNGNTPSPCVACNSRMKFDTLVALARD 123

Query: 136 LGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM 195
           +GA  +ATGHY R +    +D   R  + +  DL +DQSYFLF  TQ+QL    FPLG++
Sbjct: 124 VGAAKVATGHYARVQF---NDTTGRWELRKGRDLHKDQSYFLFELTQEQLAWALFPLGEL 180

Query: 196 KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINA------------------ 237
            K   R LAR  GL  A+K++SQ+ICF+  G Y   ++R  A                  
Sbjct: 181 SKAETRALARRYGLPTAEKAESQEICFIPDGNYARFIERYLAEAGGTVAGEPQSPVAPTL 240

Query: 238 -------GIALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGE--PLFVVYLDKNSS 288
                   +   G+IV  +G++LGRHNGI +YT+GQRRGLGV  G+  PL+VV +D    
Sbjct: 241 VQLGLRRNMPQPGEIVTTDGRVLGRHNGIHHYTVGQRRGLGVTAGDGRPLYVVRIDAARG 300

Query: 289 RVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG- 347
           +VIVGP E+L    +    +NW+   L E  +    +C  +IR      P  +    DG 
Sbjct: 301 QVIVGPEEALTGKTLTATRVNWI--TLPE--LTAPRRCAARIRYRHLEAPATIYPLPDGN 356

Query: 348 VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGII 383
           V V F+  +  +  GQA VFY  +     VLGGG I
Sbjct: 357 VRVVFDIPQKAITPGQAVVFYDGEL----VLGGGWI 388


>gi|253700862|ref|YP_003022051.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M21]
 gi|251775712|gb|ACT18293.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M21]
          Length = 359

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 160/373 (42%), Positives = 217/373 (58%), Gaps = 21/373 (5%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDV 73
           DK+ K  R++VAMSGGVDSSV AALLK  G+DVIGV+LQLY   +++   G +CC+  DV
Sbjct: 3   DKSLKK-RILVAMSGGVDSSVTAALLKEQGHDVIGVSLQLYERPESTPSGGKTCCSLTDV 61

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            DA RV   + +   V D  ERF+  VI  F + YAAG TP PC  CN  +KF  LL +T
Sbjct: 62  MDAARVAKRLGIPFEVVDLRERFKELVIDNFTAEYAAGRTPNPCARCNERIKFGLLLEMT 121

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
              G D+LATGHY R    +  D +    + + +D  +DQSYFLF   Q+QL  + FP+G
Sbjct: 122 ASFGTDLLATGHYAR----IEQDSEGIYQLLKGLDPGKDQSYFLFGMNQEQLSRIVFPVG 177

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQI 252
           +++K  VR+ A    L +A K +SQ+ICF+    Y   ++   AG+  E GDIV  +G  
Sbjct: 178 NLEKRVVREHAARFNLPVAQKQESQEICFIPDNDYVRFLE--EAGVKPEAGDIVDGSGNK 235

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LG H GI  YT+GQRRGLG+A  EPL+V  ++  +SRV+VGP E L+   +   E+ W  
Sbjct: 236 LGSHVGIHKYTVGQRRGLGIAWKEPLYVTAINGATSRVVVGPEEDLKTGGLVAGELTWT- 294

Query: 313 DGLFEDAVVDG-FKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTS 370
                D  + G F     IR    PVP   +  ++G + V+FE  +  V  GQA V Y  
Sbjct: 295 -----DKPISGTFNGSCSIRYRMKPVPCSARLIEEGSIQVEFETPQRAVTPGQAVVLYQG 349

Query: 371 DSNEARVLGGGII 383
           D    +V+GGG I
Sbjct: 350 D----KVVGGGWI 358


>gi|283781959|ref|YP_003372714.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Pirellula staleyi DSM 6068]
 gi|283440412|gb|ADB18854.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Pirellula staleyi DSM 6068]
          Length = 373

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 159/381 (41%), Positives = 213/381 (55%), Gaps = 28/381 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTL-----------------QLYNSRKASKRK 64
           R+V+AMSGGVDSSV AA+L R G++VIGV +                 QL   ++ S  K
Sbjct: 3   RIVLAMSGGVDSSVAAAILTRAGHEVIGVFMRHGEEAQAACAVDAPGFQLPIFKERSDHK 62

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
             CC+  D  DARRV D +++  Y  + +  FR  +I  F   Y  G TP PCV CN  +
Sbjct: 63  QGCCSASDAEDARRVADRLDIPFYALNLQSEFRQ-IIDYFIDEYTVGRTPNPCVQCNNWL 121

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQ 184
           KF  L      +GA+ +ATGHY R     GD       +CR +D  +DQSY LF   ++ 
Sbjct: 122 KFGKLFDYADSVGAEFVATGHYARLAQIDGD-----LALCRGVDDGKDQSYVLFGIKKEL 176

Query: 185 LCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGD 244
           L  +  P+GD  K  +R LA E+GL +ADK DSQ+ICFV  GK+ + V+     I   G+
Sbjct: 177 LPRMLLPIGDYYKPQIRKLAHEIGLRVADKRDSQEICFVTSGKHDEFVRARRPDIDTRGE 236

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV + G++LG+H GI  +TIGQRRGLGVA+GE  FVV ++ ++ RV+VG R+ L    + 
Sbjct: 237 IVTMEGKVLGQHAGIERFTIGQRRGLGVALGERAFVVRIEPDTHRVVVGTRDDLARTALT 296

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQ 363
               NW        A+ + F+C  KIR + DP P    R  DD + VDF++   GVA GQ
Sbjct: 297 AANCNWHTTKSPVGAIGEPFRCEAKIRYNSDPAPATAVRLTDDRLQVDFDEPRHGVAPGQ 356

Query: 364 ACVFYTSDSNEARVLGGGIIS 384
           A V Y  D    RVLGGG I 
Sbjct: 357 AVVVYDGD----RVLGGGWIE 373


>gi|126698878|ref|YP_001087775.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile 630]
 gi|123174593|sp|Q18BE2|MNMA_CLOD6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|115250315|emb|CAJ68137.1| transfer RNA-specific 2-thiouridylase MnmA [Clostridium difficile]
          Length = 361

 Score =  273 bits (697), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 220/366 (60%), Gaps = 12/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV +
Sbjct: 6   KVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDVVEIEGGCCSLSAVEDARRVAN 65

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D +
Sbjct: 66  KIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCDYV 125

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ VR
Sbjct: 126 ATGHYAKIE---KDESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDRVR 182

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI+ 
Sbjct: 183 EIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGILY 242

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E L    +  +++N++     E+ + 
Sbjct: 243 YTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNEDLFKKELIAKDVNFISIDTLEEPL- 301

Query: 322 DGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   KIR S  P P  + R  +D + + F++++  +  GQ+ V Y  D     V+GG
Sbjct: 302 ---RVQAKIRYSAKPSPATIHRVGEDTIKIVFDEAQRAITKGQSVVMYDGDI----VVGG 354

Query: 381 GIISGS 386
           GII  S
Sbjct: 355 GIIEKS 360


>gi|295695739|ref|YP_003588977.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Bacillus tusciae DSM 2912]
 gi|295411341|gb|ADG05833.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Bacillus tusciae DSM 2912]
          Length = 363

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 154/366 (42%), Positives = 216/366 (59%), Gaps = 14/366 (3%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VVVAMSGGVDSSV AALLK  GYDVIG+T++L    + S  +G CC+  DV DARRVC +
Sbjct: 6   VVVAMSGGVDSSVTAALLKERGYDVIGITMRLRGGEETSSGRG-CCSVDDVSDARRVCQS 64

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + +  Y  +Y E F   VI  F   Y  G TP PC+ CN  +K+  LL     LGAD LA
Sbjct: 65  LGIPFYAVNYREAFEKRVIQYFEDEYKRGRTPNPCIACNMYMKYDLLLEQAVDLGADYLA 124

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY R  LY  D+ + R ++ +  D  +DQ+Y L+  TQ+QL    FPLG+ +K  VR+
Sbjct: 125 TGHYARV-LY--DESRGRYVLRKAEDRRKDQTYVLYHLTQEQLARTLFPLGEYEKSEVRE 181

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNGIIN 261
           +AR+ GL +A+K++SQDICF+  G Y + ++R     A+  GD V   G ++GRH G+  
Sbjct: 182 MARKFGLRVANKAESQDICFIPNGDYGEFLRRRMGDSAVAPGDFVDTEGHVVGRHEGVSF 241

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLGVA+G P++VV +    +RV++GP+E +    +   ++NWL        + 
Sbjct: 242 YTIGQRKGLGVAVGHPVYVVDIQPERNRVVLGPKERVFSPGLVASKVNWLSLPRPNGPI- 300

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   KIR         +   + G V V+F++ +  V  GQA VFY  +     V+GG
Sbjct: 301 ---RVSAKIRYGAPEAAATLYPEEAGRVRVEFDEPQRAVTPGQAVVFYRGEE----VVGG 353

Query: 381 GIISGS 386
           G I  S
Sbjct: 354 GTIEKS 359


>gi|254974826|ref|ZP_05271298.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-66c26]
 gi|255092214|ref|ZP_05321692.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile CIP 107932]
 gi|255100299|ref|ZP_05329276.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-63q42]
 gi|255306238|ref|ZP_05350410.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile ATCC 43255]
 gi|255313953|ref|ZP_05355536.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-76w55]
 gi|255516633|ref|ZP_05384309.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-97b34]
 gi|255649732|ref|ZP_05396634.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-37x79]
 gi|260682888|ref|YP_003214173.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile CD196]
 gi|260686486|ref|YP_003217619.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile R20291]
 gi|260209051|emb|CBA62172.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile CD196]
 gi|260212502|emb|CBE03431.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile R20291]
          Length = 359

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 220/366 (60%), Gaps = 12/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV +
Sbjct: 4   KVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDVVEIEGGCCSLSAVEDARRVAN 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D +
Sbjct: 64  KIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCDYV 123

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ VR
Sbjct: 124 ATGHYAKIE---KDESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDRVR 180

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI+ 
Sbjct: 181 EIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGILY 240

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E L    +  +++N++     E+ + 
Sbjct: 241 YTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNEDLFKKELIAKDVNFISIDTLEEPL- 299

Query: 322 DGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   KIR S  P P  + R  +D + + F++++  +  GQ+ V Y  D     V+GG
Sbjct: 300 ---RVQAKIRYSAKPSPATIHRVGEDTIKIVFDEAQRAITKGQSVVMYDGDI----VVGG 352

Query: 381 GIISGS 386
           GII  S
Sbjct: 353 GIIEKS 358


>gi|296451277|ref|ZP_06893017.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP08]
 gi|296880371|ref|ZP_06904334.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP07]
 gi|296259883|gb|EFH06738.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP08]
 gi|296428612|gb|EFH14496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile NAP07]
          Length = 361

 Score =  272 bits (695), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 220/366 (60%), Gaps = 12/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV +
Sbjct: 6   KVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDDVEIEGGCCSLSAVEDARRVAN 65

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D +
Sbjct: 66  KIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCDYV 125

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ VR
Sbjct: 126 ATGHYAKIE---KDESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDRVR 182

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI+ 
Sbjct: 183 EIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGILY 242

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E+L    +  +++N++     E+ + 
Sbjct: 243 YTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNENLFKKELIAKDVNFISIDTLEEPL- 301

Query: 322 DGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   KIR S  P P  + R   D + + F++++  +  GQ+ V Y  D     V+GG
Sbjct: 302 ---RVQAKIRYSAKPSPATIHRVGKDTIKIVFDEAQRAITKGQSVVMYDEDI----VVGG 354

Query: 381 GIISGS 386
           GII  S
Sbjct: 355 GIIEKS 360


>gi|255655293|ref|ZP_05400702.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium difficile QCD-23m63]
          Length = 359

 Score =  271 bits (694), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 220/366 (60%), Gaps = 12/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V++ MSGGVDSSV A LLK+ GYDVIGVT++L+      + +G CC+   V DARRV +
Sbjct: 4   KVMIGMSGGVDSSVAAYLLKQQGYDVIGVTMKLWQDDDDVEIEGGCCSLSAVEDARRVAN 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I +  YV ++ E F+  VI  F   Y  G+TP PC+ CN+ +KF D     RQ+G D +
Sbjct: 64  KIGIPFYVLNFREVFKEKVIDYFIDEYLEGKTPNPCIACNKHIKFDDFYKKARQIGCDYV 123

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +      D+   R ++ + +  ++DQ+Y L+  TQ+QL     P+GD +K+ VR
Sbjct: 124 ATGHYAKIE---KDESTGRYLLKKSVTDKKDQTYALYNLTQEQLEHTLLPIGDYEKDRVR 180

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A+EMG+ + +K DSQ+ICFV+   Y + VK+ +     EG  V   G ILG+H GI+ 
Sbjct: 181 EIAKEMGMAVHNKPDSQEICFVKDNDYANYVKKHSKKRIEEGFFVDTKGNILGKHKGILY 240

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+  G+P+FV+ ++  ++ +++G  E+L    +  +++N++     E+ + 
Sbjct: 241 YTIGQRKGLGITFGKPMFVIDINPINNTIVLGDNENLFKKELIAKDVNFISIDTLEEPL- 299

Query: 322 DGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   KIR S  P P  + R   D + + F++++  +  GQ+ V Y  D     V+GG
Sbjct: 300 ---RVQAKIRYSAKPSPATIHRVGKDTIKIVFDEAQRAITKGQSVVMYDEDI----VVGG 352

Query: 381 GIISGS 386
           GII  S
Sbjct: 353 GIIEKS 358


>gi|153813145|ref|ZP_01965813.1| hypothetical protein RUMOBE_03554 [Ruminococcus obeum ATCC 29174]
 gi|149830800|gb|EDM85890.1| hypothetical protein RUMOBE_03554 [Ruminococcus obeum ATCC 29174]
          Length = 375

 Score =  268 bits (686), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 152/364 (41%), Positives = 210/364 (57%), Gaps = 13/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS-KRKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV A L+ ++GYD  G TL+LY++ + S     +CC   D  DAR V 
Sbjct: 14  KAIIAMSGGVDSSVAAYLMVKEGYDCAGATLKLYDNPQCSFPGHRACCTPSDTEDARSVA 73

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YVF   + FR++VI  FA +Y  G TP PC+DCNR +KFS LL   R+LG + 
Sbjct: 74  ARLGMLYYVFPMHDEFRHSVIDKFADTYLHGGTPNPCIDCNRFLKFSALLDKARELGCEY 133

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +A+GHY R      D    R I+ + +D  +DQSY L+A TQ QL    FPLG   K+ +
Sbjct: 134 IASGHYARREQ---DPETGRFILKKGLDPTKDQSYVLYAMTQDQLAHTLFPLGSYTKKEI 190

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A++ G   ADK DSQDICFV  G Y   +++     +  GD V   G +LG+H G I
Sbjct: 191 RHIAQKQGFINADKPDSQDICFVPDGDYASFIEQYTGQSSEPGDFVDKEGNVLGKHKGQI 250

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQRRGLG++  E L+V     +S++VI+G ++ L     Y+ +IN +      D +
Sbjct: 251 HYTIGQRRGLGISAPESLYVCGKSLDSNKVILGGKQDLMSTCCYINDINLIP----WDHL 306

Query: 321 VDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               KC VK R  Q   P  V Q  DD + + FE+ +  V  GQA V Y  D     VLG
Sbjct: 307 DKPIKCKVKTRYRQPEQPATVEQLGDDLLKITFEEPQRAVTPGQAAVLYDGD----MVLG 362

Query: 380 GGII 383
           GG I
Sbjct: 363 GGTI 366


>gi|153814505|ref|ZP_01967173.1| hypothetical protein RUMTOR_00719 [Ruminococcus torques ATCC 27756]
 gi|317500546|ref|ZP_07958768.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|331089354|ref|ZP_08338254.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145847999|gb|EDK24917.1| hypothetical protein RUMTOR_00719 [Ruminococcus torques ATCC 27756]
 gi|316898056|gb|EFV20105.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lachnospiraceae bacterium 8_1_57FAA]
 gi|330405417|gb|EGG84952.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 356

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 212/365 (58%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++        +  G CC    V DARRV
Sbjct: 3   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEEDVCTVEENGGCCGLSAVEDARRV 62

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++ E F+  VI  FA SY  G+TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 63  AAALGIPYYVMNFREEFQKNVIDYFADSYVNGQTPNPCIACNRYVKWEALLKRSISIGAD 122

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    V      R  + R     +DQ+Y L+  TQ+QL     P+G+  KE 
Sbjct: 123 FIATGHYAR----VEQLSNGRYALRRSATAAKDQTYALYNLTQEQLKRTLMPVGEYTKEE 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A ++GL +ADK DSQDICFVQ G Y   ++      A EG+ V  +G ++GRH GI
Sbjct: 179 VRVIAEKIGLLVADKPDSQDICFVQDGNYAAFIEEHTGKKASEGNFVTSDGTVIGRHKGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YT+GQR+GLG+A+G P FV+ +   ++ V++G  E      +  +++N++     ED 
Sbjct: 239 IHYTVGQRKGLGLALGYPAFVLEIRPETNEVVIGTYEESLTTVVRAKQLNFMS---VED- 294

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           + +  + F KIR +       V+R  +D V   FE+ +  V  GQA VFY  +     VL
Sbjct: 295 LKEPLRVFAKIRYNHKGAWCTVERTKEDEVTCCFEEPQRAVTPGQAIVFYDGE----YVL 350

Query: 379 GGGII 383
           GGG I
Sbjct: 351 GGGTI 355


>gi|268608557|ref|ZP_06142284.1| tRNA-specific 2-thiouridylase MnmA [Ruminococcus flavefaciens FD-1]
          Length = 358

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 212/366 (57%), Gaps = 15/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR---KASKRKGSCCAGQDVYDARR 78
           +V+V MSGGVDSSV A LL+  GYDV+GVTL+L++     +A K   +CCA  DV DAR 
Sbjct: 3   KVMVGMSGGVDSSVAAMLLREQGYDVMGVTLKLFSDEDIDQAQKEGKTCCALSDVEDARS 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +   H VF++++ FR  V+  F+ SY  G TP PC++CNR VKF  +L    +L  
Sbjct: 63  VARRLGFEHLVFNFKDNFREHVMKQFSDSYLCGRTPNPCIECNRHVKFDKMLRRALELEY 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY        D+ + R ++ R  D  +DQ+Y L++ TQ+QL    FPLG + K 
Sbjct: 123 DYIATGHYAVCEY---DEERGRWLLKRSADRSKDQTYVLYSLTQEQLSHTLFPLGSLDKT 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR+LA + GL  ++K DSQDICFV  G Y   ++R        G+ V + G++LG H G
Sbjct: 180 QVRELAEKAGLVNSNKPDSQDICFVPDGDYAGFIRRFTGTDVPHGNFVDMEGKVLGEHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           IINYT+GQR+GLG+++G+P +VV  D +++ V +G    L    +   + N +       
Sbjct: 240 IINYTVGQRKGLGISLGKPAYVVKKDVDTNTVTLGDESDLYTKTLIADDFNLISVA---- 295

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  +   K R SQ+  P  V    +G Y V+F++ +  V SGQA V Y  D     V
Sbjct: 296 ELTEPMRVTAKTRYSQNEQPATVSYLGNGEYMVEFDQPQRAVTSGQAVVLYDGDI----V 351

Query: 378 LGGGII 383
           +GGG I
Sbjct: 352 VGGGTI 357


>gi|121535962|ref|ZP_01667756.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosinus carboxydivorans Nor1]
 gi|121305454|gb|EAX46402.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosinus carboxydivorans Nor1]
          Length = 364

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 151/370 (40%), Positives = 212/370 (57%), Gaps = 14/370 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           RVVVAMSGGVDSS+ AALL   GYDVIGVT+Q++ +   +       CC+   V DARRV
Sbjct: 6   RVVVAMSGGVDSSLTAALLVHQGYDVIGVTMQIWENDLPEIDPEHRGCCSLSAVNDARRV 65

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + + +YV ++ E F+  V+  F   YAAG+TP PC+ CNR VKF  LL     L A 
Sbjct: 66  ADKLGIPYYVLNFREMFQETVVDYFIREYAAGKTPNPCIACNRYVKFEGLLQKALALDAQ 125

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R      D G+ R I+ + +D  +DQSY L+   Q  L     PLG+  K  
Sbjct: 126 YVATGHYARIEY---DKGRGRYILRKGVDRTKDQSYALYHLNQHTLRHFLMPLGEYTKVQ 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
            R +AR+ GL +A+K DSQ+ICF+    Y   ++         G+IV  +G+ILGRH G+
Sbjct: 183 TRQMARQFGLAVAEKPDSQEICFIPNDDYKSFLEEKAPETLRPGNIVDTHGRILGRHKGL 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YT+GQR+GLG+A+G+PL+VV LD   + VIVG  E +    +   ++N++      D 
Sbjct: 243 PLYTVGQRKGLGIAVGKPLYVVALDYERNEVIVGSDEDVFASELIAEDLNFIT----VDK 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    +   KIR S    P  +    +G VYV F++ +  +  GQ+ VFY  D+    V+
Sbjct: 299 LASPLRVAAKIRYSAREAPATITPEREGAVYVRFDEPQRAITPGQSVVFYDGDT----VV 354

Query: 379 GGGIISGSKR 388
           GGGII  + R
Sbjct: 355 GGGIIRKAIR 364


>gi|16330399|ref|NP_441127.1| tRNA-specific 2-thiouridylase MnmA [Synechocystis sp. PCC 6803]
 gi|3122978|sp|P73755|MNMA_SYNY3 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|1652889|dbj|BAA17807.1| sll0844 [Synechocystis sp. PCC 6803]
          Length = 358

 Score =  268 bits (684), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 157/373 (42%), Positives = 216/373 (57%), Gaps = 23/373 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AALL R GY V+GVTL L       K KG CC+ + + DA  +C+
Sbjct: 4   KVVVGLSGGVDSSVAAALLHRQGYAVVGVTLWLM------KGKGQCCS-EGLVDAASICE 56

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H + D  + F+N +I      Y  G TPLPC  CN+ VKF  +L   +Q LG D 
Sbjct: 57  QLGVPHEIVDTRDLFQNHIIDYLVQGYGEGVTPLPCSQCNKAVKFGPMLQYAQQSLGIDK 116

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    ++  +R  + R +D ++DQSYFL+  +Q+ L    FPLG+  K   
Sbjct: 117 IATGHYARIRF---NEASQRYELLRAVDRQKDQSYFLYDLSQEILAATLFPLGEQTKTVT 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           R LA E  L  A+K DSQD+C ++  G   D + +  A  A  G+IV L+G +LG H GI
Sbjct: 174 RQLAAEFDLSTAEKKDSQDLCLIEAHGSMRDFLDKYIAPKA--GEIVDLSGAVLGHHEGI 231

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+VV LD   +RVIVG R+S      Y++ +NW+   + E  
Sbjct: 232 HHYTIGQRKGLGIAAAEPLYVVKLDPVMNRVIVGDRQSAGSGECYVQRLNWV--SIPEPT 289

Query: 320 VVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
                +C V++R    PV V  +  +D  + + F++ + G+  GQA V Y  D    RVL
Sbjct: 290 A--PIRCEVQVRYRSAPVTVNAIPWHDQQIKLVFDEPQFGITPGQAAVLYDGD----RVL 343

Query: 379 GGGIISGSKRSDA 391
           GGGII   K   A
Sbjct: 344 GGGIICPQKSETA 356


>gi|255020959|ref|ZP_05293015.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidithiobacillus caldus ATCC 51756]
 gi|254969750|gb|EET27256.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidithiobacillus caldus ATCC 51756]
          Length = 348

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/364 (42%), Positives = 212/364 (58%), Gaps = 21/364 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+VVA+SGGVDS+V AALL   G+D++GVTL+L+   +       CC  +D+ DA  +C 
Sbjct: 3   RIVVALSGGVDSAVAAALLADAGHDLVGVTLRLWPQSR-------CCDERDIEDAADLCA 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + + V DY +RFR A++ PF + Y AG TP PC  CN+ +KF+ L   +  LGAD L
Sbjct: 56  QLGIPYRVLDYRQRFREAIVEPFVADYLAGRTPNPCARCNQLLKFTALWQESAALGADFL 115

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R R  VGDD + RR +    D  +DQSYFLFA   + L  LRFPLG+ +KE VR
Sbjct: 116 ATGHYVRLR-EVGDDWQLRRAV----DERKDQSYFLFAVPGELLPRLRFPLGEWRKEEVR 170

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
             AR+ GL IA K DSQD+CF+  G     +K         GDIV   G +LG+H G+++
Sbjct: 171 TWARQRGLAIAAKGDSQDLCFIPDGDTGAFIKSQTQVEVRPGDIVDATGAVLGQHEGLVH 230

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YT+GQRRGLG     P +V+ LD   +R+ VGP  +L      LR+ NW    L   +V 
Sbjct: 231 YTVGQRRGLGGGAAVPRYVLALDAKHNRLQVGPEAALFRGEARLRDCNW----LTTQSVA 286

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                 VK+R +  PVP  ++  D    ++ F   +  +  GQA V Y  D    R+LGG
Sbjct: 287 LDTPVTVKLRYAASPVPATLRLLDGAAAHLRFATPQRAITPGQAAVCYDGD----RLLGG 342

Query: 381 GIIS 384
           G I+
Sbjct: 343 GWIA 346


>gi|326791915|ref|YP_004309736.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium lentocellum DSM 5427]
 gi|326542679|gb|ADZ84538.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium lentocellum DSM 5427]
          Length = 360

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 140/363 (38%), Positives = 211/363 (58%), Gaps = 12/363 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV MSGGVDSSV A LLK  GY+VIG+T+Q++         G CC    V DARRVC 
Sbjct: 8   KVVVGMSGGVDSSVTAYLLKEQGYEVIGMTMQIWQEGAPEDSDGGCCGLSAVDDARRVCQ 67

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            +++ HYV ++   F+  VI  F   Y    TP PC+ CNR VK+  +L    Q+GAD +
Sbjct: 68  KLDIPHYVVNFRSDFKKHVIDYFLDEYQNARTPNPCIACNRYVKWESMLQKALQIGADYI 127

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R    + D+   R  + +   L +DQ+Y L+  TQ QL     PLGD  K+ VR
Sbjct: 128 ATGHYAR---VIRDEVTGRYSLKQSKTLAKDQTYALYNLTQHQLAHTLMPLGDYTKDEVR 184

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A+E+GL +A K DSQ+ICFV    Y   ++       + G+ V+ +G++LG+H GII+
Sbjct: 185 AIAKEIGLAVATKPDSQEICFVPDNNYAKYIEEETGKKPVVGNFVNKDGKVLGKHKGIIH 244

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+++G+P FV  +++ ++ V++G  E L    +   ++N++     E  + 
Sbjct: 245 YTIGQRKGLGLSLGKPGFVQRINQKTNEVVIGDNEDLFDTTVTANQVNFMPFEHLEGEM- 303

Query: 322 DGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               C  KIR +Q P P  ++  ++D +   F++ +  +  GQA V Y  D    +++GG
Sbjct: 304 ---HCLGKIRYNQAPQPCTIKMIDEDTIQCIFDEKQRAITPGQALVLYDGD----KLIGG 356

Query: 381 GII 383
           G I
Sbjct: 357 GTI 359


>gi|325679422|ref|ZP_08159007.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus albus 8]
 gi|324109019|gb|EGC03250.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus albus 8]
          Length = 356

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 148/363 (40%), Positives = 208/363 (57%), Gaps = 13/363 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV+ AMSGGVDSS    LL   GY+V G T+ LYN+     R+ +CC+  DV DAR V  
Sbjct: 5   RVLAAMSGGVDSSAAVKLLLDKGYEVAGATMHLYNNEDIGIREKNCCSLNDVEDARLVAL 64

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + +  +VF++ + F+  V+  F ++Y +G TP PC++CN+ +KF   L     LG D +
Sbjct: 65  KLGIDFHVFNFSDEFKMRVMDDFVNTYLSGGTPNPCIECNKHLKFGRFLERAELLGFDYI 124

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+ S     D+   R ++ R  D  +DQSY L+  TQ QL    FP+GDM K  +R
Sbjct: 125 ATGHYVTSHY---DEASGRWLLKRSADRAKDQSYVLYGMTQHQLAHTIFPVGDMNKTDIR 181

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            LA E GL  A K DSQDICF+  G Y   +    AG    GDIV  +G +LG+H G+I+
Sbjct: 182 ALAEENGLINAHKRDSQDICFIPDGDYAKFITEA-AGEQPAGDIVLSDGTVLGKHRGLIH 240

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YT+GQRRG+GV+  EPLFV   D   +++I+G  E L    +   E+N++      D + 
Sbjct: 241 YTVGQRRGVGVSYSEPLFVTSKDMAQNKLIMGTAEQLCSKTLTAGEVNFIT----VDKLT 296

Query: 322 DGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              KC  + R  Q  VP  V Q +++ V V+F+K    ++ GQA VFY  +     V+GG
Sbjct: 297 SPLKCTAQTRYHQQDVPCTVFQIDENTVKVEFDKPHKAISKGQAVVFYDGE----YVVGG 352

Query: 381 GII 383
           G I
Sbjct: 353 GKI 355


>gi|295110441|emb|CBL24394.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus obeum A2-162]
          Length = 373

 Score =  267 bits (682), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 212/364 (58%), Gaps = 13/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS-KRKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV A L+ ++GYD  G TL+LY++ + S     +CC   D  DAR V 
Sbjct: 4   KAMIAMSGGVDSSVAAYLMVQNGYDCAGATLKLYDNPQCSFPGHRACCTPSDTEDARSVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YVF   + FR++VI  FA +Y  G TP PC+DCNR +KFS LL   R+LG + 
Sbjct: 64  ARLGMLYYVFPMHDEFRHSVIDKFADTYLHGGTPNPCIDCNRFLKFSALLDKARELGCEY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +A+GHY R      D    R I+ + +D  +DQSY L+A TQ QL    FPLG   K+ +
Sbjct: 124 IASGHYARREQ---DPETGRFILKKGLDPTKDQSYVLYAMTQDQLAHTLFPLGGYTKKEI 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A+E G   ADK DSQDICFV  G Y   +++     +  GD V   G++LG+H G I
Sbjct: 181 RHIAQEQGFINADKPDSQDICFVPDGDYASFIEQYTGQSSEPGDFVDKEGKVLGKHKGQI 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQRRGLG++  E L+V     +S+ VI+G ++ L  +  Y+ +IN +      D +
Sbjct: 241 HYTIGQRRGLGISAPESLYVCGKSLDSNEVILGGKQDLMSNYCYINDINLIP----WDHL 296

Query: 321 VDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               KC VK R  Q   P  V++  +D + + F++ +  V  GQA V Y  D     VLG
Sbjct: 297 DAPIKCKVKTRYRQPEQPATVEQIGEDLIKITFDEPQRAVTPGQAAVLYDDD----MVLG 352

Query: 380 GGII 383
           GG I
Sbjct: 353 GGTI 356


>gi|227824500|ref|ZP_03989332.1| conserved hypothetical protein [Acidaminococcus sp. D21]
 gi|226904999|gb|EEH90917.1| conserved hypothetical protein [Acidaminococcus sp. D21]
          Length = 357

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 211/367 (57%), Gaps = 15/367 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           M+ ++AMSGGVDSSV A L+   GY+ +G T++LYN+  A     +CC+ +DV DAR V 
Sbjct: 1   MKALIAMSGGVDSSVAAKLMLDQGYECVGCTMKLYNNPDAGCSSKTCCSIRDVEDARSVA 60

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + ++VF+Y + FR  V+  FA SY  G+TP PC+DCN+ +KF  L    ++LG D 
Sbjct: 61  VRLGMPYFVFNYMDEFRRDVMETFARSYTLGKTPNPCIDCNKFLKFGALYERAKELGCDT 120

Query: 141 LATGHYIRSRLYVGDDGKRRRI--MCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           + TGHY R R       KR     + R  D ++DQSY L+  TQ+QL   +FPLGD +K 
Sbjct: 121 IVTGHYARIR-------KRNGCYELLRAKDPKKDQSYVLYNLTQEQLAHTQFPLGDYEKT 173

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
             R++A E G   + K DSQDICFV  G Y + V+RI +     G  + L+G+ +G H G
Sbjct: 174 HTREIAEESGFINSHKPDSQDICFVPNGTYTEAVQRILSYEPQPGPFLTLDGKEIGTHKG 233

Query: 259 IINYTIGQRRGLGVAMGE-PLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           II YTIGQ + LG+   + PL+V+ +D   + VIVGP ++L      ++E NW+  G   
Sbjct: 234 IIYYTIGQHKKLGLPQPDGPLYVIAIDPKKNAVIVGPSQALFRRDAAVKEANWI-SGKVP 292

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           DA    F C VK+R  Q+  P  V     D   + F++ +  +  GQ+ V Y        
Sbjct: 293 DAP---FACLVKVRYRQEAQPAIVTPTGSDTFSILFDEPQRAITPGQSAVLYGLGDETDV 349

Query: 377 VLGGGII 383
           V+GGGI+
Sbjct: 350 VIGGGIL 356


>gi|312143962|ref|YP_003995408.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halanaerobium sp. 'sapolanicus']
 gi|311904613|gb|ADQ15054.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halanaerobium sp. 'sapolanicus']
          Length = 357

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 148/371 (39%), Positives = 217/371 (58%), Gaps = 23/371 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V++AMSGGVDSSV AALLK  GY+VIG T+ ++ +  +A+ R+  CC+   + DA+RV 
Sbjct: 3   KVMIAMSGGVDSSVAAALLKEKGYEVIGGTMHIFPDYEEATDREDHCCSYSAIRDAKRVA 62

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + H+VF+ ++ F+  VI  F   Y+   TP PCV CN+ +KF  LL   R++G D 
Sbjct: 63  QKLEIPHFVFNLKDEFQEKVIDYFVYEYSKARTPNPCVMCNKKIKFDALLRKAREIGCDY 122

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R ++ +  D  +DQSY L+   Q+QL    FPLGD  K+ +
Sbjct: 123 IATGHYSKIEKNNG-----RYLLKKGRDESKDQSYMLYVLNQEQLSRALFPLGDFTKQEI 177

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R  A+E+G +I +K++SQ+ICFV    Y   +      I+  G I+   G  +G HNGI 
Sbjct: 178 RQKAKELGFEIHNKAESQEICFVPDDDYVRFLDNNYPEISKPGPILDSEGNKVGTHNGIS 237

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG----DGLF 316
           NYTIGQRRGLGVA+G P +VV LD +++ VI+G  E +    ++  +IN +     DG  
Sbjct: 238 NYTIGQRRGLGVALGYPAYVVKLDPDNNAVILGEDEEVFSKGLFAEDINIIPFSSLDGKI 297

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
           E A         +IR +  PVP  +++  +D + V+F+ S+  V  GQ+ VFY  D    
Sbjct: 298 EVA--------AQIRYNSYPVPAIIEKIGEDKIKVEFKDSQRAVTPGQSVVFYLDD---- 345

Query: 376 RVLGGGIISGS 386
            V GGGII  S
Sbjct: 346 LVFGGGIIKES 356


>gi|160881034|ref|YP_001560002.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium phytofermentans ISDg]
 gi|205813731|sp|A9KPI9|MNMA_CLOPH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|160429700|gb|ABX43263.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium phytofermentans ISDg]
          Length = 357

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 215/365 (58%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++     +  +  G CC    V DARRV
Sbjct: 3   KVVVGMSGGVDSSVAAYLLKEAGYDVIGVTMQIWQDEDNQTVEENGGCCGLSAVDDARRV 62

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            +++++ +YV +++  F+  V+  F   Y AG TP PC+ CNR VK+  LL+ + Q+GAD
Sbjct: 63  ANSLDIPYYVMNFKSEFKANVMDYFVKEYQAGRTPNPCIACNRYVKWESLLTRSLQIGAD 122

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +R+    +G  R  + +     +DQ+Y L+  TQ QL     P+G+  KE 
Sbjct: 123 YIATGHY--ARIVTLPNG--RFALKKSATAAKDQTYALYNLTQDQLSKTLMPVGEYTKEE 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A ++GL +A+K DSQ+ICFV    Y   ++       + G+ V   G ILGRH GI
Sbjct: 179 VREIAAKIGLLVANKPDSQEICFVPDNNYAGFIEDYTGQKIIPGNFVDTKGNILGRHQGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YT+GQR+GLG+A+G P FVV +   ++ V++G  + +   R+   ++N +    FE  
Sbjct: 239 IHYTVGQRKGLGIALGRPAFVVEIRPETNEVVIGSNDDIFTDRLIANKLNAMAVEEFE-- 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             DG +   KIR + +     +++ +D  +  +FE  +  V  GQA VFY  D     V+
Sbjct: 297 --DGMEVIAKIRYNHEGSKCTIRKVSDTEIACEFETPQRAVTPGQAVVFYQGDI----VV 350

Query: 379 GGGII 383
           GGG I
Sbjct: 351 GGGTI 355


>gi|304436306|ref|ZP_07396284.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
 gi|304370711|gb|EFM24358.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas sp. oral taxon 149 str. 67H29BP]
          Length = 361

 Score =  266 bits (679), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 209/364 (57%), Gaps = 14/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRVC 80
           RVVVAMSGGVDSSV AALL+  GY+V+GVT++L    + +   G SCC+   V DARRV 
Sbjct: 5   RVVVAMSGGVDSSVTAALLQEQGYEVVGVTMRLSEEARDADLDGRSCCSLSSVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + + HYV D+ + F+  VI  F   YA G TP PC+ CNR +KF  LL  TR LGA  
Sbjct: 65  DILGIPHYVMDFTDPFQRLVIDYFTQEYARGRTPNPCIACNRYIKFEGLLEKTRALGAQY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +R+   +DG     + + +D  +DQSY L+  TQ+ +  + FPLGD +K+ +
Sbjct: 125 IATGHY--ARITHTEDGTYH--LRKGIDAAKDQSYVLYHLTQEMMDHVLFPLGDYRKDEI 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL +A K++SQ+ICFV +  Y   ++         G I    G +LG H GI 
Sbjct: 181 RRMAEDYGLPVAHKAESQEICFVPRDDYKSYLRTHAPQTMQTGAITDRTGHVLGTHEGIA 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQRRGLG+A   PL+V  LD + +RVIVG  + +  H +   +++W          
Sbjct: 241 FYTIGQRRGLGIAAEHPLYVTALDASENRVIVGASDEIFAHALTASDLSW----TLSRPP 296

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR  +     +++   DG V V F + +  V  GQ+ VFY  D+    VLG
Sbjct: 297 HKPRRVRAKIRYGKREADAWMEPQGDGTVAVHFSEPQRAVTPGQSIVFYEGDA----VLG 352

Query: 380 GGII 383
           GG I
Sbjct: 353 GGSI 356


>gi|148656262|ref|YP_001276467.1| tRNA-specific 2-thiouridylase MnmA [Roseiflexus sp. RS-1]
 gi|205816909|sp|A5UV64|MNMA_ROSS1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|148568372|gb|ABQ90517.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseiflexus sp. RS-1]
          Length = 373

 Score =  266 bits (679), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 154/377 (40%), Positives = 215/377 (57%), Gaps = 22/377 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +++VAMSGGVDSS+ AALL   G+DV GVTL L+        +  CC+ +    ARRVC 
Sbjct: 3   KIMVAMSGGVDSSLAAALLHEAGHDVTGVTLHLWEGDDDRLAESLCCSQEMTESARRVCA 62

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + +YVF+Y+  FR  VI  F   YA+G TP PC++CNR +KF  LL+  R LG D +
Sbjct: 63  QLGIPYYVFNYQREFRRYVIEYFLREYASGFTPNPCLECNREIKFRALLARARTLGFDYV 122

Query: 142 ATGHYIRSRL----YVGDDG------KRRRI---MCRPMDLERDQSYFLFATTQQQLCDL 188
           ATGHY R R     + G+D       + +R    + R +D E+DQSY L+   Q  L  L
Sbjct: 123 ATGHYARIRADETRHNGEDAGLPPAERAQRTTYRLLRAVDREKDQSYMLYMLGQDDLARL 182

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL 248
            FP+G+  K  VR +A   GL  A++ +SQDICFV  G Y ++++         G I+ L
Sbjct: 183 IFPIGEYTKAEVRAMAAARGLASANRPESQDICFVPGGDYRNLLREERPDALRPGPILDL 242

Query: 249 NGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREI 308
            G+ +GRH G+  YTIGQRRGLG+A G+P++V  LD   + VIVGP  +L    +    +
Sbjct: 243 EGREVGRHQGLPLYTIGQRRGLGIATGQPMYVTALDVARNAVIVGPESALRRESLRAEWV 302

Query: 309 NWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVF 367
            ++  G++ +A    F C  +IR+  D VP  V   + G V V F + +  V  GQA VF
Sbjct: 303 TFV-SGMWPEAP---FDCLAQIRAHADAVPARVIPGEAGTVDVHFSRPQRAVTPGQAIVF 358

Query: 368 YTSDSNEARVLGGGIIS 384
           Y  D     VLGGG I+
Sbjct: 359 YDGDV----VLGGGRIA 371


>gi|284047421|ref|YP_003397760.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Acidaminococcus fermentans DSM 20731]
 gi|283951642|gb|ADB46445.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Acidaminococcus fermentans DSM 20731]
          Length = 356

 Score =  265 bits (678), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 146/366 (39%), Positives = 208/366 (56%), Gaps = 14/366 (3%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK-RKGSCCAGQDVYDARRV 79
           M+ ++AMSGGVDSSV A L++  GYD IG  ++LYN+  A      +CC+  DV DAR V
Sbjct: 1   MKALIAMSGGVDSSVSAKLMQDAGYDCIGCNMKLYNNPDAGYCSTKTCCSLSDVEDARSV 60

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           C  + +  YVF+Y E F++ V+  FA SY  G TP PC+DCN+ +KF  L    R+LG D
Sbjct: 61  CARLGMPFYVFNYTEEFKHDVMEKFARSYTLGHTPNPCIDCNKFLKFGALYQRARELGCD 120

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            + TGHY R R    ++   +  + + +D ++DQSY L+  TQ+QL    FPLG   K  
Sbjct: 121 CVVTGHYARIR---KNETTGKYELLKALDPKKDQSYVLYNLTQEQLAHTCFPLGGYHKTH 177

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
            R++A E G   + K DSQDICFV  G+Y D V+RI       G  + L G ++G+H GI
Sbjct: 178 TREIAEENGFINSHKPDSQDICFVPNGQYTDAVQRILDYRPQPGPFLDLEGNVIGQHRGI 237

Query: 260 INYTIGQRRGLGVAMGE-PLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I YT+GQ + LG+   + PL+VV +D   + ++VGP E+L   +  + E NW+   +   
Sbjct: 238 IYYTLGQHKHLGLNQPDFPLYVVKIDPKKNAIVVGPSEALFSRKASVGEANWISGEVPAG 297

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            V    +C VK+R  QD  P  V     D   + F++ +  +  GQA V Y  +     V
Sbjct: 298 PV----RCQVKVRYRQDAQPATVTPTGKDTFTIQFDEPQRAITPGQAAVLYDGEV----V 349

Query: 378 LGGGII 383
           LGGG I
Sbjct: 350 LGGGTI 355


>gi|325265024|ref|ZP_08131751.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium sp. D5]
 gi|324029714|gb|EGB91002.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium sp. D5]
          Length = 356

 Score =  265 bits (677), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 149/366 (40%), Positives = 217/366 (59%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    R   +  G CC    V DARRV
Sbjct: 3   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDRAVQEENGGCCGLSAVEDARRV 62

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GA+
Sbjct: 63  AAELEIPYYVMNFKQEFKEHVIDYFVEEYRNGRTPNPCIACNRYVKWESLLHRSMAIGAE 122

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +R+   D+G  R  + R   L +DQ+Y L+  TQ+QL     P+G+  K+ 
Sbjct: 123 YIATGHY--ARVVKLDNG--RFTLRRSATLAKDQTYALYNLTQEQLEHTLMPVGEYSKDE 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNG 258
           VR +A ++GL +A+K DSQDICFV  G Y   ++   AGI + EG+ V  +G++LGRH G
Sbjct: 179 VRRIAEKIGLMVANKPDSQDICFVPDGDYASYIEE-TAGIRMPEGNFVSSDGRVLGRHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YT+GQR+GLG+A+G P FV+ +  +++ V++G  E    H +    +N++     ED
Sbjct: 238 ITHYTVGQRKGLGLALGYPAFVLEIRPDTNEVVIGTNEESMTHTLKADRLNFMS---VED 294

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +  + F KIR +       +++   D V   FE+ +  V  GQA VFY  +     V
Sbjct: 295 -LTEPLRVFTKIRYNHKGAWCIIEKTGTDEVLCTFEEPQRAVTPGQAVVFYDGEY----V 349

Query: 378 LGGGII 383
           LGGG I
Sbjct: 350 LGGGTI 355


>gi|255659674|ref|ZP_05405083.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mitsuokella multacida DSM 20544]
 gi|260848239|gb|EEX68246.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mitsuokella multacida DSM 20544]
          Length = 366

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 208/374 (55%), Gaps = 14/374 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN-SRKASKRKGSCCAGQDVYDARRVC 80
           +VVVAMSGGVDSS+ AALLK  GY+ IGVT++L   SR   +    CC+   V DARRV 
Sbjct: 5   KVVVAMSGGVDSSLTAALLKEQGYEAIGVTMRLSEESRDFDENDRGCCSLSSVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I + HY  +++E F+  VI  F + YA G TP PC+ CNR VKF  LL    +LGAD 
Sbjct: 65  EIIGIPHYTMNFKEMFQEKVIDYFLADYAKGWTPNPCIACNRYVKFEGLLQKAMELGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R    +  D   R ++ + +D  +DQSY L+   QQ L     PLGD  K   
Sbjct: 125 VATGHYAR----IAQDESGRYVLKKGIDTHKDQSYALYHLNQQSLAHFLMPLGDYTKVET 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A    L +A K DSQ+ICFV    Y   ++  N      GDIV   G +LG H G+ 
Sbjct: 181 REMAERYKLPVAHKPDSQEICFVPHDDYKAYLRAKNPSCLHPGDIVDKEGHVLGHHEGVP 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A  EPL+VV LD   +RV+VG    +    +   ++NW+      DA+
Sbjct: 241 LYTIGQRKGLGIAHPEPLYVVDLDMAHNRVVVGGAGDVFSDGLIAGDLNWIAI----DAL 296

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   K+R  +      V+    G V V F + +  V  GQ+ VFY  D+    V+G
Sbjct: 297 EAPIEVTAKVRYGRREGRAHVEPLAGGKVRVHFAEPQRAVTPGQSVVFYAGDT----VVG 352

Query: 380 GGIISGSKRSDAVE 393
           GGII  + R +A E
Sbjct: 353 GGIIEKAIRKEAAE 366


>gi|163781841|ref|ZP_02176841.1| hypothetical protein HG1285_03123 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159883061|gb|EDP76565.1| hypothetical protein HG1285_03123 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 356

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/376 (42%), Positives = 222/376 (59%), Gaps = 30/376 (7%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS---CCAGQDVYDAR 77
           MRV V MSGGVDSSV A L+K  G++VIGVTL+ +++ +A + +G+   CC+ +DV DA 
Sbjct: 1   MRVAVGMSGGVDSSVTALLMKEKGHEVIGVTLR-FHTIEACEVEGTHNVCCSPKDVQDAA 59

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV   + + H  FD+E  F+  VI  F   Y+ G TP PC  CNR VK        R + 
Sbjct: 60  RVSQKLGIPHLTFDWERIFKERVIDYFVEEYSRGRTPNPCAVCNREVKTGYFARYLRAVA 119

Query: 138 -ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
             D LATGHY R    + +D    R++ R  D +RDQSYFL    ++ L  L FPLG+M 
Sbjct: 120 DIDRLATGHYAR----IEEDPSFGRVIKRGTDRKRDQSYFLALVRREDLDLLEFPLGNMT 175

Query: 197 KESVRDLAREMGLDIADKSDSQDICFV---QQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
           KE VR+LAR  GL++ADK DSQ++CF+     G+Y + +  +      EG+I H++G+ L
Sbjct: 176 KEEVRELARSYGLEVADKRDSQEVCFLMGKSPGEYLEKIVGLR-----EGEIRHVSGKTL 230

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW-LG 312
           GRH+GI N+TIGQRRGLG++  +PL+VV +D +++ V VG  E L   ++Y+RE+N  + 
Sbjct: 231 GRHSGIYNFTIGQRRGLGISYSKPLYVVDIDASTNTVFVGEEEYLYNDKLYVRELNLHVP 290

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSD 371
              +ED          +IR    PV V  V+R  DG  V F +   G+  GQ   FY+ D
Sbjct: 291 MERWEDVS-------AQIRYRHSPVRVESVKRTSDGYEVKFREEVRGITPGQVVAFYSGD 343

Query: 372 SNEARVLGGGIISGSK 387
                +LGGGII   K
Sbjct: 344 I----LLGGGIIEAYK 355


>gi|291519700|emb|CBK74921.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Butyrivibrio fibrisolvens 16/4]
          Length = 354

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 211/365 (57%), Gaps = 15/365 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS-KRKGSCCAGQDVYDARRV 79
           M+ ++AMSGGVDSSV A L+K +GY+ IG T++LY +         +CC+  DV DA+ V
Sbjct: 1   MKALIAMSGGVDSSVAALLMKENGYECIGCTMKLYGNEDVDLSDTSTCCSLDDVQDAKDV 60

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + HY ++++++F+  VI  F   Y    TP PC++CN+ +KF +L    ++LG D
Sbjct: 61  ARKLGMLHYTWNFKDQFKEKVIDNFTYCYEHAMTPNPCIECNKHLKFCELYRRAKELGCD 120

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            + TGHY R R    D+G +   + +  D  +DQSY L++ TQ +L    FPLG+  K+ 
Sbjct: 121 KIVTGHYARVR--KCDNGYQ---LLKGKDASKDQSYVLYSMTQDELAHTDFPLGEYSKDE 175

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A +     A+K DSQDICFV  G Y   +KR        GD V + G +LGRH G+
Sbjct: 176 IRRIAEKNEFVNANKPDSQDICFVPNGDYVSALKRFTGKEYEPGDFVDMEGNVLGRHKGL 235

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG++   PL+VV LD   ++V++G  E L    +Y+ +INW+G     + 
Sbjct: 236 VCYTIGQRKGLGISAAYPLYVVKLDTEKNQVVLGKNEDLFSRDVYVEDINWIG----PEE 291

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           + + F+C  K+R      P  VQR       + F++ +  +  GQ+ VFY  +     VL
Sbjct: 292 LPETFRCAAKVRYRMVEQPCEVQRLGKTSAKILFDEPQRAITPGQSAVFYDGEI----VL 347

Query: 379 GGGII 383
           GGGII
Sbjct: 348 GGGII 352


>gi|210615810|ref|ZP_03290791.1| hypothetical protein CLONEX_03009 [Clostridium nexile DSM 1787]
 gi|210150146|gb|EEA81155.1| hypothetical protein CLONEX_03009 [Clostridium nexile DSM 1787]
          Length = 362

 Score =  263 bits (673), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 147/369 (39%), Positives = 214/369 (57%), Gaps = 15/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK +GYDVIGVT+Q++    R   +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAYLLKEEGYDVIGVTMQIWQDEDRAIQEENGGCCGLTAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  ASDLGIPYYVMNFKKEFKENVIDYFVDEYLNGRTPNPCIACNRYVKWESLLKRSMDIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  + R   L +DQ+Y L+  TQ+QL     P+G   KE
Sbjct: 125 YIATGHYARIEKLPNG-----RYSLRRSATLAKDQTYALYNLTQEQLKRTLMPVGAYAKE 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR++A ++GL +A+K DSQDICFV  G Y + ++        EG+ V  +G ++GRH G
Sbjct: 180 EVREIAEKIGLRVANKPDSQDICFVPDGNYAEFIEETIEKKIPEGNFVLSDGTVVGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YT+GQR+GLG+++G P+FV+ +   ++ V++G  E    + +   ++N++     ++
Sbjct: 240 ITHYTVGQRKGLGLSLGHPVFVLEIRPETNEVVIGSNEESLTYTLRANQLNFMSIEDLKE 299

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              +  + F KIR +       V+R  +D V   FE+ +  V  GQA VFY  D     V
Sbjct: 300 G--EKIRVFAKIRYNHKGAWCEVERIGEDEVRCTFEEQQRAVTPGQAVVFYDGDY----V 353

Query: 378 LGGGIISGS 386
           LGGG I G 
Sbjct: 354 LGGGTIIGE 362


>gi|254519285|ref|ZP_05131341.1| tRNA-specific 2-thiouridylase mnmA [Clostridium sp. 7_2_43FAA]
 gi|226913034|gb|EEH98235.1| tRNA-specific 2-thiouridylase mnmA [Clostridium sp. 7_2_43FAA]
          Length = 360

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 139/367 (37%), Positives = 219/367 (59%), Gaps = 17/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GY+VIGVT++ ++       +R+G CC+   V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMKHFDDEDEDYIEREGGCCSLSSVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + +  YV ++++ F+  VI  F   Y  G+TP PC+ CN+ +KF + L   + +GAD
Sbjct: 64  ADKLGIPFYVLNFKDSFKEKVIDYFVQEYMEGKTPNPCIACNKHIKFDEFLRRAKGIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +++   +DG  R ++ +  D ++DQ+Y L+  TQ+QL     P GD  K+ 
Sbjct: 124 YVATGHY--AKIEKNEDG--RYLLIKADDDKKDQTYALYNFTQEQLSQTLMPCGDYTKDK 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R++A+E+GL + +K DS++ICF+    +   +         EG+ V  NG ILG+H GI
Sbjct: 180 IREIAKEIGLAVHNKKDSEEICFIPDNNHGKYILNARPNQVREGNFVDKNGNILGKHKGI 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFED 318
           + YTIGQR+GLG+A+G P+FV  ++  ++ V++GP E +    +  +++N++  + L E+
Sbjct: 240 VYYTIGQRKGLGLALGTPIFVTDINPRTNEVVIGPEEDVFKTDLVAKDVNFIPFNSLSEE 299

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
             V     F K+R    P    +    DG V V F++ +  +  GQ+ VFY  +     V
Sbjct: 300 ITV-----FAKVRYQAKPSEAIISPLADGRVKVSFKEKQRAITKGQSVVFYDGNV----V 350

Query: 378 LGGGIIS 384
           +GGGII 
Sbjct: 351 VGGGIIE 357


>gi|310821277|ref|YP_003953635.1| tRNA-specific 2-thiouridylase mnma [Stigmatella aurantiaca DW4/3-1]
 gi|309394349|gb|ADO71808.1| tRNA-specific 2-thiouridylase MnmA [Stigmatella aurantiaca DW4/3-1]
          Length = 348

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 159/364 (43%), Positives = 211/364 (57%), Gaps = 18/364 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MRVVVAMSGGVDSS  AALLK  G++VIG+TL+++ S +   + GSCC+  D+ DAR V 
Sbjct: 1   MRVVVAMSGGVDSSAAAALLKEQGHEVIGITLRVW-SYEGKAQCGSCCSPDDIDDARAVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV + EE F++ VI PF  SY  G TP+PCV CNR VKF+ LL   R LGA  
Sbjct: 60  QKLDIPFYVANAEEIFKDRVINPFVQSYLGGRTPIPCVACNRDVKFNFLLKRARALGAQ- 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R    V  +G  R ++ R +DL +DQSYFLF   Q +L D+ FP+G M K  V
Sbjct: 119 LATGHYAR----VEREGD-RHVLRRAVDLAKDQSYFLFTLGQAELADVLFPVGGMTKAEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A    L  + K +S +ICFV  G Y   V+++ AG    GDI+  +G +LG H GI 
Sbjct: 174 RAVAERHALPTSQKPESMEICFVPDGDYAGFVEKV-AGPQPSGDIIDTDGHVLGTHGGIH 232

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            +T+GQRRGL +  GE  +V  L+  ++RV+VG   +       L + +W+      D  
Sbjct: 233 RFTVGQRRGLNLGGGEARYVQRLEPEANRVVVGTASAAGRDAFGLLQPHWVDAPPAPDQT 292

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           V+     V+IR     VP  V+ +  G V V  E     V  GQA V Y  D    RVLG
Sbjct: 293 VE-----VRIRHRHAGVPGRVEISTHGLVSVRLEAPARAVTPGQAAVVYAQD----RVLG 343

Query: 380 GGII 383
           GG I
Sbjct: 344 GGWI 347


>gi|20807693|ref|NP_622864.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|24638309|sp|Q8RAH7|MNMA1_THETN RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|20516242|gb|AAM24468.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Thermoanaerobacter tengcongensis MB4]
          Length = 364

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 147/370 (39%), Positives = 216/370 (58%), Gaps = 14/370 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRV 79
           RVVV MSGGVDSSV A LLK  G++VIGVT++++     KA     SCC+ + ++DA++V
Sbjct: 6   RVVVGMSGGVDSSVTAYLLKEQGFEVIGVTMRVWVDPYGKARDDDKSCCSLKAIHDAKKV 65

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + HY  +  E F + ++  F   Y  G TP PCV CNR +KF DLL    +LGA 
Sbjct: 66  AEILGIPHYTVNLSEVFYDKIVKYFIDEYLKGRTPNPCVFCNRFIKFGDLLEKAHELGAY 125

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY+R      D+ ++R ++ + +D ++DQSY L+  TQ+QL    FPLG+  KE 
Sbjct: 126 YIATGHYVRKEY---DEDRKRYLLKKGLDFKKDQSYMLYRLTQEQLKHALFPLGNYTKEE 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR LA ++GL +ADK +SQ+ICF+    Y   +KR        G+   ++G  LG H GI
Sbjct: 183 VRALAEKIGLPVADKRESQEICFIPDNDYKAFIKRQIKKDVKPGEFRDIHGNFLGYHKGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           INYTIGQR+GLG++   PL+VV +D  ++ VIVG +E +    +     N++     E+ 
Sbjct: 243 INYTIGQRKGLGLSSDRPLYVVDIDPENNVVIVGHQEDVWGEELISSNNNFISIEKLEEE 302

Query: 320 VVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    K   KIR ++++   +     DD V V F + +  +  GQ+ VFY  D     V+
Sbjct: 303 I----KVTAKIRYTAKEDEAIIKPYGDDKVLVRFLRPQRAITPGQSVVFYDGDV----VV 354

Query: 379 GGGIISGSKR 388
           GGGII    R
Sbjct: 355 GGGIIEKKVR 364


>gi|167629936|ref|YP_001680435.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Heliobacterium modesticaldum Ice1]
 gi|205816855|sp|B0TFA7|MNMA_HELMI RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|167592676|gb|ABZ84424.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Heliobacterium modesticaldum Ice1]
          Length = 385

 Score =  262 bits (670), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 152/365 (41%), Positives = 202/365 (55%), Gaps = 16/365 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VVVAMSGGVDSSV AALL   GYDVIGVTLQ++        +G CC+   V DA+RV   
Sbjct: 5   VVVAMSGGVDSSVTAALLLEQGYDVIGVTLQIWPKDAPEGAEGGCCSLSAVEDAKRVASK 64

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + V HYV ++ + F   VI  F   Y AG+TP PC+ CNR +KF  LL  +  LGA  +A
Sbjct: 65  LGVPHYVLNFRDYFETEVIEYFGREYLAGQTPNPCIRCNRVIKFEGLLQKSLALGAAKVA 124

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY R      D    R  + R +D  +DQSY LF  TQ+QL    FPLG   K  +R+
Sbjct: 125 TGHYARIEQ---DSATGRYRLGRGIDANKDQSYALFNMTQEQLSRTLFPLGGFTKPEIRE 181

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVV-KRINAGIALEGDIVHLNGQILGRHNGIIN 261
            A ++GL +A K DSQ+ICF+    Y   + +R        G  V   G ++G H G+  
Sbjct: 182 KAAQLGLAVASKPDSQEICFIPDNDYRRFLEERYPDHRFQPGPFVDQEGNVIGTHRGLPF 241

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDAV 320
           YT+GQR+GLGVA G P +V+ LD   + V++GP E+++  R+   ++NW+   GL     
Sbjct: 242 YTVGQRKGLGVAFGFPAYVIALDVEHNAVVIGPDEAVKGRRLLADDLNWIDIAGLKAPME 301

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           V+      KIR S  P    +    DG  V V+F   +  +  GQA VFY  D     V+
Sbjct: 302 VE-----AKIRYSASPAIAVISPVKDGSAVIVEFAAPQRAITPGQAVVFYRGDW----VV 352

Query: 379 GGGII 383
           GGG I
Sbjct: 353 GGGTI 357


>gi|149921054|ref|ZP_01909513.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Plesiocystis pacifica SIR-1]
 gi|149818058|gb|EDM77515.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Plesiocystis pacifica SIR-1]
          Length = 367

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 154/371 (41%), Positives = 214/371 (57%), Gaps = 16/371 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK-RKGSCCAGQDVYDARRV 79
           MRVV AMSGGVDSSV AAL+   G++VIG+T+ LY+++   K R G+CC+  ++  ARR 
Sbjct: 1   MRVVCAMSGGVDSSVAAALMVEAGHEVIGLTMALYDAKGERKGRGGTCCSPAEIDLARRA 60

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           CD + V HY  D  ERF+ AVI  FA  Y AG TP PC  CN  VKF  LL+  R LGA+
Sbjct: 61  CDLLGVPHYTVDERERFQAAVIDDFAREYLAGRTPNPCARCNEHVKFGPLLARARALGAE 120

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +L TGHY +       DG+    + R +D  +DQSYFLFA  ++ L ++ FPLG   K  
Sbjct: 121 LLVTGHYAQIV-----DGEAGPALHRGVDASKDQSYFLFAMGRETLAEVAFPLGAWSKAQ 175

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE------GDIVHLNGQIL 253
           VR+ ARE+G+  AD  DSQ++CFV  G + +VV+     + L+      G I   +G +L
Sbjct: 176 VREKARELGMPNADAPDSQELCFVPGGDHGEVVEARAKALGLDTARLEPGPIRDESGAVL 235

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H GI   T+GQRRGLGV+   P +V+ +  +   V+VG  E LEV  + + +   L D
Sbjct: 236 GEHRGIHRVTVGQRRGLGVSADRPRYVLRVLPSERAVVVGDPEGLEVRELMVGDFRALAD 295

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
               + +    +  V+ RS+  P  V +   +  + V F++    VA GQA V Y  + +
Sbjct: 296 LPVGEPIA--ARVQVRHRSAASPATVEIL-GEGALKVRFDQPIRAVAPGQAAVVYAGERD 352

Query: 374 EA-RVLGGGII 383
              RVLGGG I
Sbjct: 353 AGDRVLGGGWI 363


>gi|292670858|ref|ZP_06604284.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas noxia ATCC 43541]
 gi|292647479|gb|EFF65451.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas noxia ATCC 43541]
          Length = 365

 Score =  262 bits (669), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 153/372 (41%), Positives = 214/372 (57%), Gaps = 14/372 (3%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL-YNSRKASKRKGSCCAGQD 72
           +++  K  RVVVAMSGGVDSS+ AALL+  GYDV+GVT++L   +R A     SCC+   
Sbjct: 1   MERKMKKERVVVAMSGGVDSSLAAALLQERGYDVVGVTMRLSAENRDAPSNDRSCCSLIS 60

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
           V DARRV D + + HYV D+ E F++AVI  F + Y  G TP PC+ CNR +KF  LL  
Sbjct: 61  VDDARRVADVLGIPHYVMDFTEPFQHAVIDYFFNEYLHGRTPNPCIACNRFIKFEGLLHK 120

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
           +++LGA  +ATGHY  +R+  G DG  R  + + +DLE+DQSY L+   Q+ L  +  PL
Sbjct: 121 SKELGASYIATGHY--ARIDHGKDGTYR--LRKGLDLEKDQSYVLYHMNQEILAHVLLPL 176

Query: 193 GDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQI 252
           G   K   R +A +  L +A K++SQ+ICFV +  Y   ++         G+IV   G +
Sbjct: 177 GVFSKHETRRMAEQYHLPVAYKAESQEICFVPRDDYKSYLREKRPESCCPGNIVDRAGNV 236

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LG H GI  YTIGQR+GLG+A  +PL+V  LD   +RV+VG    +    +   ++NW  
Sbjct: 237 LGIHEGIAFYTIGQRKGLGIAATQPLYVTALDTLHNRVVVGTANEVYARGLTASDLNW-- 294

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSD 371
                 A+ +      KIR  +      +  + DG V+V F + +  V  GQ+ VFY  D
Sbjct: 295 --TMPIALDNPRTVQAKIRYGKRSASATITSHKDGEVHVLFSELQRAVTPGQSIVFYEDD 352

Query: 372 SNEARVLGGGII 383
                VLGGGII
Sbjct: 353 V----VLGGGII 360


>gi|309388972|gb|ADO76852.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halanaerobium praevalens DSM 2228]
          Length = 360

 Score =  262 bits (669), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 219/368 (59%), Gaps = 17/368 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V++AMSGGVDSSV AALLK +GY+VIG T+ ++ +  +A+ R+  CC+   V DA+RV 
Sbjct: 3   KVMIAMSGGVDSSVAAALLKEEGYEVIGGTMHIFPDYEEATDREDHCCSYSAVRDAKRVA 62

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + H+VF+  E F+  VI  F   Y+ G TP PCV CN+ +KF+ L     ++G D 
Sbjct: 63  QKLEIPHFVFNLREEFQEKVIDYFVDEYSLGRTPNPCVMCNKEIKFAALHKKAIEIGCDY 122

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +A+GHY +     G     R I+ + +D  +DQSY L+   Q+QL    FPL +  K  +
Sbjct: 123 IASGHYAKIEKENG-----RYILKKGLDENKDQSYMLYVLNQEQLSQTLFPLSEYTKSEI 177

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R+ A+ +G +I +K++SQ+ICFV    Y   +      I+  G I+   G  +G H G+ 
Sbjct: 178 REKAKNLGFEIHNKAESQEICFVPDDDYVRFLDNNYPEISNTGPILDSEGNKVGEHEGLA 237

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQRRGLG++MG P++V  LD   + VIVG  +S+    +   E+N++    FED  
Sbjct: 238 HYTIGQRRGLGISMGYPIYVTNLDYEKNAVIVGKDKSVFSDGLIAEELNFIP---FED-- 292

Query: 321 VDG-FKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +DG  +   +IR +  PV  ++++  +D V V+FE+++  V  GQ+ VFY  D     VL
Sbjct: 293 IDGRMEVEAQIRYNSFPVKAYIEKIKNDEVKVEFEEAQRAVTPGQSVVFYLGD----LVL 348

Query: 379 GGGIISGS 386
           GGGII  S
Sbjct: 349 GGGIIKKS 356


>gi|166367576|ref|YP_001659849.1| tRNA-specific 2-thiouridylase MnmA [Microcystis aeruginosa
           NIES-843]
 gi|205816884|sp|B0JVR4|MNMA_MICAN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|166089949|dbj|BAG04657.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Microcystis aeruginosa NIES-843]
          Length = 352

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 157/367 (42%), Positives = 216/367 (58%), Gaps = 21/367 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA L   GYDVIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSVAAAALHAQGYDVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H++ D  E F+  +I    S Y AG TPLPC  CN+ VKFS +L   R+ L  D 
Sbjct: 56  QLGVPHHIVDSRELFQKEIIDYLVSGYEAGITPLPCSQCNKAVKFSPMLHYARETLQTDT 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    ++   R  + R +D  +DQSYFL+  TQ  L    FPLG+  K   
Sbjct: 116 IATGHYARIRFSPENN---RYQLLRAVDQNKDQSYFLYDLTQDVLRGTLFPLGEQTKAET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNGI 259
           R +A+E GL  ADK DSQD+C ++   +  +   ++  IA+ EGDIV L+G++LG+H+GI
Sbjct: 173 RRIAQEFGLKTADKPDSQDLCLIE--AHGTMRSFLDKYIAVSEGDIVDLDGKVLGKHSGI 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+G+G+A  EPL+VV LD   +RVIVG RES       +  +NW+   + E  
Sbjct: 231 HHYTIGQRKGIGIAAAEPLYVVKLDPVMNRVIVGNRESAVSAACLVGRMNWV--SIAEPT 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                +  V+ RS   PV V    N+  V + F++ +  +  GQA V Y  +     VLG
Sbjct: 289 TPIRAQVQVRYRSPAVPVNVIPLENNQ-VKLVFDQPQFSITPGQAAVIYEGEI----VLG 343

Query: 380 GGIISGS 386
           GGIISG+
Sbjct: 344 GGIISGA 350


>gi|210622568|ref|ZP_03293250.1| hypothetical protein CLOHIR_01198 [Clostridium hiranonis DSM 13275]
 gi|210154151|gb|EEA85157.1| hypothetical protein CLOHIR_01198 [Clostridium hiranonis DSM 13275]
          Length = 357

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 137/364 (37%), Positives = 221/364 (60%), Gaps = 16/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V++ MSGGVDSSV A LLK  GYDVIGV + L N     +++        + DARRV +
Sbjct: 4   KVMLGMSGGVDSSVAAYLLKEQGYDVIGVNMMLSNDNTEEEKR---MTEDSIRDARRVAE 60

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            +++  +V D+   F+  VI  F   YA G TP PC+ CN+ +KF     V  + G D +
Sbjct: 61  KLDIPLHVLDFRREFKEKVIDDFIKEYAEGRTPNPCIVCNKFIKFGLFFDVAEKFGCDYV 120

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R      D+   R ++ +    ++DQ+Y L+   Q+QL  +  P+G+ +K++VR
Sbjct: 121 ATGHYARVER---DEKTGRLVLKKGESAKKDQTYNLYNIKQEQLERILLPIGNYEKDTVR 177

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQILGRHNGII 260
           ++A+++GLD+ +K DSQ+ICF++   Y   +K  N+ I ++ G+ V  +G +LG+HNGII
Sbjct: 178 EIAKKIGLDVHNKKDSQEICFIKDNDYVRYLKE-NSDIKIKTGEFVEADGTVLGKHNGII 236

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           NYTIGQR+GLG+A G+P+FVV ++   +RV++G  + L    + ++++N +    F+ A 
Sbjct: 237 NYTIGQRKGLGIAFGKPMFVVDINAKKNRVVLGSNDDLFKKELVIKDVNTIP---FDFAD 293

Query: 321 VDGFKCFVKIRSSQDP-VPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           VD FK + K+R +  P +    + +D+   V FE+++  +  GQ+ V Y  D     ++G
Sbjct: 294 VDEFKVYAKVRYAAKPSLATVTKLSDNTAKVVFEEAQRAITKGQSLVMYDGDI----LVG 349

Query: 380 GGII 383
           GGII
Sbjct: 350 GGII 353


>gi|197303193|ref|ZP_03168235.1| hypothetical protein RUMLAC_01916 [Ruminococcus lactaris ATCC
           29176]
 gi|197297733|gb|EDY32291.1| hypothetical protein RUMLAC_01916 [Ruminococcus lactaris ATCC
           29176]
          Length = 358

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 210/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++   + +  +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEENTVQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              I + +YV ++++ F+ +VI  F   Y AG TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  AAAIGIPYYVMNFKDEFQKSVIEYFTKEYLAGRTPNPCIACNRYVKWEALLQRSLSIGAD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +      R  + R   +E+DQ+Y L+  TQ+QL     P+G+  K+ 
Sbjct: 125 YIATGHYAR----IEHLPNGRYAIRRSATMEKDQTYALYNLTQEQLARTLMPVGEYSKDR 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R++A E+GL +A K DSQDICFV  G Y   ++     +   G+ V   G++LG+H GI
Sbjct: 181 IREMADEIGLLVAHKPDSQDICFVPDGDYASFIENTTDQVLPTGNFVTPEGKVLGKHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YT+GQR+GLG+A+G P FV+ +   ++ V++G  E    + +   E+N++      + 
Sbjct: 241 IHYTVGQRKGLGLALGYPAFVLEIRPETNEVVIGTYEESLTYTVRANELNFMS----VEQ 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           + +  + F KIR +       V+R  +D +   F++       GQA V Y  +     VL
Sbjct: 297 ITEPVRIFAKIRYNHKGAWCTVERTGEDEIVCTFDEPIRAATPGQAVVLYDGE----YVL 352

Query: 379 GGGII 383
           GGG I
Sbjct: 353 GGGTI 357


>gi|219849660|ref|YP_002464093.1| tRNA-specific 2-thiouridylase MnmA [Chloroflexus aggregans DSM
           9485]
 gi|254811448|sp|B8G5F1|MNMA_CHLAD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|219543919|gb|ACL25657.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Chloroflexus aggregans DSM 9485]
          Length = 359

 Score =  261 bits (667), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 218/364 (59%), Gaps = 15/364 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V+VAMSGGVDSS+ AALL+  G+ V GVT+ L++  +   R+  CCA +    ARRVC  
Sbjct: 4   VLVAMSGGVDSSLAAALLQEAGHQVTGVTMHLWDDDEQGLRESLCCAAEAATSARRVCAL 63

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + +  YVF+Y+  FR  VI  F  +Y  G TP PCV+CNR +KF  LL   R LG D +A
Sbjct: 64  LGIPFYVFNYQREFRRHVIEYFIRAYTHGLTPNPCVECNRMIKFRALLDRARALGFDAVA 123

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY R    V DD  R ++  R +D E+DQSY L    Q  L  L FP+G+  K+ VR+
Sbjct: 124 TGHYAR---IVRDDCGRYQLW-RAVDTEKDQSYMLHMLGQADLARLLFPIGEYTKQQVRE 179

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNGIIN 261
           +A    L  A++ +SQDICFV  G Y +++ RI A  +L  G IV L G+ +GRH G+  
Sbjct: 180 MAAARCLPSANREESQDICFVPDGDYRNLL-RIEAPESLIPGPIVDLEGREIGRHRGLPL 238

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YT+GQRRGLG+  GEP +VV +D   + +IVGP E+L   R  + +  W+ D        
Sbjct: 239 YTVGQRRGLGLGGGEPRYVVAIDPARNALIVGPVEALNRERFIVTDARWVDDA----PPA 294

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
           + F C V++R+  +P+P  V    DG + V+ E+ +  V+ GQA VFY    +  RVLGG
Sbjct: 295 ETFHCQVQVRAHAEPLPARVSAQPDGRWLVELERPQRAVSPGQAAVFY----DGVRVLGG 350

Query: 381 GIIS 384
           G I+
Sbjct: 351 GWIA 354


>gi|153005212|ref|YP_001379537.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter sp. Fw109-5]
 gi|205811178|sp|A7HCV7|MNMA_ANADF RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|152028785|gb|ABS26553.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter sp. Fw109-5]
          Length = 349

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 155/363 (42%), Positives = 205/363 (56%), Gaps = 15/363 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MRV+VA+SGGVDSS  AALL  +G+DVIGV++++ +   A +R  SCCA  D+ DAR   
Sbjct: 1   MRVLVALSGGVDSSTAAALLVAEGHDVIGVSMRVADYSDA-RRGRSCCAPDDLEDARAAA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV + E RFR  VI PF   Y  G TP PCV CN  VKF  LL+  R LGA  
Sbjct: 60  RRLDIPFYVANVEARFRERVIEPFVRDYVEGRTPNPCVACNSDVKFDWLLARARALGAK- 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R     G     R  +CR  D  +DQ+YFL+   Q+ L D+ FP+GD+ K  V
Sbjct: 119 LATGHYARVERRGG-----RFALCRAGDPAKDQTYFLYGLGQEALRDVLFPVGDLAKRDV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A+K++SQ+ICFV QG   D V     G    G+IV   G++LGRH+G+ 
Sbjct: 174 RAVAAQAGLPNAEKAESQEICFVTQGDAGDFVALRAPGSVRAGEIVSTAGEVLGRHDGVH 233

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            +T+GQRRGLG+A   P +VV L+  ++RV+VG        R  + E+ W+        V
Sbjct: 234 RFTVGQRRGLGLAGPAPRYVVRLEPGTARVVVGSAGEASRDRFAVTEVRWIAGAPPPRPV 293

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                  VK+R   +     V  +  G  V   +   GVA GQA VFY  D     VLGG
Sbjct: 294 A----ARVKVRHRHEGEEGTVTPDGGGGQVRLARPVRGVAPGQAAVFYDGDE----VLGG 345

Query: 381 GII 383
           G I
Sbjct: 346 GRI 348


>gi|220931733|ref|YP_002508641.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halothermothrix orenii H 168]
 gi|259495830|sp|B8CWH7|MNMA_HALOH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|219993043|gb|ACL69646.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Halothermothrix orenii H 168]
          Length = 358

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/364 (38%), Positives = 209/364 (57%), Gaps = 14/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           RV+VAMSGGVDSSV AALLK  GY+VIG T++++ +  +    +G CC+   + DARRV 
Sbjct: 3   RVLVAMSGGVDSSVTAALLKEQGYEVIGGTMEIFPDYEQPPLDEGGCCSLSSIEDARRVA 62

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             I + HY F+ ++ F   VI  F + Y    TP PCV CN  +KF  LL    +L AD 
Sbjct: 63  HHIGIRHYTFNLKKVFEEEVINNFVNEYKNARTPNPCVVCNNEIKFRSLLKKALELDADY 122

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      V  +   + ++ +  D+++DQ+Y L+  TQ QL     PLG+  K+ V
Sbjct: 123 IATGHY----AIVEHNVNGKHLLKKAKDVDKDQTYMLYGLTQFQLSHTLMPLGNYTKQEV 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A++ G  I +K +SQ+ICFV    Y   +     G+   G ++  +G ILG+H G+ 
Sbjct: 179 RQMAKDFGFRIHNKPESQEICFVPDNNYTRFLDENYPGLGKPGPVMDTDGNILGKHKGLH 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQRRGLG+++G P++VV LD+  + VI+GP E +    +   ++NW+      D +
Sbjct: 239 HYTIGQRRGLGISLGYPVYVVKLDREKNAVIIGPEEEVYSKSLIANKVNWISI----DKL 294

Query: 321 VDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            +  K   +IR +S +        ND+ V V F+K +  V  GQ+ VFY        V+G
Sbjct: 295 TEPIKVTARIRYNSPESHAKIYPVNDNEVKVVFDKKQRAVTPGQSVVFYDGKV----VVG 350

Query: 380 GGII 383
           GGII
Sbjct: 351 GGII 354


>gi|309790491|ref|ZP_07685051.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oscillochloris trichoides DG6]
 gi|308227478|gb|EFO81146.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oscillochloris trichoides DG6]
          Length = 359

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 209/363 (57%), Gaps = 13/363 (3%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           ++VAMSGGVDSS+ AALL   G+ V+GVT+ L++       +  CC+ +    ARRVC+ 
Sbjct: 4   IMVAMSGGVDSSLTAALLHEQGHTVVGVTMHLWDGDDDHLAESLCCSLEMTASARRVCNQ 63

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + +YVF+Y+  FR AV+  F  +Y+ G TP PC+ CNR +KF  LL+   QLG D +A
Sbjct: 64  LGIPYYVFNYQREFRRAVVDAFVHAYSHGYTPNPCIACNREIKFRALLARANQLGYDYVA 123

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY+R R+    D  + +++ R  D  +DQSY L+   Q +L  L FPLG+ +K  VR 
Sbjct: 124 TGHYVRRRV---TDANQYKLL-RAHDHGKDQSYVLYMLGQTELARLLFPLGEYQKSEVRA 179

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A   GL+ AD+ +SQDICFV  G Y  +++       + G IV  +G+ +G+H G+  Y
Sbjct: 180 MATARGLESADRPESQDICFVPDGDYRQLLRTEAPASLVPGPIVDQHGREVGQHQGLPLY 239

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQRRGLGV    PL+V  LD   + +IVGP  +L  H  ++   + +     E     
Sbjct: 240 TIGQRRGLGVYAATPLYVTGLDTARNTLIVGPAAALLRHEFWVEAASSVAATWPESP--- 296

Query: 323 GFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
            F C V++R+     P  V  +  + +++  +     ++ GQA V Y  +    RV+GGG
Sbjct: 297 -FTCEVQVRAHGATAPATVTAHPGERLHIQLQSPIRAISPGQAAVLYAGE----RVIGGG 351

Query: 382 IIS 384
            I+
Sbjct: 352 TIA 354


>gi|159028008|emb|CAO87968.1| trmU [Microcystis aeruginosa PCC 7806]
          Length = 352

 Score =  260 bits (665), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 157/367 (42%), Positives = 217/367 (59%), Gaps = 21/367 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA L   GYDVIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSVAAAALHAQGYDVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H++ D  E F+  +I    S Y AG TPLPC  CN+ VKFS +L   R+ L  D 
Sbjct: 56  QLGVPHHIVDSRELFQKEIIDYLVSGYEAGITPLPCSQCNKAVKFSPMLHYARETLETDT 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R     +  R ++M R +D  +DQSYFL+  TQ  L    FPLG+  K   
Sbjct: 116 IATGHYARIRF--SPENNRYQLM-RAVDKNKDQSYFLYDLTQDVLRGTLFPLGEQTKAET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNGI 259
           R +A+E GL  ADK DSQD+C ++   +  +   ++  IA+ EGDIV L+G++LG+H+GI
Sbjct: 173 RRIAQEFGLKTADKPDSQDLCLIE--AHGTMRSFLDKYIAVSEGDIVDLDGKVLGKHSGI 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+G+G+A  EPL+VV LD   +RVIVG RES       +  +NW+   + +  
Sbjct: 231 HHYTIGQRKGIGIAAAEPLYVVKLDPVMNRVIVGNRESAVSADCLVGRMNWV--SIAQPT 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                +  V+ RS   PV V    N+  V + F++ +  +  GQA V Y  +     VLG
Sbjct: 289 TPIRAQVQVRYRSPAVPVNVIPLENNQ-VKLVFDEPQFSITPGQAAVIYEGEI----VLG 343

Query: 380 GGIISGS 386
           GGIISG+
Sbjct: 344 GGIISGA 350


>gi|219669597|ref|YP_002460032.1| tRNA-specific 2-thiouridylase MnmA [Desulfitobacterium hafniense
           DCB-2]
 gi|219539857|gb|ACL21596.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Desulfitobacterium hafniense DCB-2]
          Length = 370

 Score =  260 bits (665), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/369 (39%), Positives = 206/369 (55%), Gaps = 15/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV MSGGVDSS+ AALLK +GY+VIG+TLQ   S       G CC+   + DARRV  
Sbjct: 8   KVVVGMSGGVDSSMAAALLKEEGYEVIGITLQTMPS-GGPDDVGGCCSITAIDDARRVAH 66

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV ++   F   VI  F ++Y +GETP PC  CNR V++ + L   R LGAD L
Sbjct: 67  QLGIPHYVLNFRTIFEENVIDYFTNAYLSGETPNPCTMCNRVVRWGEFLRKARALGADYL 126

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +    + D    R +M RP+D  +DQ+Y L+  TQ QL    FPL D KKE +R
Sbjct: 127 ATGHYAK---ILQDPDSGRYLMSRPVDTWKDQTYMLYNLTQDQLKHTLFPLADYKKEHIR 183

Query: 202 DLAREMGL-DIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           ++A E GL  ++ K DSQ+ICF+    Y   ++  +      G+ V   G ILGRH G+I
Sbjct: 184 EMAAERGLLRVSRKPDSQEICFIPDDDYVSFIRERSPDKIKPGNFVDRQGNILGRHQGLI 243

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           NYT+GQR+GLGV  G+P+FV+  +   + VI+G  + +  H +   ++NW+     E  +
Sbjct: 244 NYTVGQRKGLGVTFGKPMFVLGFNVEGNEVILGEDQEVYAHTLLATDLNWIAITGLEGPL 303

Query: 321 VDGFKCFVKIRSSQDP-VPVFVQRNDDG-----VYVDFEKSEVGVASGQACVFYTSDSNE 374
               K   K   ++   +P+       G     V V+F   +  +  GQA VFY  D   
Sbjct: 304 TVQAKIRYKAPLAEAKIIPLKDSETLPGAIGPVVRVEFTTPQRAITPGQAVVFYQGD--- 360

Query: 375 ARVLGGGII 383
             V+GGG I
Sbjct: 361 -LVVGGGKI 368


>gi|291550046|emb|CBL26308.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus torques L2-14]
          Length = 358

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/367 (40%), Positives = 215/367 (58%), Gaps = 19/367 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN--SRKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++     +  +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEENEVQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             +I + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  ASSIGIPYYVMNFKQEFQKNVIDYFTKEYLNGRTPNPCIACNRYVKWEALLQRSLSIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  + R   L +DQ+Y L+  TQ+QL     P+G+  K+
Sbjct: 125 YIATGHYARIDKLSNG-----RYAIRRSATLAKDQTYALYNLTQEQLEHTLMPVGNYSKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHN 257
            +R++A ++GL +A+K DSQDICFV  G Y   ++  NA   + +G+ V  +G+ILG+H 
Sbjct: 180 QIREMAEKIGLQVANKPDSQDICFVPDGDYASFIEE-NADTPIRQGNFVTPDGKILGKHK 238

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GII+YT+GQR+GLG+A+G P FV+ +   +  V++G  E    H +   E+N++     E
Sbjct: 239 GIIHYTVGQRKGLGLALGYPAFVLEIRPETDEVVIGTYEESLTHTLRANELNFMS---VE 295

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           D + +  + F KIR +       V++  +D +   F++    V  GQA V Y  +     
Sbjct: 296 D-LTEPMRVFAKIRYNHKGAWCTVEKTGEDEITCTFDEPIRAVTPGQAVVLYDGE----Y 350

Query: 377 VLGGGII 383
           VLGGG I
Sbjct: 351 VLGGGTI 357


>gi|331091036|ref|ZP_08339878.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405258|gb|EGG84794.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 360

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 211/367 (57%), Gaps = 15/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    R   +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAHLLKEQGYDVIGVTMQIWQDEDRAIQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  AGQLEIPYYVMNFKKEFKKEVIDYFIEEYRQGRTPNPCIACNRYVKWESLLKRSMDIGAD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +R+   ++G  R  + R   L +DQ+Y L+  TQ QL     P+G+  K+ 
Sbjct: 125 YIATGHY--ARIVKLENG--RYTLKRSATLAKDQTYALYNLTQNQLSHTLMPVGEYTKDE 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A ++ L +A+K DSQDICFV  G Y   ++         G+ V LNG ILG+H GI
Sbjct: 181 IRQIAEKIHLQVANKPDSQDICFVPDGDYASFIEETTGERIQTGNFVDLNGNILGQHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YT+GQR+GLG+++G P FV+ +   ++ V++G  E    + +    +N++     E  
Sbjct: 241 IHYTVGQRKGLGLSLGRPAFVLEIRPETNEVVIGTNEDAMSYTLRANHLNFMSISDLEGE 300

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +      F KIR +       +++ ++D V   F++ +  +  GQA VFY    ++  V+
Sbjct: 301 M----HVFAKIRYNHKGAWCTIKKTSEDEVLCTFDEPQRAITPGQAVVFY----DDEYVI 352

Query: 379 GGGIISG 385
           GGG I G
Sbjct: 353 GGGTIIG 359


>gi|114776442|ref|ZP_01451487.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mariprofundus ferrooxydans PV-1]
 gi|114553272|gb|EAU55670.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mariprofundus ferrooxydans PV-1]
          Length = 374

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 156/368 (42%), Positives = 203/368 (55%), Gaps = 18/368 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN-SRKASKRKGSCCAGQDVYDAR 77
           K +RV+ AMSGGVDSSV+A LLK  G DVIGV L +++ SR    R GSCC+ +D YDAR
Sbjct: 20  KGVRVIAAMSGGVDSSVMAVLLKEAGVDVIGVFLNVWDYSRDEVNRHGSCCSLEDSYDAR 79

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV D I +  Y  D  + FR  VI PF   Y  G TP PC  CNR VKF  LL    +L 
Sbjct: 80  RVADHIGIPFYAMDMRDEFRRDVIDPFIQDYETGRTPNPCERCNRFVKFGALLEAADKLE 139

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A  +ATGHY+R R    DD     +  +  D  +DQSYFL  T + Q   + FP+G ++K
Sbjct: 140 AAYVATGHYVRRR----DDNDGIHLF-KGNDARKDQSYFLATTNRAQAERILFPVGGLEK 194

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRH 256
           +  R LA    L  ADK +SQDICF+  G     +KR  A     EGDIV   G+ILGRH
Sbjct: 195 DDTRRLAHFYKLPTADKHESQDICFIPAGDRIAFLKREGAEAGFREGDIVDTTGRILGRH 254

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GI +YT+GQR+GLG+  G P  VV LD  ++RV V   E   +  + + E  W+ +   
Sbjct: 255 QGIAHYTLGQRKGLGLPDG-PWHVVALDGATARVTVAHPEDAMIGGVDVSEAVWIREPKS 313

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
            +AV        K+R    P    ++  D+ + V F + +   A GQ   FY  D     
Sbjct: 314 GEAVT------AKVRYQMQPAACVLEHFDESLRVTFAQPQKPSAPGQVAAFYAGDE---- 363

Query: 377 VLGGGIIS 384
           +LGGGI+S
Sbjct: 364 LLGGGIVS 371


>gi|110802009|ref|YP_699068.1| tRNA-specific 2-thiouridylase MnmA [Clostridium perfringens SM101]
 gi|123047295|sp|Q0SS39|MNMA_CLOPS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110682510|gb|ABG85880.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens SM101]
          Length = 359

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 211/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV 
Sbjct: 5   KVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD 
Sbjct: 65  QKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +
Sbjct: 125 VATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKI 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H GI+
Sbjct: 180 REIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRTGNFVDKYGNVLGKHKGIV 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     ED +
Sbjct: 240 YYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLEDPM 299

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V+G
Sbjct: 300 ----EVEAKIRYSAKPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LVVG 351

Query: 380 GGIIS 384
           GGII 
Sbjct: 352 GGIIE 356


>gi|147677391|ref|YP_001211606.1| tRNA-specific 2-thiouridylase MnmA [Pelotomaculum thermopropionicum
           SI]
 gi|205816885|sp|A5D3F0|MNMA_PELTS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146273488|dbj|BAF59237.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase [Pelotomaculum thermopropionicum SI]
          Length = 365

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 145/371 (39%), Positives = 220/371 (59%), Gaps = 15/371 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG--SCCAGQDVYDA 76
           +  +VVVAMSGGVDSSV AALL   G++VIG+T+Q++N  + ++ KG  +CC+   + DA
Sbjct: 2   EKTKVVVAMSGGVDSSVTAALLLEQGFEVIGITMQIWNPGEEAESKGERTCCSLTAIDDA 61

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV D + +SHYV ++   F   VI  F S Y  G TP PC+ CNR VKF  LL     +
Sbjct: 62  RRVADKLGISHYVLNFRSIFEEKVIDYFTSEYLRGRTPNPCIACNRYVKFEALLDRALSI 121

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GA+ +ATGHY R   Y G+ G  R  + RP+D  +DQ+Y L+  TQ+Q+     PLG+  
Sbjct: 122 GAEYIATGHYARLG-YSGEYG--RYTVRRPVDRRKDQTYVLYGMTQRQIARTMMPLGNYT 178

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR +A + GL +A K++SQ+ICF+    Y   ++   AGI   G  +++ G+++GRH
Sbjct: 179 KGQVRKIAEDFGLPVAGKAESQEICFILDDDYRRFLREKAAGIK-PGPFLNMKGEVIGRH 237

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           NGI  YT+GQRRGLG+A GE L+VV +D  ++ + +GP E++    +   ++N +   L+
Sbjct: 238 NGIPFYTVGQRRGLGLAAGERLYVVKIDPENNAITLGPEEAVWGRSLIAADVNLI---LY 294

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
           E ++ +  +   ++R +    P  +    +G V V F   +  +  GQA VFY  D    
Sbjct: 295 E-SLEEPLEVEAQVRYNARTSPATLVPLPEGRVGVHFHTPQRSITPGQAVVFYRGDY--- 350

Query: 376 RVLGGGIISGS 386
            ++GG  I  +
Sbjct: 351 -LIGGATIEST 360


>gi|291522307|emb|CBK80600.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Coprococcus catus GD/7]
          Length = 368

 Score =  259 bits (662), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 201/365 (55%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++   +       G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKQQGYDVIGVTMQIWQEEEDEIVEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + I + +YV ++ E FR  VI  F S Y  G TP PC+ CNR VK+  LL     LGAD
Sbjct: 65  AERIGIPYYVMNFREVFREKVIDNFVSEYEKGRTPNPCIVCNRYVKWEALLEKALALGAD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    V     R  I     D  +DQ+Y L+   Q QL     P+G   K  
Sbjct: 125 YIATGHYAR---IVHLPNGRYAIEKAAFD-RKDQTYALYNLNQHQLAHTLMPVGAYDKSE 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A E+GL +A+K DSQDICFV  G Y   ++        EGD V  NG++LG H GI
Sbjct: 181 VRRIAGEIGLSVANKMDSQDICFVSDGNYQAFIEDYTGKKLPEGDFVDKNGKVLGHHRGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YTIGQR+GL +AMG P+FV  ++   +++I+G  + L    +Y   +N +     ++ 
Sbjct: 241 GAYTIGQRKGLNLAMGHPVFVTGINPEENKIIIGENDELFQRALYASNVNLMSRASLDEP 300

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           V    +   KIR +    P   ++  DG +YV F++ +  +  GQA V Y  D     V 
Sbjct: 301 V----RLTAKIRYAHKAAPCIARQLPDGSLYVCFDEPQRAITPGQAVVLYDGD----LVA 352

Query: 379 GGGII 383
           GGGII
Sbjct: 353 GGGII 357


>gi|313905756|ref|ZP_07839115.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium cellulosolvens 6]
 gi|313469362|gb|EFR64705.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium cellulosolvens 6]
          Length = 363

 Score =  259 bits (662), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 208/368 (56%), Gaps = 13/368 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK--RKGSCCAGQDVYDA 76
           KD  VVV MSGGVDSSV A LLK  GY+VIGVT+Q++      +   +G CC    V DA
Sbjct: 4   KDKTVVVGMSGGVDSSVAAYLLKEQGYNVIGVTMQIWQDESECRLENEGGCCGVTAVEDA 63

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV   + + +YV +++E F+  VI  F   Y  G TP PC+ CNR VK+  LL+ +  +
Sbjct: 64  RRVAGVLGIPYYVMNFKEEFQKNVIDYFVDEYLHGRTPNPCIACNRYVKWESLLTKSLAI 123

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           GAD +ATGHY R R    D+G  R  +   +  ++DQ+Y L+  TQ QL     P+GD +
Sbjct: 124 GADYIATGHYARIRHL--DNG--RYAIANSVTAKKDQTYALYGLTQNQLAHTLMPVGDYE 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K  VR++A   GL +A KSDSQ+ICFV  G Y   ++R +  +  EG+ V  +G++LGRH
Sbjct: 180 KPKVREIAERAGLPVAHKSDSQEICFVPDGDYASFIERDSGIVMPEGNFVTKDGEVLGRH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GI +YT+GQRRGL + MG  +FV  +   ++ V+VG  E +    +    +N++G G  
Sbjct: 240 RGITHYTVGQRRGLDLPMGRRVFVTEIRPETNEVVVGEAEDVWSETLKANRLNFMGIGDL 299

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
                D F    KIR +       V+R  +D +   F+     V  GQA VFY  D    
Sbjct: 300 PLGEEDHF--LAKIRYNHAGTGCRVKRTGEDEITCVFDDPVRAVTPGQALVFYKDDY--- 354

Query: 376 RVLGGGII 383
            V GGG+I
Sbjct: 355 -VAGGGVI 361


>gi|154503928|ref|ZP_02040988.1| hypothetical protein RUMGNA_01754 [Ruminococcus gnavus ATCC 29149]
 gi|153795527|gb|EDN77947.1| hypothetical protein RUMGNA_01754 [Ruminococcus gnavus ATCC 29149]
          Length = 356

 Score =  259 bits (661), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 146/367 (39%), Positives = 216/367 (58%), Gaps = 17/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN--SRKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    + A +  G CC    V DARRV
Sbjct: 3   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEEQAAQEENGGCCGLSAVDDARRV 62

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GA+
Sbjct: 63  AAALEIPYYVMNFKKEFKENVIDYFVEEYQNGRTPNPCIACNRYVKWESLLQRSLSIGAE 122

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +R+   ++G  R  + R   L +DQ+Y L+  TQ+QL     P+G   K+ 
Sbjct: 123 YIATGHY--ARVVQLENG--RYTLRRSATLAKDQTYALYNLTQEQLKRTLMPVGKYTKDE 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNG 258
           VR +A ++ L IA+K DSQDICFV  G Y   ++   AG+ + EG+ V  +G +LGRH G
Sbjct: 179 VRAIAEKINLRIANKPDSQDICFVPDGDYAAYIEE-EAGVKVPEGNFVLTDGTVLGRHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YT+GQR+GLG+A+G P FV+ +   ++ V++G +E     ++  R +N++     ED
Sbjct: 238 ITHYTVGQRKGLGLALGYPAFVLEIRPETNEVVIGTKEESMTTQLRARNLNFMA---VED 294

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +    F KIR +       +++  +D V   F++ +  V  GQA VFY  +     V
Sbjct: 295 -LTEPLHVFTKIRYNHKGAWCTIEKTGEDEVLCTFDEPQRAVTPGQAVVFYDGEY----V 349

Query: 378 LGGGIIS 384
           LGGG I 
Sbjct: 350 LGGGTIQ 356


>gi|167759055|ref|ZP_02431182.1| hypothetical protein CLOSCI_01402 [Clostridium scindens ATCC 35704]
 gi|167663462|gb|EDS07592.1| hypothetical protein CLOSCI_01402 [Clostridium scindens ATCC 35704]
          Length = 361

 Score =  259 bits (661), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 147/370 (39%), Positives = 217/370 (58%), Gaps = 17/370 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN--SRKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    R   + +G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEERIVEEEQGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             ++ + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 65  AASLGIPYYVMNFKQEFKTYVIDYFMDEYLHGRTPNPCIACNRYVKWESLLKRSMEIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  RL     G  R  +       +DQ+Y L++ TQ+QL     P+G+  K+
Sbjct: 125 YIATGHYARIERL-----GNGRCSLRTSAASAKDQTYALYSLTQEQLKRTLMPVGEYTKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R LA ++GL++ADK DSQDICFV  G Y   ++  +    L G+ V  +G ++GRH G
Sbjct: 180 EIRKLAGKIGLNVADKPDSQDICFVPDGDYASYIEANSGARILPGNFVLSDGTVVGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I++YT+GQR+GLG+++G P+FV+ +   ++ +IVG  E      +    IN++     ED
Sbjct: 240 IVHYTVGQRKGLGLSLGHPVFVLDIRPETNEIIVGTNEESLTCHVRADRINFMA---IED 296

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + D  + + KIR +       V++  +D +   FE+ +  VA GQA V Y  +     V
Sbjct: 297 -LADKKRVWAKIRYNHRGAWCTVEKTGEDEILCIFEEPQRAVAPGQAVVLYDGEY----V 351

Query: 378 LGGGIISGSK 387
           LGGG I G +
Sbjct: 352 LGGGTIIGDE 361


>gi|226322606|ref|ZP_03798124.1| hypothetical protein COPCOM_00378 [Coprococcus comes ATCC 27758]
 gi|225208943|gb|EEG91297.1| hypothetical protein COPCOM_00378 [Coprococcus comes ATCC 27758]
          Length = 359

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 150/369 (40%), Positives = 217/369 (58%), Gaps = 19/369 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++     K  +  G CC    V DAR+V
Sbjct: 5   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEESKIQEENGGCCGLSAVDDARKV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              I + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL+ + ++GAD
Sbjct: 65  AAQIGIPYYVMNFKKDFQEKVIDYFVDEYLHGRTPNPCIACNRYVKWESLLTRSMEIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  +       +DQ+Y L+  TQ QL     P+G+ +K+
Sbjct: 125 YIATGHYARVEQLPNG-----RYAIRHSATWSKDQTYALYNLTQDQLRRTLMPVGEYEKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL IA+K DSQDICFV    Y   ++  +     EG+ V  +G+ILGRH G
Sbjct: 180 QIREIAKEIGLQIANKPDSQDICFVSDDDYASFIEEESDQKIPEGNFVTPDGKILGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           II+YTIGQR+GLG+++G P FV+ +  +++ V++G  E L   R+   ++N++     ED
Sbjct: 240 IIHYTIGQRKGLGLSLGYPAFVLEIRPDTNEVVIGTNEDLMTTRVRANKLNFM---TVED 296

Query: 319 AVVDG-FKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
             ++G  + F KIR +       V++  +D +   FE  +  V  GQA V Y  D     
Sbjct: 297 --LEGEMRVFAKIRYNHKGDWCTVRKTGEDEIECIFETPQRAVTPGQALVLYDGDY---- 350

Query: 377 VLGGGIISG 385
           VLGGG I G
Sbjct: 351 VLGGGTILG 359


>gi|269217070|ref|ZP_06160924.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Slackia exigua ATCC 700122]
 gi|269129207|gb|EEZ60292.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Slackia exigua ATCC 700122]
          Length = 362

 Score =  258 bits (660), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 149/373 (39%), Positives = 210/373 (56%), Gaps = 23/373 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-------RKASKRKGSCCAGQDVY 74
           RV+V MSGGVDSSV A +LK+ GY+VIG T++L+ S       R  + R  +CC+  DV 
Sbjct: 4   RVMVGMSGGVDSSVTAYVLKQQGYEVIGATMRLHGSDLPGRDARSCASR--TCCSLDDVE 61

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA+ V   + ++H   D+ +RF +AVI PF  +Y    TP PC+DCNR +KF  +L    
Sbjct: 62  DAKSVARRLGIAHRTIDFTDRFEDAVIKPFVRAYETARTPNPCIDCNRRLKFGSMLERAL 121

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
            LG D +ATGHY +  +  GD    R  + R  D  +DQSY L++ TQ QL     PLG 
Sbjct: 122 DLGCDYVATGHYAQI-VRRGD----RFALVRGADASKDQSYVLYSLTQYQLAHTLLPLGG 176

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           M+K  VR +A E G   ADK +SQDICF+  G Y   ++R +      G+I    G ++G
Sbjct: 177 MRKSEVRAIAAEQGFINADKPESQDICFIPDGDYVGFLERYSGHTPQPGEIRDEAGAVIG 236

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
           RH+GI ++T+GQR+G+G+A   PL+VV  D     ++VGP++SL        + NW+ D 
Sbjct: 237 RHSGIESFTVGQRKGIGIAASGPLYVVAKDARDHALVVGPKDSLLSDGCVADDWNWVADP 296

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSN 373
             ED  +  F+  VK    Q P P  V+R  DG V + +       A GQA V Y  D  
Sbjct: 297 --ED--LASFEVMVKTHYRQTPHPARVERRQDGTVRIVYASPARLAAPGQAVVVYQGDE- 351

Query: 374 EARVLGGGIISGS 386
              V+GGG ++ +
Sbjct: 352 ---VIGGGTVAST 361


>gi|225026476|ref|ZP_03715668.1| hypothetical protein EUBHAL_00725 [Eubacterium hallii DSM 3353]
 gi|224956215|gb|EEG37424.1| hypothetical protein EUBHAL_00725 [Eubacterium hallii DSM 3353]
          Length = 354

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 140/364 (38%), Positives = 207/364 (56%), Gaps = 17/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV A L+K  GYD IGVT++LY N      R+ +CC+  D+ DAR VC
Sbjct: 4   KALIAMSGGVDSSVAAYLMKEAGYDCIGVTMKLYDNEDIGMAREKTCCSLSDIEDARSVC 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YVF++++ F+  VI  F S Y  G TP PC++CNR +KF  L    + L  DV
Sbjct: 64  VKLGIPYYVFNFKDDFKEKVIDNFISCYQNGMTPNPCIECNRHLKFEHLYKRAKVLHCDV 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY +    +  D +   ++ + +D  +DQSY L++ TQ+QL +  FPLGD  K  +
Sbjct: 124 IVTGHYAK----ITHDEQGYHLL-KGVDDSKDQSYVLYSLTQEQLANTCFPLGDYSKTEI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A E G   A K DSQDICF+  G Y   +++     +  GD V+  G+++GRH G  
Sbjct: 179 RKIAEEQGFFNAHKHDSQDICFIPDGDYMSFIEKTTGKKSEPGDFVNQEGEVVGRHKGYY 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG++  +P +V  +    ++VIVG  E L    +   + NW+ + L ED V
Sbjct: 239 GYTIGQRKGLGISAPKPYYVTEIRPEENKVIVGSNEDLFKTDLIANDFNWI-ENLAEDEV 297

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                   +IR  Q       ++N DG V + F + +  +  GQA V Y  +     V+G
Sbjct: 298 AKA-----RIRYHQTEKEATARKNSDGTVDIHFLEPQRAITKGQAVVLYRDN----HVVG 348

Query: 380 GGII 383
           GG I
Sbjct: 349 GGTI 352


>gi|227872028|ref|ZP_03990409.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oribacterium sinus F0268]
 gi|227842120|gb|EEJ52369.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oribacterium sinus F0268]
          Length = 362

 Score =  258 bits (658), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 142/371 (38%), Positives = 212/371 (57%), Gaps = 16/371 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK-RKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV AAL++  GYD IG+T++LY+S      R  +CC  +DV DAR+V 
Sbjct: 3   KALIAMSGGVDSSVAAALMQEKGYDCIGITMKLYDSETGQACRSRTCCTLEDVEDARQVA 62

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
            T+++  YV ++++ F+  VI+PF  +Y  G TP PC+ CNR +K   L     +L    
Sbjct: 63  STLSMPFYVLNFKDDFQKKVILPFVETYENGGTPNPCIRCNRFMKHDKLYQRAEELSCSY 122

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           + TGHY R      D+   R ++ +  D ++DQSY L+  +Q+QL    FPLG+   KE 
Sbjct: 123 IVTGHYARIE---KDESSGRYLLKKAKDEKKDQSYVLYFLSQEQLAHTLFPLGEYSSKEE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A + G   +DK DSQDICFV  G Y D +++        GD V  NG+ LG H G 
Sbjct: 180 VREIADKYGFINSDKPDSQDICFVTNGDYGDFLEKFRGKPYPSGDFVDENGKKLGEHRGT 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG+++ +P++V   +   ++VI+  +E +    +   + NW+     ED 
Sbjct: 240 VRYTIGQRKGLGLSLKKPMYVSGKNIEKNQVILSDKEGIYFEGLLANDFNWISLPPTEDM 299

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      K R +   VP  V   ++G V++ F + E  V  GQA V Y  D     VL
Sbjct: 300 AVE-----AKTRYNGKAVPAIVSVRENGDVFLRFPEKERAVTKGQAVVLYDGD----LVL 350

Query: 379 GGG-IISGSKR 388
           GGG I+ G K+
Sbjct: 351 GGGTIVEGYKK 361


>gi|83590486|ref|YP_430495.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Moorella thermoacetica ATCC 39073]
 gi|123524262|sp|Q2RHY7|MNMA_MOOTA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|83573400|gb|ABC19952.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Moorella thermoacetica ATCC 39073]
          Length = 357

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 149/363 (41%), Positives = 210/363 (57%), Gaps = 13/363 (3%)

Query: 24  VVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVCDT 82
           +VAMSGGVDSS  AALLK  GY+VIGVTL L+         +  CC+ + V DARRV + 
Sbjct: 1   MVAMSGGVDSSTAAALLKEAGYEVIGVTLALWPEDTPPPPGETGCCSLKAVDDARRVANI 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +++ +YV ++ + F   VI  F +SY  GETP PC+ CNR +KF  LL+  R LG D +A
Sbjct: 61  LDIPYYVLNFRDLFEREVIDYFIASYLEGETPNPCIACNRRIKFGALLAKARALGIDYIA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY R R Y  D  K R ++ R  D  +DQSY L+  TQ+QL     PLGD  K  VR+
Sbjct: 121 TGHYAR-RWY--DKEKGRYLLARGRDAGKDQSYALYTFTQEQLAHTLLPLGDYTKVEVRE 177

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A   GL +A K++SQ+ICFV +G Y D ++         G I+   G++LG+H G+  Y
Sbjct: 178 IAARYGLPVARKAESQEICFVTEGDYRDYIQSRAREKIKPGPILDTRGRVLGQHRGLPFY 237

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P FVV LD   + VIVG +E LE   +Y R+ N++  G        
Sbjct: 238 TIGQRKGLGLALGKPCFVVALDPERNAVIVGDKEDLERRVLYARDNNYILWGELPGKA-- 295

Query: 323 GFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   +IR  + +    +         ++F++ +  +  GQA V+Y  D     V+GGG
Sbjct: 296 --RVTARIRYRAPEAAATWHPLAGGRARLEFDEPQRAITPGQAVVYYQGDL----VVGGG 349

Query: 382 IIS 384
            I 
Sbjct: 350 TIE 352


>gi|160931216|ref|ZP_02078618.1| hypothetical protein CLOLEP_00053 [Clostridium leptum DSM 753]
 gi|156869771|gb|EDO63143.1| hypothetical protein CLOLEP_00053 [Clostridium leptum DSM 753]
          Length = 357

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 201/364 (55%), Gaps = 15/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V++ MSGGVDSSV A LL + GYDV GVT++L  +   A  + G CC+  D+ DARRV 
Sbjct: 4   KVMLGMSGGVDSSVAALLLLQQGYDVTGVTMKLRPDQYMAESQSGGCCSLDDIDDARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + H V ++ + F   VI  FAS Y AG TP PC+ CN  VKF  LL     L  D 
Sbjct: 64  YRLGIEHLVLNFTQVFSEKVIDYFASEYLAGRTPNPCIACNAHVKFDALLRKALSLEYDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  + +   D+G   R + +     +DQSY L+  TQ QL     PL  M+K   
Sbjct: 124 VATGHY--AVITQNDEG---RWLLKKAPCSKDQSYVLYHLTQHQLAHTLMPLAGMEKSEA 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R+LARE GL +A K DSQ+ICFVQ   Y   ++R        G+ +   G +LG H GI 
Sbjct: 179 RELAREAGLPVAHKPDSQEICFVQDNDYASFIRRYTGKEPPPGNFIDQAGNVLGTHKGIT 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQR+GLG++ G+P+FV  +D  S+ V +G   S     +   ++N +     E  +
Sbjct: 239 HYTIGQRKGLGISFGKPMFVTKIDPISNTVTLGENGSQYASSLIAGKVNLISADTLEAPI 298

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                  VK+R    P P  +   D+G + VDF++ +  V  GQA VFY  D     VLG
Sbjct: 299 ----SAQVKVRYQAPPAPARLTPLDNGKIRVDFQEPQRSVTPGQAAVFYDGD----LVLG 350

Query: 380 GGII 383
           GGII
Sbjct: 351 GGII 354


>gi|260438131|ref|ZP_05791947.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Butyrivibrio crossotus DSM 2876]
 gi|292809456|gb|EFF68661.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Butyrivibrio crossotus DSM 2876]
          Length = 357

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 149/366 (40%), Positives = 204/366 (55%), Gaps = 16/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A +LK  GYDVIGVT+Q++           G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAALILKEQGYDVIGVTMQIWQDEDYCDMSENGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            +TI + +YV +++E F+  VI  F + Y  G TP PC+ CNR VK+  LL     +GAD
Sbjct: 64  AETIGIPYYVMNFKEEFKKTVIDYFVAEYLRGRTPNPCIACNRYVKWEALLHRCLGIGAD 123

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY    +L  G     R  + +   L +DQSY L+  TQ++L    FP+  M+K+
Sbjct: 124 YIATGHYGNIEKLPNG-----RFAVTKSASLNKDQSYVLYNLTQEELSHTLFPISTMEKD 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A   GL +A K DSQDICF++ G Y   ++      +  GD V   G +LGRH G
Sbjct: 179 EVRKIAERAGLPVAHKKDSQDICFIKDGDYASFIEEQTGVKSGPGDFVDSKGNVLGRHAG 238

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           II+YT+GQR+GLG+A GEP +V+ LD   ++V++G  + L    +   +IN++      +
Sbjct: 239 IIHYTVGQRKGLGIAFGEPRYVIRLDVPKNQVVLGTLDELMTKEVLFDDINYMSVSDINE 298

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARV 377
            V    K   K+R S   VP  +    DGV    FE+       GQA VFY    +   V
Sbjct: 299 PV----KVTGKVRYSAKDVPCTLYPAKDGVMKAVFEEPVRAATPGQAAVFY---KDGCIV 351

Query: 378 LGGGII 383
            GG II
Sbjct: 352 CGGSII 357


>gi|317498544|ref|ZP_07956838.1| tRNA methyl transferase [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316894237|gb|EFV16425.1| tRNA methyl transferase [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 363

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 149/365 (40%), Positives = 210/365 (57%), Gaps = 16/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++        +  G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKKQGYDVIGVTMQIWQEEDEFVQEENGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              I + HYV ++ + F++ VI  F   Y    TP PC+ CNR VK+  LL     +GAD
Sbjct: 64  AQMIGIPHYVMNFRKDFKDKVIDYFCEEYLNARTPNPCIACNRYVKWESLLKRCLDIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  S++   D+G R  + C     ++DQ+Y L+  TQ QL     P+G   K+ 
Sbjct: 124 YIATGHY--SQITKLDNG-RYALKCSKTQ-KKDQTYALYNLTQNQLSKTLMPIGAYTKDE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A E+GL +A+K DSQDICFV    Y + ++        +G+ V   G +LG H GI
Sbjct: 180 VRQIAEEIGLLVANKPDSQDICFVDD-NYGEFIEETTGTKIPKGNFVDPEGNVLGEHKGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I YT+GQRRGLG+++ +P +V+ +DK+++ V+VG ++ L  + +Y  ++N +    FE  
Sbjct: 239 IYYTVGQRRGLGLSLKKPGYVIKVDKDTNEVVVGDKQDLFANVLYGNKVNCMSVPEFE-- 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             DG K   KIR +   VP  V    +D V V F++ +  +  GQA VFY  D     V 
Sbjct: 297 --DGMKLMAKIRYNSPEVPCRVYMTGEDEVRVVFDEPQRAITPGQAVVFYDGDI----VA 350

Query: 379 GGGII 383
           GG  I
Sbjct: 351 GGATI 355


>gi|167765590|ref|ZP_02437654.1| hypothetical protein CLOSS21_00084 [Clostridium sp. SS2/1]
 gi|167712775|gb|EDS23354.1| hypothetical protein CLOSS21_00084 [Clostridium sp. SS2/1]
          Length = 363

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 149/365 (40%), Positives = 210/365 (57%), Gaps = 16/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++        +  G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKKQGYDVIGVTMQIWQEEDEFVQEENGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              I + HYV ++ + F++ VI  F   Y    TP PC+ CNR VK+  LL     +GAD
Sbjct: 64  AQMIGIPHYVMNFRKDFKDKVIDYFCEEYLNARTPNPCIACNRYVKWESLLKRCLDIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  S++   D+G R  + C     ++DQ+Y L+  TQ QL     P+G   K+ 
Sbjct: 124 YIATGHY--SQITKLDNG-RYALKCSKTQ-KKDQTYALYNLTQNQLSKTLMPIGAYTKDE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A E+GL +A+K DSQDICFV    Y + ++        +G+ V   G +LG H GI
Sbjct: 180 VRQIAEEIGLLVANKPDSQDICFVDD-NYGEFIEETTGTKIPKGNFVDPEGNVLGEHKGI 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I YT+GQRRGLG+++ +P +V+ +DK+++ V+VG ++ L  + +Y  ++N +    FE  
Sbjct: 239 IYYTVGQRRGLGLSLKKPGYVIKVDKDTNEVVVGDKQDLFANVLYGNKVNCMSVPEFE-- 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             DG K   KIR +   VP  V    +D V V F++ +  +  GQA VFY  D     V 
Sbjct: 297 --DGMKLMAKIRYNSPEVPCRVYMTGEDEVRVVFDEPQRAITPGQAVVFYDGDI----VA 350

Query: 379 GGGII 383
           GG  I
Sbjct: 351 GGATI 355


>gi|27262188|gb|AAN87375.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Heliobacillus mobilis]
          Length = 376

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 205/365 (56%), Gaps = 16/365 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VVVAMSGGVDSSV AALL   GY+VIGVTLQ++        +G CC+   V DARRV  T
Sbjct: 5   VVVAMSGGVDSSVTAALLLEKGYNVIGVTLQIWPKDAPEGAEGGCCSLSAVEDARRVAFT 64

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + HYV ++ + F   VI  F   Y AG+TP PC+ CNR +KF  LL  +  LGAD +A
Sbjct: 65  LGIPHYVMNFRDYFEEEVINYFGQEYLAGQTPNPCIRCNRVIKFEGLLQKSLALGADKVA 124

Query: 143 TGHYIRSRLYVGDDGKRRRI-MCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           TGHY R    +  D +R+R  + +  D ++DQSY LF  TQ+QL    FPLG   K  +R
Sbjct: 125 TGHYAR----IEYDAERQRYRLGQAKDAKKDQSYVLFNMTQEQLSRTMFPLGGFTKPEIR 180

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVK-RINAGIALEGDIVHLNGQILGRHNGII 260
           ++AR   L +A K DSQ+ICF+    Y   ++ R        G  V  +G ++G H G+ 
Sbjct: 181 EMARAYNLAVASKPDSQEICFIPDNDYRRFLQERYPENSFAPGPFVDTSGNVIGTHQGLP 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GLG A G P +VV LD   + VI+G  E +   R+   ++NW+      + +
Sbjct: 241 FYTVGQRKGLGQAFGYPAYVVGLDVARNAVIIGRDEDVFSRRLLAGDLNWIE----VNRL 296

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG--VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
               +   KIR S       ++   +G  V V+FE+ +  +  GQA VFY  D     ++
Sbjct: 297 TAPMEVQAKIRYSALKAKAIIRPVGEGDQVIVEFEEKQRAITPGQAVVFYQGDW----IV 352

Query: 379 GGGII 383
           GGG I
Sbjct: 353 GGGTI 357


>gi|331085021|ref|ZP_08334108.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330408721|gb|EGG88186.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 357

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 142/365 (38%), Positives = 212/365 (58%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    R   +  G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDRAVEEENGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 64  AAALEIPYYVMNFKKEFKEKVIDYFVQEYLHGRTPNPCIACNRYVKWESLLKRSMDIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    V  +  R  + C    L +DQ+Y L+  TQ+QL     P+G+  K+ 
Sbjct: 124 YIATGHYARV---VQLENGRYTLKCSAT-LAKDQTYALYNLTQEQLKRTLMPVGEYTKDQ 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A ++ L IA+K DSQDICFV  G Y   ++   A    EG+ V L+G++LGRH GI
Sbjct: 180 VREIAEKINLRIANKPDSQDICFVPDGDYASFIEEEAAVKIPEGNFVDLDGRVLGRHKGI 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YT+GQR+GLG+++G P FV+ +   ++ +++G  E    + +   ++N++     ED 
Sbjct: 240 THYTVGQRKGLGLSLGHPAFVLEIRPETNEIVIGSNEDSMSYTLRANQLNFMS---IED- 295

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    + + KIR +       ++++  D V   FE+ +  +  GQA VFY  +     V+
Sbjct: 296 LTGEMRVWTKIRYNHKGAWCTIRKSGKDEVTCTFEEPQRAITPGQAVVFYDGEY----VV 351

Query: 379 GGGII 383
           GGG I
Sbjct: 352 GGGTI 356


>gi|238922133|ref|YP_002935647.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium eligens ATCC 27750]
 gi|238873805|gb|ACR73513.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium eligens ATCC 27750]
          Length = 355

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 137/363 (37%), Positives = 210/363 (57%), Gaps = 13/363 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++        +  CC    V DARRV  
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDDATEAAENGCCGISAVDDARRVAG 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            +++ +YV +++  F+  VI  F   Y  G TP PC+ CNR VK+  LL  + ++GAD +
Sbjct: 64  QLDIPYYVMNFKNEFKCNVIDYFVDEYKKGRTPNPCIACNRYVKWESLLKRSLEIGADYI 123

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY  +R++   +G  R  +C  +   +DQ+Y L+  TQ+QL     P+GD  K+ VR
Sbjct: 124 ATGHY--ARIHQLPNG--RYTICNSVTARKDQTYALYNLTQEQLSHTLLPIGDYTKDQVR 179

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++A ++G+ +A K DS +ICF+    Y   +KR     ++ G+ + +NG ++GRH GII+
Sbjct: 180 EIASKIGITVAKKPDSMEICFIPDNDYAGFIKRETGYTSVPGNFIDVNGNVIGRHQGIIH 239

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YT+GQR+GLG+A+G+P FVV +   ++ V++G    +   ++Y   +N++     E  + 
Sbjct: 240 YTVGQRKGLGLALGKPAFVVAIRPETNEVVIGDNSDVFSPKLYANNLNFMSIPSLEGEM- 298

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   KIR S +     ++  D+      F++    V  GQA V Y  D+    VLGG
Sbjct: 299 ---RAKGKIRYSHEGAMCTIRMFDENTLECTFDEPVRAVTPGQALVLYDGDN----VLGG 351

Query: 381 GII 383
           G I
Sbjct: 352 GTI 354


>gi|302670955|ref|YP_003830915.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase TrmU
           [Butyrivibrio proteoclasticus B316]
 gi|302395428|gb|ADL34333.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase TrmU
           [Butyrivibrio proteoclasticus B316]
          Length = 373

 Score =  256 bits (655), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 144/363 (39%), Positives = 202/363 (55%), Gaps = 15/363 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVCD 81
            ++AMSGGVDSSV AAL  + GY+ IG T++LY N        G+CC+ +D  DAR VCD
Sbjct: 19  ALIAMSGGVDSSVAAALTLKKGYNCIGCTMRLYENDMVGLDLLGTCCSIEDTKDARSVCD 78

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + + ++ YE  FR+ VI PF  SY  GETP PC+ CN+ +KF  L    R+LG D +
Sbjct: 79  KLGIDYNIYHYEAEFRDKVIEPFVCSYERGETPNPCIRCNKYLKFDSLYKRARELGCDYI 138

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
            TGHY R     G        + +  DL +DQSY L+  +++QL    FPLG+  K  VR
Sbjct: 139 VTGHYARIEERDG-----HFYLLKAKDLNKDQSYVLYDLSEEQLRHTLFPLGEFTKPEVR 193

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A E G   + KS+SQDICFV  G Y  ++ R       +GD V  +G +LG H+GIIN
Sbjct: 194 AIAEENGFVTSHKSESQDICFVPDGDYAGMIHRYRGKDYPKGDFVDKDGNVLGTHDGIIN 253

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQRRGLG+     L+V  LD  +++VI+     L    + +R+ +W+          
Sbjct: 254 YTIGQRRGLGIPADRRLYVTKLDVENNKVILADNIDLFKREMIIRDFHWITGS----EPT 309

Query: 322 DGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
           + F+C  KIR      P  V    +    V F++++  + +GQ+ V Y  D     VLGG
Sbjct: 310 NEFRCQAKIRYKHKEQPASVLPLGEKRARVVFDEAQRAITAGQSAVLYDGDI----VLGG 365

Query: 381 GII 383
           GII
Sbjct: 366 GII 368


>gi|291556233|emb|CBL33350.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium siraeum V10Sc8a]
          Length = 358

 Score =  256 bits (654), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 149/370 (40%), Positives = 212/370 (57%), Gaps = 23/370 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++ +AMSGGVDSSV   LLK D YDV G TL+L++SR  +   G C +  D+ DA+ +  
Sbjct: 3   KLAIAMSGGVDSSVALVLLK-DKYDVSGYTLKLHDSR-GTDDSGLCGSASDIEDAKAIAA 60

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
              V HY+ D  E F   V   F  SY +G TP PCV+CN T+KF  LL   ++ G + +
Sbjct: 61  KFGVPHYLLDMRELFSKTVQKSFTESYLSGRTPNPCVECNETIKFGALLDAVKKQGINHI 120

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLE-----RDQSYFLFATTQQQLCDLRFPLGDMK 196
           ATGHY+RS     D+   R ++ + ++ +     +DQSY L+  +QQQL    FPLG+M 
Sbjct: 121 ATGHYVRSCY---DEKSGRWLLKKAINADGTSNAKDQSYVLYRLSQQQLAASVFPLGEMT 177

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ +R +A + GL  +DK DSQDICFV  G Y   ++R       +GD +  NG ++GRH
Sbjct: 178 KDEIRHIAADSGLINSDKPDSQDICFVPDGDYAGFIERYTGNTYPDGDFLDENGNVIGRH 237

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            G+I YTIGQRRG+G   G+P++V+  + +++ V +G  E L    +Y   +NW+    F
Sbjct: 238 KGVIFYTIGQRRGIGTGFGKPMYVIGKNADNNTVTLGSNELLFTDTLYADNLNWIA---F 294

Query: 317 EDAVVDGFKCFVKI--RSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
           E    + FKC  K   R ++ P  V+ Q RN   V V F++    V  GQ  VFY  D  
Sbjct: 295 EYPESE-FKCKAKTRYRQTEQPCTVYPQGRNT--VRVVFDEKIRAVTPGQHVVFYDGDI- 350

Query: 374 EARVLGGGII 383
              VLGGG+I
Sbjct: 351 ---VLGGGVI 357


>gi|326390151|ref|ZP_08211712.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325993799|gb|EGD52230.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 364

 Score =  256 bits (654), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 143/370 (38%), Positives = 215/370 (58%), Gaps = 14/370 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY--NSRKASKRKGSCCAGQDVYDARRV 79
           RV + MSGGVDSSV A LLK++G+DVIG+T++++  +  KA     SCC+ +   DA++V
Sbjct: 6   RVAIGMSGGVDSSVAAYLLKKEGFDVIGLTMKVWVDHEAKAFDSDKSCCSLRATQDAKKV 65

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + V HY  D+ E F + ++  F + Y  G TP PCV CNR +KF +LL    +LGA 
Sbjct: 66  AEMLGVPHYTVDFSEVFYDKIVNYFINEYLKGRTPNPCVLCNRQIKFGELLEKAFELGAY 125

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY+R      D+  +R ++ + +D  +DQSY L+  TQ+QL    FPLG+ KKE 
Sbjct: 126 YIATGHYVRKDY---DEKTKRYLLKKGIDSSKDQSYVLYRLTQKQLEHALFPLGNYKKEE 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R LA E+ L +A K +SQ+ICF+    Y   +KR        G+   ++G+ LG H GI
Sbjct: 183 IRALAEELKLPVAKKPESQEICFIPDNDYSGFIKRQVKDEIKPGEFRDVHGKFLGYHKGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQRRGLG++   PL+VV +D  ++ V+VG +E +    +     N++      + 
Sbjct: 243 IHYTIGQRRGLGLSSDRPLYVVDIDVKNNVVVVGHQEDVWGEELISSNNNFISI----EK 298

Query: 320 VVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    K   KIR ++++   +     +D V V F K +  +  GQ+ VFY  D     V+
Sbjct: 299 LKREMKVTAKIRYTAKEEEAIIKPYEEDKVLVKFLKPQRAITPGQSVVFYDKDV----VV 354

Query: 379 GGGIISGSKR 388
           GGGII    R
Sbjct: 355 GGGIIEKKVR 364


>gi|168218238|ref|ZP_02643863.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens NCTC 8239]
 gi|182379744|gb|EDT77223.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens NCTC 8239]
          Length = 359

 Score =  256 bits (654), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 210/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV 
Sbjct: 5   KVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD 
Sbjct: 65  QKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +
Sbjct: 125 VATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKI 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H GI+
Sbjct: 180 REIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKGIV 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     E  +
Sbjct: 240 YYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLEGPM 299

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V+G
Sbjct: 300 ----EVEAKIRYSARPAKATISPMENGKVKVSFEDKQRAITKGQSVVFYKDD----LVVG 351

Query: 380 GGIIS 384
           GGII 
Sbjct: 352 GGIIE 356


>gi|187933232|ref|YP_001885369.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum B str.
           Eklund 17B]
 gi|205813703|sp|B2THM7|MNMA_CLOBB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|187721385|gb|ACD22606.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum B str. Eklund 17B]
          Length = 361

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 138/367 (37%), Positives = 217/367 (59%), Gaps = 17/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-RKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIG T+Q++   ++  +R+G CC+   V DARRVC
Sbjct: 7   KVLVGMSGGVDSSVAAYLLKEQGYEVIGATMQIWQEDKEVEEREGGCCSLSAVEDARRVC 66

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D +++  YV ++ + F+  VI PF   Y  G TP PC++CN+ +KF +LL   + +G D 
Sbjct: 67  DKLDIPFYVLNFRDSFKKKVIEPFIQEYIDGRTPNPCIECNKHLKFDELLRKAQGIGVDY 126

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +++   DD   R ++ R  D  +DQ+Y L+  TQ QL     P G+  K+ +
Sbjct: 127 IATGHY--AKIDKKDD---RYMLIRSDDDRKDQTYALYNFTQDQLAHTLMPCGEYTKDRI 181

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +     G    G+ V  +G ILG+H GI+
Sbjct: 182 REIAKEIGLAVHNKKDSEEICFISDNDHGKYILNAKPGAVKSGNFVDKSGNILGKHKGIV 241

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+++G P+FV  ++  ++ V++G  E +    +   ++N++  D L ++ 
Sbjct: 242 YYTIGQRKGLGLSVGRPVFVTDINPKTNEVVIGAEEDIFKTELIAGDLNFITFDKLEKEI 301

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR S  P    +    DG V V F + +  +  GQ+ VFY    N   V+
Sbjct: 302 EVEA-----KIRYSARPGKATIVPLKDGRVKVVFNEKQRAITKGQSVVFY----NGNIVI 352

Query: 379 GGGIISG 385
           GGG+I  
Sbjct: 353 GGGVIEA 359


>gi|325661222|ref|ZP_08149849.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           4_1_37FAA]
 gi|325472729|gb|EGC75940.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           4_1_37FAA]
          Length = 357

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 142/365 (38%), Positives = 212/365 (58%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    R   +  G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDRAVEEENGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 64  AAALEIPYYVMNFKKEFKEKVIDYFVQEYLHGRTPNPCIACNRYVKWESLLKRSMDIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    V  +  R  + C    L +DQ+Y L+  TQ+QL     P+G+  K+ 
Sbjct: 124 YIATGHYARV---VQLENGRYTLKCSAT-LAKDQTYALYNLTQEQLKRTLMPVGEYTKDQ 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++A ++ L IA+K DSQDICFV  G Y   ++   A    EG+ V L+G++LGRH GI
Sbjct: 180 VREIAEKINLRIANKPDSQDICFVPDGDYASFIEEEAAVKIPEGNFVDLDGRVLGRHKGI 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YT+GQR+GLG+++G P FV+ +   ++ +++G  E    + +   ++N++     ED 
Sbjct: 240 THYTVGQRKGLGLSLGHPAFVLEIRPETNEIVIGSNEDSLSYTLKANQLNFMS---IED- 295

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    + + KIR +       ++++  D V   FE+ +  +  GQA VFY  +     V+
Sbjct: 296 LTGEMRVWTKIRYNHKGAWGTIRKSGKDEVTCTFEEPQRAITPGQAVVFYDGEY----VV 351

Query: 379 GGGII 383
           GGG I
Sbjct: 352 GGGTI 356


>gi|282901416|ref|ZP_06309341.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Cylindrospermopsis raciborskii CS-505]
 gi|281193695|gb|EFA68667.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Cylindrospermopsis raciborskii CS-505]
          Length = 350

 Score =  256 bits (653), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 149/372 (40%), Positives = 208/372 (55%), Gaps = 37/372 (9%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA+L   GYDVIG+TL L       K KG CC+ + + DA  +C 
Sbjct: 4   KVVVGLSGGVDSSVAAAILHNQGYDVIGLTLWLM------KGKGQCCS-EGMVDAATICQ 56

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            +++ H + D  + F+  ++    S Y+AG TPLPC  CNRTVKF  +L   R+ LG+DV
Sbjct: 57  QLSIPHEIVDMRDVFQTNIVDYLVSGYSAGITPLPCSQCNRTVKFGPMLEYAREKLGSDV 116

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R      D G  R  + R  D  +DQSYFL+  +Q+ L    FPLG++ K   
Sbjct: 117 IATGHYARIAY---DHGTERYQLLRAFDRNKDQSYFLYDLSQELLAGTIFPLGELNKNDT 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQG--------KYFDVVKRINAGIALEGDIVHLNGQI 252
           R +A E GL  ADK +SQD+C V+          KY          +   GDIV  NG+I
Sbjct: 174 RKIAAEYGLKTADKPESQDLCLVESNGSMRAFLDKYL---------VPKPGDIVDSNGKI 224

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LG+H+G+ +YTIGQR+GLG+A  EPL+V+ LD  ++ V+VG R         +  +NW+ 
Sbjct: 225 LGKHDGVHHYTIGQRKGLGIAAAEPLYVIKLDTVNNLVVVGDRTKGTEKECTVERVNWVS 284

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSD 371
                  +    +  V+IR    PV    +    D V + F++ +  +  GQA V+Y  D
Sbjct: 285 MAEPRGTI----RGEVQIRYRSQPVLATIIPGETDCVQLVFDEPQFSITPGQAAVWYEGD 340

Query: 372 SNEARVLGGGII 383
               +VLGGGII
Sbjct: 341 ----KVLGGGII 348


>gi|110801338|ref|YP_696468.1| tRNA-specific 2-thiouridylase MnmA [Clostridium perfringens ATCC
           13124]
 gi|168211408|ref|ZP_02637033.1| tRNA -methyltransferase [Clostridium perfringens B str. ATCC 3626]
 gi|24638315|sp|Q8XJH3|MNMA_CLOPE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|123049729|sp|Q0TPH2|MNMA_CLOP1 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110675985|gb|ABG84972.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens ATCC 13124]
 gi|170710614|gb|EDT22796.1| tRNA -methyltransferase [Clostridium perfringens B str. ATCC 3626]
          Length = 359

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 210/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV 
Sbjct: 5   KVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD 
Sbjct: 65  QKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +
Sbjct: 125 VATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKI 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H GI+
Sbjct: 180 REIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKGIV 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     E  +
Sbjct: 240 YYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLEGPM 299

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V+G
Sbjct: 300 ----EVEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LVVG 351

Query: 380 GGIIS 384
           GGII 
Sbjct: 352 GGIIE 356


>gi|289450037|ref|YP_003475194.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridiales genomosp. BVAB3 str. UPII9-5]
 gi|289184584|gb|ADC91009.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridiales genomosp. BVAB3 str. UPII9-5]
          Length = 380

 Score =  256 bits (653), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 144/363 (39%), Positives = 203/363 (55%), Gaps = 11/363 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+VAMSGGVDSSV A LL   GYDV G T+Q++ N R+ +     CC+   V DARRV 
Sbjct: 5   KVLVAMSGGVDSSVAAKLLVDHGYDVTGATMQIWQNEREENHCDRGCCSLSAVEDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             I + +YV ++++ FR  VI PF  +Y  GETP PC+ CNR +KF + L     +G D 
Sbjct: 65  AKIGIPYYVLNFKDDFRKQVIAPFVDAYWQGETPNPCILCNRHIKFEEFLQKALMMGFDH 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R    V +    R  +       +DQ+Y L+  TQQQL  L  PLGD+ KE V
Sbjct: 125 IATGHYGR---VVYNQATGRYALALSATTAKDQTYALYTLTQQQLSHLLLPLGDLVKERV 181

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A E GL +A+K DSQ+ICFV    Y   V+  +A  +  G+ +  +G +LGRH G+I
Sbjct: 182 REIALEAGLPVANKRDSQEICFVTDNNYARFVEEFSARTSRPGNFILSDGTVLGRHRGLI 241

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQR+GLG+A   PLFV  L  +++ VI+   E L    +      W       + +
Sbjct: 242 HYTIGQRKGLGIAYKHPLFVKALRMDTNEVILAADEDLYATALIANNPVWSAWPKLSEPL 301

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               K  ++ R++  P  ++    DD V + F + +  +  GQA V Y  D     VLGG
Sbjct: 302 --SVKAKIRYRATAAPATLY-PLADDQVGLIFAEPQRAITPGQAVVCYKDD----LVLGG 354

Query: 381 GII 383
             I
Sbjct: 355 ATI 357


>gi|168207849|ref|ZP_02633854.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens E str. JGS1987]
 gi|169343749|ref|ZP_02864748.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens C str. JGS1495]
 gi|169298309|gb|EDS80399.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens C str. JGS1495]
 gi|170660837|gb|EDT13520.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens E str. JGS1987]
          Length = 359

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 210/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV 
Sbjct: 5   KVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD 
Sbjct: 65  QKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +
Sbjct: 125 VATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKI 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H GI+
Sbjct: 180 REIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKGIV 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++      D +
Sbjct: 240 YYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISI----DKL 295

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V+G
Sbjct: 296 EGHMEVEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LVVG 351

Query: 380 GGIIS 384
           GGII 
Sbjct: 352 GGIIE 356


>gi|189426122|ref|YP_001953299.1| tRNA-specific 2-thiouridylase MnmA [Geobacter lovleyi SZ]
 gi|226704771|sp|B3E966|MNMA_GEOLS RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|189422381|gb|ACD96779.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter lovleyi SZ]
          Length = 354

 Score =  255 bits (652), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 149/371 (40%), Positives = 217/371 (58%), Gaps = 31/371 (8%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+ VAMSGGVDSSVVAALL++ G++VIG+T+QL+    +         G   +D  +V  
Sbjct: 3   RIAVAMSGGVDSSVVAALLQQQGHEVIGITMQLFEPCSSGP-------GTPAHDGAQVAA 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + H++   E +FR+ +I  F   Y  G+TP PC+ CNR +KF  LL   R+LGA++L
Sbjct: 56  QLGIPHHLLRLEPQFRDLIIDNFIDQYRQGQTPNPCILCNRLIKFGLLLEQARELGAELL 115

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCR---PMDLERDQSYFLFATTQQQLCDLRFPLGDM-KK 197
           ATGHY+R    VG DG     +C      +  +DQSYFL++ +QQQL  + FPLG++  K
Sbjct: 116 ATGHYVRRT--VGPDG-----LCHLRTAANQAKDQSYFLYSLSQQQLRQVIFPLGEIASK 168

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRH 256
           + VR LA   GL +A K DSQ++CF+    Y   +++   GI A  G+IVH+ GQ+LGRH
Sbjct: 169 DEVRSLATGFGLAVATKGDSQEVCFIPNDDYAAFLEQ--QGIKASPGNIVHIGGQVLGRH 226

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           +G   YTIGQR+GLG+   EPL+V+ +D + + ++VG ++ L    +   +I+W+     
Sbjct: 227 SGTHRYTIGQRKGLGIGWSEPLYVLEIDSSRNLIVVGEQQHLLKAGLIGADISWI----- 281

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
                  F    KIR    PVP  V+   DD   V F++++  V  GQ  VFY  D    
Sbjct: 282 IPPPATSFNTTCKIRYRHQPVPCRVELLADDQCRVLFDEAQRSVTPGQFVVFYQDD---- 337

Query: 376 RVLGGGIISGS 386
           +VLGGG I  +
Sbjct: 338 QVLGGGRIQAA 348


>gi|162455579|ref|YP_001617946.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sorangium cellulosum 'So ce 56']
 gi|205828973|sp|A9EXM5|MNMA_SORC5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|161166161|emb|CAN97466.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sorangium cellulosum 'So ce 56']
          Length = 385

 Score =  255 bits (652), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 149/377 (39%), Positives = 203/377 (53%), Gaps = 21/377 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV +AMSGGVDSSV AA L   GY+V+GVTL L++       K  CCA +D +DARRV D
Sbjct: 23  RVFIAMSGGVDSSVAAARLCDAGYEVVGVTLHLWDYPDDGSVKSRCCAPEDQHDARRVAD 82

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HY FD    FR  V+ PF  +Y AGETP PCV CNR+VK  +L  +  +LG   +
Sbjct: 83  HLGIPHYTFDRRALFREHVVDPFVEAYLAGETPSPCVACNRSVKLRELFPLAERLGVSWV 142

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY  +R+ + + G R   + R  D  +DQSYFL      +L  L FPLGD  K+ VR
Sbjct: 143 ATGHY--ARVVLEEGGAR---LYRGRDRHKDQSYFLHMLRSDELSRLLFPLGDSTKDEVR 197

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
             A   GL  A+K +SQ++CF+  G+Y   V    A     G IV  +G+++G H G+  
Sbjct: 198 AEAIARGLPGAEKGESQELCFIPSGRYAPFVADRAADRLRPGPIVDRDGRVVGSHGGVHG 257

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           +T+GQR+G+GV++G P FVV LD  S  V +G    L      + +  W  D +F     
Sbjct: 258 FTVGQRKGIGVSLGRPAFVVGLDAASGAVHLGDEGDLYAAGAEIADAVWCDDAVFP---- 313

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDD------GVYVDFEKSEVGVASGQACVFYTSDSNEA 375
              +  V++R+  +  P  ++R  D           F      V+ GQ  V Y  D    
Sbjct: 314 --LEAEVRVRARHEAAPGIIERRRDPATGAESFVARFASPVRSVSPGQMAVVYRGD---- 367

Query: 376 RVLGGGIISGSKRSDAV 392
           RVLGGG I  + RS A 
Sbjct: 368 RVLGGGRIKAALRSQAA 384


>gi|302387623|ref|YP_003823445.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium saccharolyticum WM1]
 gi|302198251|gb|ADL05822.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium saccharolyticum WM1]
          Length = 372

 Score =  255 bits (651), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 141/367 (38%), Positives = 210/367 (57%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK--GSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++       ++  G CC    V DARRV
Sbjct: 18  KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEDTGTQEENGGCCGLSAVDDARRV 77

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV +++E F++ VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 78  AWDLGIPYYVMNFKEEFKSQVIDYFVGEYQKGRTPNPCIACNRYVKWESLLKRSLDIGAD 137

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY +  +L  G     R  + + +   +DQ+Y L+  TQ QL     P+G   K+
Sbjct: 138 YIATGHYAQIEKLPNG-----RYALKKSVTAAKDQTYALYNLTQHQLSHTLMPVGAYSKD 192

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A  + L +A K DSQ+ICF+    Y   ++      A EG+ V L+GQ++GRH G
Sbjct: 193 QIREIADRINLMVAHKPDSQEICFIPDNDYAGFIEESAGEKAPEGNFVDLSGQVIGRHKG 252

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           I +YT+GQR+GL ++MG P+FVV +   ++ V++G  + +    +    INW+  DGL  
Sbjct: 253 ITHYTVGQRKGLNLSMGRPVFVVEIRPEANEVVIGTGDDVFSQTLRANHINWMAVDGLHG 312

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEAR 376
           +++    +   KIR S       ++  +DGV    F++ +  +  GQA VFY  D     
Sbjct: 313 ESM----RVLAKIRYSHKGAMCTIREAEDGVVECRFDEPQRAITPGQAVVFYEGD----Y 364

Query: 377 VLGGGII 383
           V+GGG I
Sbjct: 365 VVGGGTI 371


>gi|197119634|ref|YP_002140061.1| tRNA-specific 2-thiouridylase MnmA [Geobacter bemidjiensis Bem]
 gi|197088994|gb|ACH40265.1| tRNA (5-carboxymethylaminomethyl-2-thio-U34)-thioltransferase
           [Geobacter bemidjiensis Bem]
          Length = 355

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 158/377 (41%), Positives = 215/377 (57%), Gaps = 29/377 (7%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQD 72
           +  N K  +V VAMSGGVDSS VAALLK  G +VIG+ ++L+    +  + KG       
Sbjct: 1   MSGNFKGKKVAVAMSGGVDSSTVAALLKEQGAEVIGINMKLFARDGEDPQAKG------- 53

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
             DA+ V + + +  ++   EE+F   ++  F + Y  GETP PCV CNR VKF  LL  
Sbjct: 54  --DAQIVAEYLGIEFHLVHLEEQFSRLIMEDFRAQYLGGETPNPCVRCNRYVKFGLLLDK 111

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
             +LGA+ LATGHY+R+     DDG    ++ +   L +DQSYFL+  TQ+QL  + FPL
Sbjct: 112 ALELGAEYLATGHYVRTSR---DDGGSYHLL-KAAFLAKDQSYFLYTLTQKQLSHVVFPL 167

Query: 193 GDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           GDM  K+ VR LA + GL +A KSDSQ+ICFV    Y   +++        GDIVH++G 
Sbjct: 168 GDMPSKDEVRRLAEKFGLPVAQKSDSQEICFVPGDDYVAFLEKGGRVAGKSGDIVHVDGT 227

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           +LGRH G   YTIGQRRGLGVA  EPL+VV +D    RV+VG    L    +   ++NW+
Sbjct: 228 VLGRHGGTHRYTIGQRRGLGVAWKEPLYVVSIDALQGRVVVGEAGQLFASGLVACDLNWV 287

Query: 312 GDGLFEDAVVDG--FKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFY 368
                    V+G  F+   KIR  Q P+   V+   +G+  V F + +  V  GQ+ VFY
Sbjct: 288 -------VPVEGETFETTCKIRYRQQPIACRVKLLGEGLGEVYFAEPQKSVTPGQSVVFY 340

Query: 369 TSDSNEARVLGGGIISG 385
             D     +LGGG I G
Sbjct: 341 REDE----LLGGGRIVG 353


>gi|197122790|ref|YP_002134741.1| tRNA-specific 2-thiouridylase MnmA [Anaeromyxobacter sp. K]
 gi|196172639|gb|ACG73612.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter sp. K]
          Length = 351

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 156/364 (42%), Positives = 203/364 (55%), Gaps = 13/364 (3%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSS  AALL   G++VIGVT+++ +   A++ + SCCA  DV DAR   
Sbjct: 1   MRILVAMSGGVDSSTAAALLAGHGHEVIGVTMRVADYSDAARGR-SCCAPDDVEDARAAA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +  YV + E RFR  VI  F   Y  G TP PCV CN  VKF  LL+  R LGA  
Sbjct: 60  RRLGIPFYVANVEARFRERVIDRFVDDYVEGRTPNPCVACNTEVKFDWLLARARALGAK- 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R    V + G RR ++    D  +DQSYFL+   Q  L D+ FP+G + K  V
Sbjct: 119 LATGHYAR----VEERGGRRALLT-AADPAKDQSYFLYGLGQDALRDVLFPVGALAKPVV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R  A   GL +ADK DSQ+ICFV +G   D V          G+IV   G++LGRH+G+ 
Sbjct: 174 RAEAARAGLAVADKPDSQEICFVTRGDAGDYVALRAPARIRPGEIVSTAGEVLGRHDGVH 233

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            +T+GQRRGLG+A   P +VV LD  ++RV+VG  E     R  +RE +W+       AV
Sbjct: 234 RFTVGQRRGLGIAGAVPRYVVRLDAAAARVVVGSAEEASRDRFEVREASWVSGAPPAGAV 293

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               +  V+ R   +   V       G  V   +   GVA GQA VFY  D     V+GG
Sbjct: 294 E--LRVKVRHRHEGERGTVRAVSGGAGAEVRLARPVRGVAPGQAAVFYAGDE----VVGG 347

Query: 381 GIIS 384
           G I+
Sbjct: 348 GRIA 351


>gi|223936336|ref|ZP_03628248.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [bacterium Ellin514]
 gi|223894854|gb|EEF61303.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [bacterium Ellin514]
          Length = 349

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 144/358 (40%), Positives = 203/358 (56%), Gaps = 12/358 (3%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSS  AALL   GYDVIG+TL+L+     ++ +  CC  Q V DAR V + + + 
Sbjct: 1   MSGGVDSSAAAALLLEQGYDVIGITLKLWPQDCVNRAEDKCCGPQAVMDARSVSNKLGIP 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           +Y+ D    F+  VI  FA  Y AG TP PCV CN  +KF  L+S  +QLGA+ +ATGH+
Sbjct: 61  YYLVDESADFQKQVIGYFAEEYKAGRTPNPCVMCNEKLKFGTLISRAQQLGAEYIATGHF 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
            R+      DG R  ++ R  D  +DQSYFLF+  Q QL    FPLG + K   R +AR+
Sbjct: 121 ARTEKSA--DGSRM-LLKRGRDPRKDQSYFLFSLRQDQLARTIFPLGQLTKTDTRTVARQ 177

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
             L  ADK +S +ICFV    Y   +++ N     +G+IV+++G +LG+H+GI  YTIGQ
Sbjct: 178 CELKTADKEESMEICFVPDNDYGKFLQQANLVKKHKGEIVNVHGHVLGQHDGIEFYTIGQ 237

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           RRGLG++  +PL+VV LD  ++RV+VG   +L+     +   NW+       +  + F+ 
Sbjct: 238 RRGLGISSAKPLYVVELDAINNRVMVGDESALDRDEFTVERCNWIPFA----SPPETFEV 293

Query: 327 FVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARVLGGGII 383
             KIR +       +    +G   V     +  +  GQACVFY  D     V+GGG I
Sbjct: 294 SAKIRYNHPGTGATITPQPNGTAKVKLHVPQRAITPGQACVFYQDD----LVVGGGWI 347


>gi|167037462|ref|YP_001665040.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300914208|ref|ZP_07131524.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X561]
 gi|307724557|ref|YP_003904308.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X513]
 gi|320115876|ref|YP_004186035.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|205810696|sp|B0K991|MNMA2_THEP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|205815314|sp|B0K0P8|MNMA2_THEPX RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|166856296|gb|ABY94704.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|300889143|gb|EFK84289.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X561]
 gi|307581618|gb|ADN55017.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X513]
 gi|319928967|gb|ADV79652.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 364

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 213/366 (58%), Gaps = 14/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY--NSRKASKRKGSCCAGQDVYDARRV 79
           RV + MSGGVDSSV A LLK+ G+DVIG+T++++  +  KA     SCC+ +   DA++V
Sbjct: 6   RVAIGMSGGVDSSVAAYLLKKQGFDVIGLTMRVWVDHEAKAFDSDKSCCSLKATQDAKKV 65

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + HY  D  + F + ++  F + Y  G TP PCV CNR +KF +LL    +LGA 
Sbjct: 66  AEILGIPHYTVDLSKIFYDKIVNYFVNEYLKGRTPNPCVLCNRQIKFGELLEKAFELGAY 125

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY+R      D+  +R ++ + +D  +DQSY L+  TQ+QL    FPLG+ KKE 
Sbjct: 126 YIATGHYVRKEY---DEKTKRYLLKKGIDSSKDQSYVLYRLTQKQLEHALFPLGNYKKEE 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R LA E+ L +A K +SQ+ICF+    Y  ++KR        G+   ++G+ LG H GI
Sbjct: 183 IRALAEELKLPVAKKPESQEICFIPDNDYSGLIKRQVKDEIKPGEFRDVHGKFLGYHKGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQRRGLG++   PL+VV +D  ++ V+VG +E +    +     N++     E  
Sbjct: 243 IHYTIGQRRGLGLSSDRPLYVVDIDVKNNVVVVGHQEDVWGEELISSNNNFISIEKLEKE 302

Query: 320 VVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    K   KIR ++++   +     +D V V F K +  +  GQ+ VFY  D     V+
Sbjct: 303 M----KVTAKIRYTAKEEEAIIKPYEEDKVLVKFLKPQRAITPGQSVVFYDKDV----VV 354

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 355 GGGIIE 360


>gi|238926764|ref|ZP_04658524.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas flueggei ATCC 43531]
 gi|238885296|gb|EEQ48934.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas flueggei ATCC 43531]
          Length = 366

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/364 (41%), Positives = 202/364 (55%), Gaps = 14/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-RKASKRKGSCCAGQDVYDARRVC 80
           RVVVAMSGGVDSSV AALL+  GY+V+GVT++L    R A     SCC+   V DARRV 
Sbjct: 10  RVVVAMSGGVDSSVTAALLQEQGYEVVGVTMRLSEEGRDADPDGRSCCSLSSVDDARRVA 69

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + + HYV D+ E F+  VI  F   YA G TP PC+ CNR +KF  LL   R LGA  
Sbjct: 70  DILGIPHYVMDFTEPFQQLVIDYFTQEYARGRTPNPCIACNRYIKFEGLLGKIRALGAQH 129

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +R+    DG     + + +D  +DQSY L+  TQ+ +  + FPLGD +K+ +
Sbjct: 130 IATGHY--ARITRTGDGIYH--LRKGIDTAKDQSYVLYHLTQKMMDHVLFPLGDYRKDEI 185

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL +A K++SQ+ICFV    Y   ++         G I    G ILG H GI 
Sbjct: 186 RHMAEDYGLPVAHKAESQEICFVPHDDYKSYLRMHALQTMRPGAITDRAGHILGTHEGIA 245

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQRRGLG++   PL+V+ LD   +RVIVG  + +    +    ++W          
Sbjct: 246 FYTIGQRRGLGISAEHPLYVIALDAAENRVIVGASDEVFACALTASNLSW----TLPQPP 301

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                   KIR  +     +++   DG V V F + +  V  GQ+ VFY  D+    VLG
Sbjct: 302 HAPRSVRAKIRYGKREADAWMEPQGDGTVAVHFSEPQRAVTPGQSIVFYEGDA----VLG 357

Query: 380 GGII 383
           GG I
Sbjct: 358 GGSI 361


>gi|167040124|ref|YP_001663109.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X514]
 gi|166854364|gb|ABY92773.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X514]
          Length = 387

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 213/366 (58%), Gaps = 14/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY--NSRKASKRKGSCCAGQDVYDARRV 79
           RV + MSGGVDSSV A LLK+ G+DVIG+T++++  +  KA     SCC+ +   DA++V
Sbjct: 29  RVAIGMSGGVDSSVAAYLLKKQGFDVIGLTMRVWVDHEAKAFDSDKSCCSLKATQDAKKV 88

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + HY  D  + F + ++  F + Y  G TP PCV CNR +KF +LL    +LGA 
Sbjct: 89  AEILGIPHYTVDLSKIFYDKIVNYFVNEYLKGRTPNPCVLCNRQIKFGELLEKAFELGAY 148

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY+R      D+  +R ++ + +D  +DQSY L+  TQ+QL    FPLG+ KKE 
Sbjct: 149 YIATGHYVRKEY---DEKTKRYLLKKGIDSSKDQSYVLYRLTQKQLEHALFPLGNYKKEE 205

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R LA E+ L +A K +SQ+ICF+    Y  ++KR        G+   ++G+ LG H GI
Sbjct: 206 IRALAEELKLPVAKKPESQEICFIPDNDYSGLIKRQVKDEIKPGEFRDVHGKFLGYHKGI 265

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQRRGLG++   PL+VV +D  ++ V+VG +E +    +     N++     E  
Sbjct: 266 IHYTIGQRRGLGLSSDRPLYVVDIDVKNNVVVVGHQEDVWGEELISSNNNFISIEKLEKE 325

Query: 320 VVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    K   KIR ++++   +     +D V V F K +  +  GQ+ VFY  D     V+
Sbjct: 326 M----KVTAKIRYTAKEEEAIIKPYEEDKVLVKFLKPQRAITPGQSVVFYDKDV----VV 377

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 378 GGGIIE 383


>gi|168214260|ref|ZP_02639885.1| tRNA -methyltransferase [Clostridium perfringens CPE str. F4969]
 gi|170714272|gb|EDT26454.1| tRNA -methyltransferase [Clostridium perfringens CPE str. F4969]
          Length = 359

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 209/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV 
Sbjct: 5   KVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD 
Sbjct: 65  QKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +
Sbjct: 125 VATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKI 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G  LG+H GI+
Sbjct: 180 REIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNALGKHKGIV 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     E  +
Sbjct: 240 YYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLEGPM 299

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V+G
Sbjct: 300 ----EVEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LVVG 351

Query: 380 GGIIS 384
           GGII 
Sbjct: 352 GGIIE 356


>gi|118580257|ref|YP_901507.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pelobacter propionicus DSM 2379]
 gi|205816920|sp|A1AQ29|MNMA_PELPD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|118502967|gb|ABK99449.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Pelobacter propionicus DSM 2379]
          Length = 355

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 154/374 (41%), Positives = 211/374 (56%), Gaps = 24/374 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSC-CAGQDVYDARRV 79
           M++ VAMSGGVDSSV AALLK  G+++IG+T+Q +          SC  AG   +DA  V
Sbjct: 1   MKIAVAMSGGVDSSVAAALLKEQGHEIIGITMQFFAP--------SCQGAGTPAHDAAVV 52

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + ++H++ D E  FR  +I  F S Y +G+TP PCV CNR VKF  LL   R+ GAD
Sbjct: 53  AAHLGITHHLLDLEHDFRQLIINDFISQYRSGQTPNPCVRCNRFVKFGLLLDAARERGAD 112

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM-KKE 198
           +LATGHY R+   +  DG R   +    +L +DQ+YFL   +Q++L  + FPLGD+  K+
Sbjct: 113 LLATGHYARTS--IDPDGTRHLRVA--ANLRKDQTYFLHTLSQERLARVVFPLGDIGSKD 168

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VRDLA   GL +A+K DSQ++CF+    Y   ++   A     GDIVH+NG++LGRH G
Sbjct: 169 EVRDLAHRFGLPVAEKGDSQEVCFIPNDDYVSYLEENCALGGETGDIVHVNGRLLGRHRG 228

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
              YTIGQR+GLG+A  EPL+VV +D     V+VG    +    +   E+ W+     E+
Sbjct: 229 THRYTIGQRKGLGIAWSEPLYVVEIDAARKLVVVGEEPHVYAQGLKAEEVGWIIAPGKEE 288

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFYTSDSNEARV 377
                F+   KIR    PV   V     G   V F +    V  GQ+ VFY  D     V
Sbjct: 289 -----FEASCKIRYRHQPVACRVTLLQGGACRVLFHEPLKAVTPGQSVVFYQDDE----V 339

Query: 378 LGGGIISGSKRSDA 391
           LGGG I+ + + D 
Sbjct: 340 LGGGRITAAIKRDG 353


>gi|220929349|ref|YP_002506258.1| tRNA-specific 2-thiouridylase MnmA [Clostridium cellulolyticum H10]
 gi|219999677|gb|ACL76278.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium cellulolyticum H10]
          Length = 359

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 210/365 (57%), Gaps = 14/365 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK--GSCCAGQDVYDARRV 79
           +V++ MSGGVDSSV AA+L R GY+VIGVTLQ++      +RK  G CC+   V DARRV
Sbjct: 5   KVMLGMSGGVDSSVAAAILLRQGYEVIGVTLQIWQDMDEERRKSEGGCCSLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV ++++ F   VI  F   Y  G TP PC+ CNR VK+  +L     +G D
Sbjct: 65  ANKLGIPYYVLNFKDIFSKTVIEYFKEEYFKGRTPNPCIACNRHVKWQAMLDKALSMGID 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY +    + D    R I+ + +  ++DQ+Y L+  TQQQL     P+GD  K+ 
Sbjct: 125 YIATGHYAK---VIQDAETGRFILKKSVTDKKDQTYALYNLTQQQLSHTLMPVGDYTKDE 181

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R++A+E+GL +A K DSQ+ICF+    Y   +        + G  V   G +LG H GI
Sbjct: 182 IREIAKEIGLSVATKPDSQEICFIHDNDYGKFLSENCDKKIVPGKFVDTKGNVLGNHKGI 241

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           ++YTIGQR+GLG+A G+P+FVV +D  ++ V++G    +   ++   ++N++      + 
Sbjct: 242 VHYTIGQRKGLGIAFGKPMFVVAVDPVNNTVVLGDDSEVFSEKLTASDLNFIS----IEK 297

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            +DG +   KIR S    P  +   D+  + V F+  +  +  GQ+ VFY  D     V+
Sbjct: 298 PIDGMRVNAKIRYSAKEAPATISIIDENRIRVVFDTPQRAITPGQSVVFYDGDV----VV 353

Query: 379 GGGII 383
           GGG I
Sbjct: 354 GGGTI 358


>gi|78043170|ref|YP_361010.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydothermus hydrogenoformans Z-2901]
 gi|123575599|sp|Q3AA24|MNMA_CARHZ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|77995285|gb|ABB14184.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydothermus hydrogenoformans Z-2901]
          Length = 365

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 147/366 (40%), Positives = 210/366 (57%), Gaps = 14/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA--SKRKGSCCAGQDVYDARRV 79
           +V+VAMSGGVDSSV AALL   GY+V+GVT+Q+++ +     +    CC+   V DARRV
Sbjct: 8   KVLVAMSGGVDSSVTAALLLEQGYEVVGVTMQIWDPKIEVIGEEYVGCCSIYAVNDARRV 67

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + + +YV ++ E F   VI  F   Y  G TP PC+ CNR +KF  LL     LG D
Sbjct: 68  ADRLGIPYYVLNFRELFERKVIDYFTEEYLRGRTPNPCIACNRYIKFDALLKKALSLGMD 127

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R  +Y  D GK    + R +D ++DQ+Y L+  TQ  L  L  PLG+  KE 
Sbjct: 128 YMATGHYARV-VYKDDIGKYG--LFRGVDRKKDQTYVLYNLTQDMLRRLLLPLGEYTKEQ 184

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR+LAR+  L  ADK +SQ+ICFV    Y   +K         G+ V +NG++LG+H G 
Sbjct: 185 VRELARKYNLVTADKPESQEICFVPDNDYRKFLKERRGEEIKPGNFVDVNGRVLGQHQGY 244

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YTIGQR+GLG+A+G+P +VV +   ++ V++G    +    +   ++N+    L+ D 
Sbjct: 245 PYYTIGQRKGLGLALGKPYYVVDIRPETNEVVIGEASEIFSPGLIASDLNF----LWFDE 300

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           + + F+   +IR +  P P  V+R   D V V F + +  +  GQA VFY  D     +L
Sbjct: 301 IPERFEAQAQIRYNAKPQPAVVERIGKDKVKVVFNEPQRAITPGQAVVFYRGDE----LL 356

Query: 379 GGGIIS 384
           GGG I 
Sbjct: 357 GGGTIE 362


>gi|108756833|ref|YP_631693.1| tRNA-specific 2-thiouridylase MnmA [Myxococcus xanthus DK 1622]
 gi|123374481|sp|Q1D6N0|MNMA_MYXXD RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|108460713|gb|ABF85898.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Myxococcus xanthus DK 1622]
          Length = 348

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 158/364 (43%), Positives = 203/364 (55%), Gaps = 18/364 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MRVVVAMSGGVDSS  AALLK  G++VIG+TL+++ S +     GSCC+  D+ DAR V 
Sbjct: 1   MRVVVAMSGGVDSSAAAALLKEQGHEVIGITLRVW-SYEGKATCGSCCSPDDIDDARAVA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
            T+ +  YV + EE F++ VI PF  SY  G TP+PCV CNR VKF+ LL   R LGA  
Sbjct: 60  QTLGIPFYVANAEEIFQDRVINPFVQSYLGGRTPIPCVACNRDVKFNFLLKRARALGAR- 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R     G     R ++ R +D  +DQSYFLF   Q +L D+ FP+G M K  V
Sbjct: 119 LATGHYARVEEVDG-----RFVLRRAVDAAKDQSYFLFTLGQDELRDILFPVGGMTKAEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A   GL  + K +S +ICFV  G Y   V+++ AG    GDIV   G +LG H GI 
Sbjct: 174 RAVAERHGLVTSQKPESMEICFVPDGDYAGFVEKV-AGPQPAGDIVDTEGNVLGTHQGIH 232

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GL +  GE  +V  L+  + RV+VGP E        L + +W+         
Sbjct: 233 RYTVGQRKGLNLGGGEIRYVHRLEPETQRVVVGPAEGTGRDNFGLLQPHWVDGPPPASQP 292

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           V+     V+IR         V  +  G V V  +     V  GQA V Y  D    RVLG
Sbjct: 293 VE-----VRIRHRHSGAQGRVHVSPHGLVSVKLDAPARAVTPGQAAVVYDQD----RVLG 343

Query: 380 GGII 383
           GG I
Sbjct: 344 GGWI 347


>gi|303241870|ref|ZP_07328364.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acetivibrio cellulolyticus CD2]
 gi|302590544|gb|EFL60298.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acetivibrio cellulolyticus CD2]
          Length = 360

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 216/365 (59%), Gaps = 16/365 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRVC 80
           V++ MSGGVDSSV AA+L   GYDVIGVT+Q++   K   +  +G CC+   V DAR V 
Sbjct: 6   VMIGMSGGVDSSVAAAVLLEKGYDVIGVTMQIWPETKEEVKLTEGGCCSLSAVDDARGVA 65

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           +++ + +YV +++E F   VI  F   Y  G+TP PC+ CNR VKF  LLS    +G D 
Sbjct: 66  NSLGIPYYVLNFKEVFEEKVINYFIDEYLKGKTPNPCIACNRHVKFESLLSKAVSMGLDY 125

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY    +   D+ ++R ++ + +  ++DQ+Y L+  TQ QL  +  P+G+  K+ V
Sbjct: 126 VATGHY---AIIEYDENRKRYLLKKSVTQQKDQTYALYNLTQDQLSKVLMPIGNYSKDVV 182

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R  A E+GL +A K DSQ+ICFV    Y   ++       + G+ V   G ILGRH G+I
Sbjct: 183 RQKAAELGLCVASKPDSQEICFVDDNNYGRFIQENTDKKIVPGNFVDTKGNILGRHKGLI 242

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
           +YT+GQR+GLG+A G+P++V+ LD  ++ VI+G    +   ++   ++N++  DGL+E  
Sbjct: 243 HYTVGQRKGLGIAFGKPMYVIGLDVKNNNVILGDNSEVFSDKLIADDLNFISIDGLYEPM 302

Query: 320 VVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V       KIR S+++     +   +  V V+F+  +  +  GQ+ VFY  D     V+
Sbjct: 303 RVKA-----KIRYSAKEGDATIIPIENGKVRVEFDTPQRAITPGQSVVFYEDDI----VV 353

Query: 379 GGGII 383
           GGGII
Sbjct: 354 GGGII 358


>gi|253580125|ref|ZP_04857392.1| tRNA methyl transferase [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848644|gb|EES76607.1| tRNA methyl transferase [Ruminococcus sp. 5_1_39BFAA]
          Length = 360

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 138/365 (37%), Positives = 208/365 (56%), Gaps = 13/365 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV A L K  G + IG T++L+ N     KR+ +CC+  DV DAR VC
Sbjct: 3   KAIIAMSGGVDSSVAALLTKETGDECIGATMKLFHNEDIGVKREKTCCSLDDVEDARNVC 62

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YVF++ ERF+  V+  F  +Y  G TP PC+DCNR +KF  +    R+L  D 
Sbjct: 63  YRMGIRYYVFNFSERFKEDVMDRFVDAYEHGSTPNPCIDCNRYLKFDKMFQRMRELEYDY 122

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY R      D+ K R ++ + +D  +DQSY L+  TQ+QL  +  PLG ++K  V
Sbjct: 123 IVTGHYARVEY---DEEKNRYLLKKAVDDTKDQSYVLYMLTQEQLAHISLPLGGLRKTEV 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A + G   A K DSQDICFV  G Y   +++     ++ GD V   G ILG+H GII
Sbjct: 180 REIAEKHGFVNARKHDSQDICFVPDGDYAKFIEQYTGRKSIPGDFVDTEGNILGKHKGII 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YT+GQRRGLG+     L+V  +   +++V++G  E L    +   ++N +      +++
Sbjct: 240 HYTLGQRRGLGIPAASRLYVCDISPKTNQVVLGNNEDLFHSELTATKVNLISC----ESL 295

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            +  +   KIR           + +DGV +V F+K +  +  GQA V Y  D     V+G
Sbjct: 296 KEPMRLKAKIRYRHPEQEAVAWQTEDGVLHVRFDKPQRAITRGQAVVLYDGDI----VVG 351

Query: 380 GGIIS 384
           GG+I 
Sbjct: 352 GGVIE 356


>gi|159897370|ref|YP_001543617.1| tRNA-specific 2-thiouridylase MnmA [Herpetosiphon aurantiacus ATCC
           23779]
 gi|205816856|sp|A9AYA7|MNMA_HERA2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|159890409|gb|ABX03489.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 357

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 144/369 (39%), Positives = 212/369 (57%), Gaps = 15/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +++VAMSGGVDSS+ A LLK  G+DV GVT+ L+        +  CC+ +    ARRVC 
Sbjct: 3   KIMVAMSGGVDSSLTAVLLKEQGHDVTGVTMHLWEGDDNGIMESQCCSVEMTAGARRVCA 62

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
             ++ +YVF+Y++ FR  VI  F   Y++G TP PC+ CNR +KF  LL     LG D L
Sbjct: 63  QYDIPYYVFNYQKDFRKHVIDYFLREYSSGATPNPCLACNRDLKFRVLLERAELLGFDGL 122

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGH+++    +   G++   + R +D+ +DQSY L+  +Q++L  L FPLG   K  VR
Sbjct: 123 ATGHFVQ----ITGGGEQPYDLRRGIDINKDQSYVLYMLSQRELGRLHFPLGGFTKPQVR 178

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +ARE GL  ADK +S DICF+    Y   +      I   G IV+ +G +LG+H G+  
Sbjct: 179 QMARERGLVTADKPESMDICFIPDNNYRRFLNEERPEIMQPGPIVNRHGTVLGQHKGLPQ 238

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+A G PLFV+ +D   + +IVG  + LE     + ++  +  G  E  + 
Sbjct: 239 YTIGQRKGLGIAAGSPLFVIEIDTVRNLLIVGDADELERRDFVIDDVRSV-YGQIEAGIY 297

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                 V+IR+  + VP  +   +DG +++ +++ +  V  GQA V Y  D    RV GG
Sbjct: 298 A-----VQIRAHGEAVPATITPREDGTLHIRYDQPQRSVTPGQAAVLYRDD----RVFGG 348

Query: 381 GIISGSKRS 389
           G IS  + S
Sbjct: 349 GRISTERYS 357


>gi|291562415|emb|CBL41231.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [butyrate-producing bacterium SS3/4]
          Length = 358

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 208/367 (56%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    +   +  G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAACLLKEQGYDVIGVTMQIWQEEDSCTVEENGGCCGLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             T+ + +YV ++ + F+  VI  F + Y  G TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 64  AWTLGIPYYVMNFRKEFQKNVIDYFVAEYLHGRTPNPCIACNRYVKWEALLERSLEIGAD 123

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R S+L  G     R  +   +   +DQ+Y L+  TQ QL     P+GD  K+
Sbjct: 124 YIATGHYARISQLPNG-----RYTIRNSVTAAKDQTYALYNLTQFQLSKTLMPIGDYTKD 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR +A + GL +A K DS +ICFV    Y   ++R  + +   G+ V  NG ILG+H G
Sbjct: 179 EVRKIAEDRGLAVAKKKDSMEICFVPDNDYAGFIEREASDVPGCGNFVDKNGVILGKHKG 238

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           I +YT+GQR+GL +AMG P+FV  +   ++ V++G    +    +  R++NW+  DGL  
Sbjct: 239 ITHYTVGQRKGLNLAMGHPVFVTGIRPETNEVVIGDGNDVFSDHLICRDVNWMAIDGLHG 298

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +      +   KIR S    P  ++   DG V   F++ +  +  GQA VFY  +     
Sbjct: 299 EEK----EVLAKIRYSHKGSPCIIRELPDGTVECQFKEPQRAITPGQAVVFYEDEC---- 350

Query: 377 VLGGGII 383
           V+GGG I
Sbjct: 351 VVGGGTI 357


>gi|254478804|ref|ZP_05092171.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydibrachium pacificum DSM 12653]
 gi|214035259|gb|EEB75966.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Carboxydibrachium pacificum DSM 12653]
          Length = 376

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 145/380 (38%), Positives = 221/380 (58%), Gaps = 17/380 (4%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKG 65
           RL +L + KN    RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +  +A + +G
Sbjct: 7   RLENLSMQKNN---RVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDKDEEAVRVEG 63

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
            CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +K
Sbjct: 64  GCCSLAAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIK 123

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL
Sbjct: 124 FEELLKRAWMIDAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQL 180

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+ 
Sbjct: 181 EHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEF 240

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
               G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +  
Sbjct: 241 RDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVYGDEL-- 298

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQA 364
             I++  + +  D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+
Sbjct: 299 --ISYNNNFISIDKLEKEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRAITPGQS 356

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D     V+GGGII 
Sbjct: 357 VVFYDGDI----VVGGGIIE 372


>gi|89895170|ref|YP_518657.1| hypothetical protein DSY2424 [Desulfitobacterium hafniense Y51]
 gi|122482441|sp|Q24US9|MNMA_DESHY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|89334618|dbj|BAE84213.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 370

 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 146/370 (39%), Positives = 204/370 (55%), Gaps = 14/370 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV MSGGVDSS+ AALLK +GY+VIG+TLQ   S       G CC+   + DARRV  
Sbjct: 8   KVVVGMSGGVDSSMAAALLKEEGYEVIGITLQTMPS-GGPDDVGGCCSITAIDDARRVAH 66

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV ++   F   VI  F ++Y +GETP PC  CNR V++ + L   R LGAD L
Sbjct: 67  QLGIPHYVLNFRTIFDENVIDYFTNAYLSGETPNPCTMCNRVVRWGEFLRKARALGADYL 126

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +    + D    R  + RP D  +DQ+Y L+  TQ QL    FPL D KKE +R
Sbjct: 127 ATGHYAK---VLQDPQSGRCFLSRPTDTWKDQTYMLYNLTQDQLKHTLFPLADYKKEHIR 183

Query: 202 DLAREMGL-DIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           ++A E GL  ++ K DSQ+ICF+    Y   ++  +      G+ V   G ILGRH G+I
Sbjct: 184 EMAAERGLLRVSRKPDSQEICFIPDDDYVSFIRERSPEKIKPGNFVDRQGNILGRHQGLI 243

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           NYT+GQR+GLGV  G+P+FV+  +   + VI+G  + +  H +   ++NW+     E  +
Sbjct: 244 NYTVGQRKGLGVTFGKPMFVLGFNVEGNEVILGEDQEVYAHTLLATDLNWIAIPGVEGPL 303

Query: 321 VDGFKCFVKIRSSQDP-VPVFVQRNDDG-----VYVDFEKSEVGVASGQACVFYTSDSNE 374
               K   K   ++   +P+       G     V V+F   +  +  GQA VFY     E
Sbjct: 304 TVQAKIRYKAPLAEAKIIPLKDSETLPGAIGPVVRVEFTTPQRAITPGQAVVFY---QGE 360

Query: 375 ARVLGGGIIS 384
             V GG II+
Sbjct: 361 LVVGGGKIIT 370


>gi|182418877|ref|ZP_02950134.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium butyricum 5521]
 gi|237667388|ref|ZP_04527372.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium butyricum E4 str. BoNT E BL5262]
 gi|182377160|gb|EDT74728.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium butyricum 5521]
 gi|237655736|gb|EEP53292.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium butyricum E4 str. BoNT E BL5262]
          Length = 360

 Score =  254 bits (648), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 207/365 (56%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +V++ MSGGVDSSV A LLK  GY+VIG T+Q++   K   +R+G CC+   V DARRVC
Sbjct: 6   KVLIGMSGGVDSSVAAYLLKEQGYEVIGATMQIWQEDKEFEEREGGCCSLSAVEDARRVC 65

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D + +  YV ++ + F+  VI PF   Y  G TP PC++CN+ +KF +LL   R +GAD 
Sbjct: 66  DKLGIPFYVLNFRDYFKEKVIEPFIQEYMDGRTPNPCIECNKHLKFDELLRRARGIGADY 125

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R ++ R  D  +DQ+Y L+  TQ QL     P G  +K  +
Sbjct: 126 VATGHYAKIEERDG-----RYLLIRSDDDSKDQTYALYNFTQDQLAHTLMPCGAYEKTKI 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +          G+ V   G +LG+H GI+
Sbjct: 181 REIAKEIGLAVHNKKDSEEICFISDNNHGKYISEARPSRVKPGNFVDKEGNVLGKHKGIV 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+++G P+FV  ++  ++ VI+G  + +  + +   ++N++      D +
Sbjct: 241 YYTIGQRKGLGLSLGRPVFVTGINAKTNEVIIGSEDEIFKNDLIATDVNFIS----FDKL 296

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                   KIR S  P    +    +G V V F+  +  +  GQ+ VFY  +     V+G
Sbjct: 297 EGELNVQAKIRYSARPAEAIIYPLPNGKVKVSFKDKQRAITKGQSVVFYDKEV----VVG 352

Query: 380 GGIIS 384
           GGII 
Sbjct: 353 GGIIE 357


>gi|323485784|ref|ZP_08091119.1| hypothetical protein HMPREF9474_02870 [Clostridium symbiosum
           WAL-14163]
 gi|323693136|ref|ZP_08107354.1| hypothetical protein HMPREF9475_02217 [Clostridium symbiosum
           WAL-14673]
 gi|323400772|gb|EGA93135.1| hypothetical protein HMPREF9474_02870 [Clostridium symbiosum
           WAL-14163]
 gi|323502619|gb|EGB18463.1| hypothetical protein HMPREF9475_02217 [Clostridium symbiosum
           WAL-14673]
          Length = 359

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 210/367 (57%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++   +    +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEEPEIQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV +++  F+  V+  F   Y  G+TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  AENLGIPYYVMNFKREFKENVMDYFVQEYIEGKTPNPCIACNRFVKWESLLKRSMDIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  + +     +DQ+Y L+  TQ QL     P+G+  K+
Sbjct: 125 YIATGHYARIEQLENG-----RYTLRKSATAAKDQTYALYNLTQHQLSHTLMPVGEYTKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R +A ++GL++A K DSQ+ICF+    Y   ++        EG+ V  +G++LGRH G
Sbjct: 180 EIRGMADKIGLNVAHKPDSQEICFIPDHDYAKFIEENTDCRLPEGNFVDKDGRVLGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           I +YT+GQR+GL +A+G P+FV  +  +++ V++G  E +   R+   ++NW+  +GL +
Sbjct: 240 ITHYTVGQRKGLNLALGRPVFVTEIRPDTNEVVIGDNEDVFSRRLTCGKLNWMAVEGLPD 299

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
               DG K   KIR S    P  ++   +D V   F+  +     GQA VFY  +     
Sbjct: 300 ----DGMKVTAKIRYSHKGAPCMIRTIGEDLVECVFDDPQRAATPGQAVVFYDGEY---- 351

Query: 377 VLGGGII 383
           V+GGG I
Sbjct: 352 VVGGGTI 358


>gi|253699615|ref|YP_003020804.1| tRNA-specific 2-thiouridylase MnmA [Geobacter sp. M21]
 gi|251774465|gb|ACT17046.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M21]
          Length = 355

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 158/377 (41%), Positives = 215/377 (57%), Gaps = 29/377 (7%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQD 72
           +  N K  +V VAMSGGVDSS VAALLK  G +VIG+ ++L+    +  + KG       
Sbjct: 1   MSANYKGRKVAVAMSGGVDSSTVAALLKEQGAEVIGINMKLFARDGEDPQAKG------- 53

Query: 73  VYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSV 132
             DA+ V + + +  ++   EE F   ++  F + Y  GETP PCV CNR VKF  LL  
Sbjct: 54  --DAQIVAEYLGIEFHLVHLEEEFSRLIMEDFRAQYLGGETPNPCVRCNRYVKFGLLLDK 111

Query: 133 TRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPL 192
             +LGA+ LATGHY+R+     DDG    ++ +   L +DQSYFL+  TQ+QL  + FPL
Sbjct: 112 ALELGAEYLATGHYVRTSR---DDGGSYHLL-KAAFLAKDQSYFLYTLTQKQLSHVVFPL 167

Query: 193 GDM-KKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQ 251
           GDM  K+ VR LA + GL +A KSDSQ+ICFV    Y   +++        GDIVH++G 
Sbjct: 168 GDMPSKDEVRRLAEKFGLPVAQKSDSQEICFVPGDDYVAFLEKGGRVAGKSGDIVHVDGA 227

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           +LGRH+G   YTIGQRRGLGVA  EPL+VV +D    RV+VG    L    +   ++NW+
Sbjct: 228 VLGRHSGTHRYTIGQRRGLGVAWKEPLYVVSIDALEGRVVVGEVGRLFAAGLVACDLNWV 287

Query: 312 GDGLFEDAVVDG--FKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFY 368
                    V+G  F+   KIR  Q P+   V+   +G+  V F + +  V  GQ+ VFY
Sbjct: 288 -------VPVEGETFETTCKIRYRQQPIACRVKLLGEGLGEVFFAEPQKSVTPGQSVVFY 340

Query: 369 TSDSNEARVLGGGIISG 385
             D     +LGGG I G
Sbjct: 341 RDDE----LLGGGRIVG 353


>gi|167749316|ref|ZP_02421443.1| hypothetical protein EUBSIR_00268 [Eubacterium siraeum DSM 15702]
 gi|167657707|gb|EDS01837.1| hypothetical protein EUBSIR_00268 [Eubacterium siraeum DSM 15702]
          Length = 387

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 147/370 (39%), Positives = 213/370 (57%), Gaps = 23/370 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++ +AMSGGVDSSV   LLK D Y+V G TL+L++SR  +   G C +  D+ DA+ +  
Sbjct: 32  KLAIAMSGGVDSSVALVLLK-DKYEVSGYTLKLHDSR-GTDDSGLCGSASDIEDAKAIAA 89

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
              V HY+ D  + F + V   F  SY +G TP PCV+CN T+KF  LL   ++ G + +
Sbjct: 90  KFGVPHYLLDMRDLFSDTVQKSFVQSYLSGRTPNPCVECNETIKFGALLDAVKKQGINHI 149

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLE-----RDQSYFLFATTQQQLCDLRFPLGDMK 196
           ATGHY+RS     D+   R ++ + ++ +     +DQSY L+  +QQQL    FPLG+M 
Sbjct: 150 ATGHYVRS---CYDEKSGRWLLKKAINADGTSNAKDQSYVLYRLSQQQLAASVFPLGEMT 206

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ +R +A + GL  +DK DSQDICFV  G Y   ++R       +GD +  NG ++GRH
Sbjct: 207 KDEIRHIAADSGLINSDKPDSQDICFVPDGDYAGFIERYTGNTYPDGDFLDENGNVIGRH 266

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            G+I YTIGQRRG+G   G+P++V+  + +++ V +G  E L    +Y   +NW+    F
Sbjct: 267 KGVIFYTIGQRRGIGTGFGKPMYVIGKNADNNTVTLGSNELLFTDTLYADNLNWIA---F 323

Query: 317 EDAVVDGFKCFVKI--RSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
           E    + FKC  K   R ++ P  V+ Q RN   V V F++    V  GQ  VFY  D  
Sbjct: 324 EYPESE-FKCRAKTRYRQTEQPCTVYPQGRNT--VRVVFDEKIRAVTPGQHVVFYDGDI- 379

Query: 374 EARVLGGGII 383
              VLGGG+I
Sbjct: 380 ---VLGGGVI 386


>gi|170760751|ref|YP_001786568.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A3 str.
           Loch Maree]
 gi|205810328|sp|B1KZE1|MNMA1_CLOBM RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|169407740|gb|ACA56151.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A3 str. Loch Maree]
          Length = 356

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 214/366 (58%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCITCNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYA-----IIEKHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G +LGRH GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNVLGRHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++IN++  D L E  
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDINYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   +DG V V+F++ +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQTPSKAIITPIEDGRVRVNFQEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|150015984|ref|YP_001308238.1| tRNA-specific 2-thiouridylase MnmA [Clostridium beijerinckii NCIMB
           8052]
 gi|205813680|sp|A6LSF2|MNMA_CLOB8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|149902449|gb|ABR33282.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium beijerinckii NCIMB 8052]
          Length = 358

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 136/365 (37%), Positives = 217/365 (59%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK+ GYDVIG T+Q++ +  +  +R+G CC+   V DARRVC
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKQQGYDVIGATMQIWQHDEEFEEREGGCCSLSAVDDARRVC 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D +++  YV ++ + F+  VI  F   Y  G+TP PC++CN+ +KF +LL   R +GAD 
Sbjct: 64  DKLDIPFYVLNFRDYFKEKVIDKFVQEYIDGKTPNPCIECNKHLKFDELLRRARGIGADY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +++   DD   R ++ R  D  +DQ+Y L+  TQ QL     P GD +K  +
Sbjct: 124 VATGHY--AKIEKRDD---RYLLIRSDDDRKDQTYALYNFTQDQLEHTLMPCGDYEKTKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +          G+ V  +G ILG+H GI+
Sbjct: 179 REIAKEIGLAVHNKKDSEEICFISDNNHGKYISEAEPNRVKPGNFVDKSGNILGKHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+++G P+FV  ++  ++ V++G  + +    +   ++N++     E  +
Sbjct: 239 YYTIGQRKGLGLSLGRPVFVTNINAKTNEVVLGSEDDIFKTELIATDVNFIPFDKLEKEI 298

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +    +G V V F++ +  +  GQ+ VFY    ++  V+G
Sbjct: 299 ----EVTAKIRYSARPAEATLIPLPNGRVKVIFKEKQRAITKGQSVVFY----DDEIVVG 350

Query: 380 GGIIS 384
           GGII 
Sbjct: 351 GGIIE 355


>gi|257060381|ref|YP_003138269.1| tRNA-specific 2-thiouridylase MnmA [Cyanothece sp. PCC 8802]
 gi|256590547|gb|ACV01434.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. PCC 8802]
          Length = 349

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 151/365 (41%), Positives = 210/365 (57%), Gaps = 23/365 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA+L   GY+VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSVAAAVLHHQGYEVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H++ D  + F+  ++    S Y AG TPLPC  CNR VKF  +L   RQ LG D 
Sbjct: 56  QLGIPHHIVDSRDVFQANIVNYLVSGYEAGITPLPCSQCNRAVKFGPMLDYARQELGCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+  +R  + R +D  +DQSYFL+  +Q+ L    FPLGD  KE  
Sbjct: 116 IATGHYARIRY---DEISQRYQLLRAIDRNKDQSYFLYDLSQEMLAGTVFPLGDQTKEDT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVV--KRINAGIALEGDIVHLNGQILGRHNG 258
           R +A E  L  A K +SQD+C ++          + IN     EGDIV L G++LG+H G
Sbjct: 173 RRIAAEFDLKTASKPESQDLCLIEAHGSMKTFLDQYINQK---EGDIVDLEGKVLGKHQG 229

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YTIGQR+GLGVA  EPL+VV LD   ++VIV  R +       +  +NW+   + E 
Sbjct: 230 IHHYTIGQRKGLGVAAPEPLYVVKLDPIMNQVIVANRANAGRSHCTVTRLNWV--SIAEP 287

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +     +  ++ RSS  PV   +   D+ V + F++ E G+  GQA VFY  +     +L
Sbjct: 288 STPIRVETQIRYRSSAVPVD-LIPLEDNRVKLVFDEPEFGITPGQAAVFYDGEI----LL 342

Query: 379 GGGII 383
           GGGII
Sbjct: 343 GGGII 347


>gi|188588033|ref|YP_001920516.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum E3 str.
           Alaska E43]
 gi|251778087|ref|ZP_04821007.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
 gi|205813690|sp|B2V3V9|MNMA_CLOBA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|188498314|gb|ACD51450.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum E3 str. Alaska E43]
 gi|243082402|gb|EES48292.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 361

 Score =  253 bits (645), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 210/351 (59%), Gaps = 13/351 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-RKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIG T+Q++   ++  +R+G CC+   V DARRVC
Sbjct: 7   KVLVGMSGGVDSSVAAYLLKEQGYEVIGATMQIWQEDKEVEEREGGCCSLSAVEDARRVC 66

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           D +++  YV ++ + F+  VI PF   Y  G TP PC++CN+ +KF +LL   + +G D 
Sbjct: 67  DKLDIPFYVLNFRDSFKKKVIEPFIQEYIDGRTPNPCIECNKHLKFDELLRKAQGIGVDY 126

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +++   DD   R ++ R  D  +DQ+Y L+  TQ QL     P G+  K+ +
Sbjct: 127 IATGHY--AKIEKKDD---RYMLIRSDDDRKDQTYALYNFTQDQLAHTLMPCGEYTKDRI 181

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +     G    G+ V  +G +LG+H GI+
Sbjct: 182 REIAKEIGLAVHNKKDSEEICFISDNDHGKYILNAKPGAVKSGNFVDKSGNVLGKHKGIV 241

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+++G P+FV  ++  ++ V++G  E +    +   ++N++  D L ++ 
Sbjct: 242 YYTIGQRKGLGLSVGRPVFVTDINPRTNEVVIGAEEDIFKTELIAGDLNFITFDKLEKEI 301

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYT 369
            V+      KIR S  P    +    DG V V F++ +  +  GQ+ VFY 
Sbjct: 302 EVEA-----KIRYSAKPAKATIVPLKDGRVKVVFDEKQRAITKGQSVVFYN 347


>gi|307265214|ref|ZP_07546773.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919836|gb|EFN50051.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 387

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 215/370 (58%), Gaps = 14/370 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY--NSRKASKRKGSCCAGQDVYDARRV 79
           RV + MSGGVDSSV A LLK++G+DVIG+T++++  ++ KA     SCC+ +   DA++V
Sbjct: 29  RVAIGMSGGVDSSVAAYLLKKEGFDVIGLTMKVWVDHAAKAFDSDKSCCSLRATQDAKKV 88

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + V HY  D+ E F + ++  F + Y  G TP PCV CNR +KF +LL    +LGA 
Sbjct: 89  AEMLGVPHYTVDFSEVFYDKIVNYFINEYLKGRTPNPCVLCNRQIKFGELLEKAFELGAY 148

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY+R      D+  +R ++ + +D  +DQSY L+  TQ+QL    FPLG+ KKE 
Sbjct: 149 YIATGHYVRKDY---DEKTKRYLLKKGIDSSKDQSYVLYRLTQKQLEHALFPLGNYKKEE 205

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R LA  + L +A K +SQ+ICF+    Y   +KR        G+   ++G+ LG H GI
Sbjct: 206 IRALAEGLKLPVAKKPESQEICFIPDNDYSGFIKRQVKDEIKPGEFRDVHGKFLGYHKGI 265

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQRRGLG++   PL+VV +D  ++ V+VG +E +    +     N++      + 
Sbjct: 266 IHYTIGQRRGLGLSSDRPLYVVDIDVKNNVVVVGHQEDVWGEELISSNNNFISI----EK 321

Query: 320 VVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    K   KIR ++++   +     +D V V F K +  +  GQ+ VFY  D     V+
Sbjct: 322 LKREMKVTAKIRYTAKEEEAIIKPYEEDKVLVKFLKPQRAITPGQSVVFYDKDV----VV 377

Query: 379 GGGIISGSKR 388
           GGGII    R
Sbjct: 378 GGGIIEKKVR 387


>gi|167751458|ref|ZP_02423585.1| hypothetical protein EUBSIR_02454 [Eubacterium siraeum DSM 15702]
 gi|167655704|gb|EDR99833.1| hypothetical protein EUBSIR_02454 [Eubacterium siraeum DSM 15702]
          Length = 358

 Score =  253 bits (645), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 210/364 (57%), Gaps = 15/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + V+AMSGGVDSSV A L+K+ G+D IGVT++L+ N      R+ SCC+  DV DAR V 
Sbjct: 4   KAVIAMSGGVDSSVAAYLMKQRGFDCIGVTMKLFANEDIGISREHSCCSLDDVEDARSVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
            ++++ +YVF++ +RF   VI  F ++Y  G TP PC+DCNR +KF  L    ++L  D 
Sbjct: 64  YSLDMPYYVFNFSDRFETDVIDRFINAYENGITPNPCIDCNRYLKFDKLYMRAKELDRDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY R    V  DG  R ++ + +D  +DQSY L+  TQ+QL    FPLG+M+K   
Sbjct: 124 VVTGHYAR----VEKDGNGRFLLKKALDDTKDQSYVLYCLTQEQLSHTIFPLGEMRKSQA 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A   G   A K+DSQDICFVQ G Y D +++       +GD +  +G ++GRH G+I
Sbjct: 180 REIAESQGFINARKADSQDICFVQNGSYADFIEQYTGKNYPDGDFLDKDGNVIGRHKGVI 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GLG++  EPL+V  ++  S+ V +   + L    +   +IN     L     
Sbjct: 240 RYTVGQRKGLGISAPEPLYVKAVNPVSNTVTLSYNDWLYSSIVKAGDIN-----LISVPE 294

Query: 321 VDG-FKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           + G  +   K+R         V +N D +   F++ +  V  GQA V Y  D+    V+G
Sbjct: 295 IKGEMRVKAKVRYRHTEQWATVTQNGDTITAVFDEPQRAVTCGQALVLYDGDT----VVG 350

Query: 380 GGII 383
           GG I
Sbjct: 351 GGTI 354


>gi|15606458|ref|NP_213838.1| hypothetical protein aq_1224 [Aquifex aeolicus VF5]
 gi|6226257|sp|O67274|MNMA_AQUAE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|2983672|gb|AAC07238.1| hypothetical protein aq_1224 [Aquifex aeolicus VF5]
          Length = 356

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 146/373 (39%), Positives = 212/373 (56%), Gaps = 26/373 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARR 78
           MRV V MSGGVDSSV A LLK  G+DVI VTL+ +     + ++    CC+ +DV DA R
Sbjct: 1   MRVAVGMSGGVDSSVTALLLKEQGHDVIRVTLRFHTVEACEVNETHNVCCSPKDVQDASR 60

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG- 137
           V   + + H VF +EE F++ VI  F   Y  G TP PC  CNR VK        +Q+  
Sbjct: 61  VAKRLGIPHLVFSWEEIFKSKVIDYFVEEYKRGRTPNPCALCNREVKTGFFARYLKQVAD 120

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
            D LATGHY +    + +D K   ++ RP D +RDQ+YFL    ++ L  L FPLG   K
Sbjct: 121 IDKLATGHYAK----IEEDKKYGLVIKRPKDRKRDQTYFLSLVRREDLELLTFPLGAYTK 176

Query: 198 ESVRDLAREMGLDIADKSDSQDICFV---QQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           E VR++A+  GL++A K DSQ++CF+     G+Y + +     G+     I H++G++LG
Sbjct: 177 EEVREIAKRYGLEVAQKRDSQEVCFLMGKSPGEYLEGILGKQRGL-----IKHVSGKVLG 231

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            H G+  YTIGQRRGLG++ G+P++V+ +D  ++ +IVG  E L   ++ ++EIN     
Sbjct: 232 EHEGVYRYTIGQRRGLGISYGKPVYVIDIDAKTNTLIVGEEEYLYNDKLLVKEIN----- 286

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
            F   +        +IR    PVPV  +++ ++G  V F++   G+  GQ   FY  D  
Sbjct: 287 -FHVPLEKWENVSAQIRYRHKPVPVERIEKTEEGFLVKFKEDVRGITPGQVVAFYDGDV- 344

Query: 374 EARVLGGGIISGS 386
              +LGGGII  S
Sbjct: 345 ---LLGGGIIEES 354


>gi|182625650|ref|ZP_02953419.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens D str. JGS1721]
 gi|177909052|gb|EDT71527.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens D str. JGS1721]
          Length = 359

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 209/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVC 80
           +VV+ MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV 
Sbjct: 5   KVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++  YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD 
Sbjct: 65  QKLDIPFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +
Sbjct: 125 VATGHYAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKI 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H GI+
Sbjct: 180 REIAKEIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKGIV 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     E  +
Sbjct: 240 YYTIGQRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLEGPM 299

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               +   KIR S  P    +   ++  V V FE  +  +  GQ+ VFY  D     V+G
Sbjct: 300 ----EVEAKIRYSARPAKATISPMENVRVKVSFEDKQRAITKGQSVVFYKDD----LVVG 351

Query: 380 GGIIS 384
           GGII 
Sbjct: 352 GGIIE 356


>gi|95930240|ref|ZP_01312978.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Desulfuromonas acetoxidans DSM 684]
 gi|95133703|gb|EAT15364.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Desulfuromonas acetoxidans DSM 684]
          Length = 346

 Score =  252 bits (644), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 205/366 (56%), Gaps = 22/366 (6%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K   V+VAMSGGVDSSV AALL   GY+VIG  ++L    ++ + +          DARR
Sbjct: 2   KKNTVLVAMSGGVDSSVTAALLIDQGYEVIGAHMRLLPGDQSIQGEA---------DARR 52

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           + + + +  +  D  + F  A+I  F   Y AG TP PCV CN+  KF  L ++  +LGA
Sbjct: 53  IAEELEIPFHSLDCRDTFNAAIIGDFCREYRAGRTPNPCVRCNQQFKFGALFALADELGA 112

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY R      D  K    +CR +  ++DQSYFLF  +  QL  + FPLG + K 
Sbjct: 113 DYLATGHYARI-----DRQKDHVRLCRGLYKQKDQSYFLFVLSAAQLKRVLFPLGGLTKP 167

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR+LA +  L    KS+SQDICFV    Y   ++R ++     G+IVH+NG++LG H+G
Sbjct: 168 EVRNLAEKYHLSSRKKSESQDICFVPDNDYIGFLERYDSPWPDHGEIVHINGKVLGTHHG 227

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
              YTIGQRRGLG+   EPL+V+ LD    RVIVG + +L+  R+ +R++ W        
Sbjct: 228 THRYTIGQRRGLGIGWTEPLYVIELDAEQQRVIVGEKAALQRDRLQVRDVTWSVPPQHTS 287

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             VD   C ++ R       + ++ N D V V F++ + GV  GQ  VFY  D     VL
Sbjct: 288 LRVD---CRIRYRHHPAMATLSIRPNGD-VDVVFDEPQYGVTPGQCAVFYDDDC----VL 339

Query: 379 GGGIIS 384
           GGG I+
Sbjct: 340 GGGWIT 345


>gi|297545060|ref|YP_003677362.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296842835|gb|ADH61351.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 364

 Score =  252 bits (644), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 217/369 (58%), Gaps = 14/369 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDA 76
           K+ RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +  +A + +G CC+   V DA
Sbjct: 3   KNNRVVVGMSGGVDSSVSAYLLKEQGYEVIGVTMQIWQDKDEEAVRVEGGCCSLAAVNDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     +
Sbjct: 63  RRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIKFEELLKRAWMI 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            A  +ATGHY        D+ +RR ++ + +D  +DQ+Y L+  TQ QL  + FPLG  K
Sbjct: 123 DAYYVATGHYAIKEY---DEERRRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKYK 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ VR LA+++GL +A K DSQ+ICFV    Y   ++         G+     G+ LG H
Sbjct: 180 KDEVRKLAKDLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGYH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +    I++  + + 
Sbjct: 240 KGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVYGDEL----ISYNNNFIS 295

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
            D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+ VFY  D    
Sbjct: 296 IDKLEGEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDSPQRAITPGQSVVFYDGDI--- 352

Query: 376 RVLGGGIIS 384
            V+GGGII 
Sbjct: 353 -VVGGGIIE 360


>gi|330838778|ref|YP_004413358.1| tRNA-specific 2-thiouridylase mnmA [Selenomonas sputigena ATCC
           35185]
 gi|329746542|gb|AEB99898.1| tRNA-specific 2-thiouridylase mnmA [Selenomonas sputigena ATCC
           35185]
          Length = 352

 Score =  252 bits (643), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 144/363 (39%), Positives = 211/363 (58%), Gaps = 19/363 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V VAMSGGVDSS+ AALL+  GY+V+G+T+QL +  +      S        DARRV D
Sbjct: 4   KVAVAMSGGVDSSLCAALLQEQGYEVLGITMQLSDDSREMNGVSSAAT-----DARRVAD 58

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + H V D+   F + V+  F + Y    TP PCV CNR +KF +LLS  ++ GAD L
Sbjct: 59  FLGIEHVVADFRTLFSDKVVDYFLTEYLTARTPNPCVICNRFLKFGELLSFAKEKGADFL 118

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R  +   +DG     + +  D ++DQSY L+   ++ L  + FPLG  +KE  R
Sbjct: 119 ATGHYVR--VEKEEDGSFS--LKKGRDEKKDQSYVLYRLPREILSHILFPLGSYRKEETR 174

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            LA+++ L +A+K++SQ+ICFV +  Y   + +        GDIV + GQILG+H G+  
Sbjct: 175 ALAQKLSLPVANKAESQEICFVPEDDYKAYLSQHRPNRFHTGDIVDMQGQILGQHRGLPF 234

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+A   PL+V+ LD+ ++RVIVG  E L    ++  ++NWL +   ++  V
Sbjct: 235 YTIGQRKGLGIAAAHPLYVIALDEANNRVIVGKNEELYASSLFASDVNWLMEEPTQEISV 294

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                  KIR     V   V   +DG V V F + +  V  GQ+ VFY+ +    R++GG
Sbjct: 295 HA-----KIRYGSREVQANVLPLEDGAVKVSFLEPQRAVTPGQSVVFYSGE----RLVGG 345

Query: 381 GII 383
             I
Sbjct: 346 ATI 348


>gi|291542284|emb|CBL15394.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus bromii L2-63]
          Length = 357

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 139/364 (38%), Positives = 207/364 (56%), Gaps = 13/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV A L K  GYD  G+TL+L+ N     KR+ +CC+  D+ DARRVC
Sbjct: 4   KALIAMSGGVDSSVAAFLTKDMGYDATGITLKLFDNEDIGEKREKTCCSLDDIDDARRVC 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YV+++++ F+  VI  F  +Y  G TP PC+DCNR +KF  L+    +L  D 
Sbjct: 64  LKLGIPYYVYNFKDSFKENVIDRFIRAYENGTTPNPCIDCNRFIKFEKLIRRAEELDFDC 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY        D G  R ++ + +D  +DQSY L+  TQ+QL     PLG   KE V
Sbjct: 124 VVTGHYSTIEY---DKGADRYLLKKSVDSTKDQSYVLYCLTQRQLAKTLLPLGTYTKEKV 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A E+GL  A K DSQDICFV  G Y   +++        G+ V   G ILG H GII
Sbjct: 181 REIANELGLINARKHDSQDICFVPDGDYAKFIEQYTGRTYPNGNFVDTKGHILGEHKGII 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GLG+A+  P++V   + +++ VI+     L    +Y  +IN +      D +
Sbjct: 241 RYTVGQRKGLGLALPHPMYVKEKNLDTNEVILCDNNELFSKELYATDINLIT----CDKI 296

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               K   ++R SQ      V++ DD  +++ F++ +  ++ GQA V Y  +     V+G
Sbjct: 297 DKPIKVKARVRYSQPEKDAIVEQIDDNTLHIVFDEPQRAISKGQAAVLYDGEY----VVG 352

Query: 380 GGII 383
           GG I
Sbjct: 353 GGTI 356


>gi|307151112|ref|YP_003886496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. PCC 7822]
 gi|306981340|gb|ADN13221.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. PCC 7822]
          Length = 353

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 151/364 (41%), Positives = 208/364 (57%), Gaps = 23/364 (6%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VVV +SGGVDSS  AA L   GY+V+G+TL L       K KG CC+ + + DA  +C+ 
Sbjct: 4   VVVGLSGGVDSSTAAATLHHQGYEVVGLTLWLM------KGKGQCCS-EGMVDAAFICEQ 56

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADVL 141
           + + H++ D  + F+  +I    S Y AG TPLPC  CNR VKF  +L   RQ LG D +
Sbjct: 57  LGIPHHIVDSRDVFQENIIDYLVSGYEAGITPLPCSQCNRAVKFGPMLRYARQELGIDCI 116

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R R    D+  +R  + R +D  +DQSYFL+  TQ  L    FPLG+  KE  R
Sbjct: 117 ATGHYARIRY---DETTQRYQLLRAVDRNKDQSYFLYDLTQDLLAGTIFPLGNQTKEETR 173

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVV--KRINAGIALEGDIVHLNGQILGRHNGI 259
            +A E GL  ADK +SQD+C ++          + I+     EGDIV L G++LG+H GI
Sbjct: 174 RIANEFGLKTADKPESQDLCLIEAHGSMQAFLDQYIHQK---EGDIVDLKGKVLGKHKGI 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+G+GVA  EPL+VV LD   ++VIVG R         +  +NW+   + E +
Sbjct: 231 HHYTIGQRKGIGVAAAEPLYVVKLDPVMNQVIVGNRADAGKPECSVSRMNWV--SIAEPS 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                +  V+ RSS  PV V +   D+ V + F++ + G+  GQA V Y  +     +LG
Sbjct: 289 SPIHTEVQVRYRSSAVPVDV-IPLGDNRVKLVFDEPQFGITPGQAAVLYDGEV----LLG 343

Query: 380 GGII 383
           GGII
Sbjct: 344 GGII 347


>gi|323702190|ref|ZP_08113857.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532877|gb|EGB22749.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Desulfotomaculum nigrificans DSM 574]
          Length = 366

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 211/369 (57%), Gaps = 16/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG---SCCAGQDVYDARR 78
           +V+ AMSGGVDSSV AALL++ GY+V+GVT+Q+++    +   G    CC+   V DARR
Sbjct: 6   KVIAAMSGGVDSSVTAALLQQQGYEVVGVTMQIWDP-DVTVVDGDYVGCCSLSAVDDARR 64

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + + +YVF++ E F   VI  F   Y  G TP PC+ CNR +KF  LL   RQ+G 
Sbjct: 65  VANILGIPYYVFNFRELFTEKVIQYFVDEYLRGRTPNPCIACNRFIKFEALLQKARQMGF 124

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY  +RL   ++ KR  +  +  D  +DQ+Y L+  TQ Q+     PL D  KE
Sbjct: 125 DYIATGHY--ARLGYSEEYKRYTVR-KARDERKDQTYVLYGFTQDQIAHTLMPLADYTKE 181

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR++AR  GL  A K +SQ+ICFV    Y + ++  +      G  + L G ++G+H G
Sbjct: 182 QVREMARRWGLPTATKPESQEICFVHDNNYRNFLEERSVEGIKPGPFLDLKGNVIGQHRG 241

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I  YTIGQRRGLG+A GE ++VV +D   + VIVGP E++    +   + N+    +  D
Sbjct: 242 IPFYTIGQRRGLGIATGERVYVVDIDPERNAVIVGPEEAIWGTELIASDNNF----ILYD 297

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   ++R +  P P  ++  ++G V V F+  +  +  GQA V+Y  D     +
Sbjct: 298 KITGPTEVEAQVRYNSKPSPALLEPLENGLVKVTFKYPQRSITPGQAVVYYQGDY----L 353

Query: 378 LGGGIISGS 386
           +GGG I  S
Sbjct: 354 VGGGTIEKS 362


>gi|125973240|ref|YP_001037150.1| tRNA-specific 2-thiouridylase MnmA [Clostridium thermocellum ATCC
           27405]
 gi|256003718|ref|ZP_05428706.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum DSM 2360]
 gi|281417440|ref|ZP_06248460.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum JW20]
 gi|205813738|sp|A3DDC8|MNMA_CLOTH RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|125713465|gb|ABN51957.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum ATCC 27405]
 gi|255992279|gb|EEU02373.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum DSM 2360]
 gi|281408842|gb|EFB39100.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum JW20]
 gi|316940529|gb|ADU74563.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium thermocellum DSM 1313]
          Length = 359

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 137/365 (37%), Positives = 210/365 (57%), Gaps = 14/365 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +V+V MSGGVDSSV AA+L   GY+VIG T+Q++       +  +G CC+   V DAR V
Sbjct: 5   KVMVGMSGGVDSSVAAAILLEQGYEVIGATMQIWPDTDEETKLVEGGCCSLSAVDDARSV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV ++++ F  +VI  F   Y  G TP PC+ CNR VKF  +L+    +G D
Sbjct: 65  ANKLGIPYYVLNFKDIFEKSVINYFKDEYLKGRTPNPCIACNRFVKFESMLNKALSMGID 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY    +   DD K+R ++ + +  ++DQ+Y L+  TQ+QL  +  P+G+  KE 
Sbjct: 125 YIATGHY---AIITYDDNKKRYLLKKSVTQQKDQTYALYNVTQEQLKHILMPIGNFTKEQ 181

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR  A+E+GL +A K DSQ+ICFV    Y   ++         G  V   G ILG+H GI
Sbjct: 182 VRAKAKELGLYVASKPDSQEICFVNDNDYGKFIEENTDKEIKPGYFVDTKGNILGKHRGI 241

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YT+GQR+GLG+A+G+P++VV +D  ++ V++G    +    +   ++N++     E+ 
Sbjct: 242 IHYTVGQRKGLGIALGKPMYVVRIDAENNTVVLGDENEVYSKELTAYDLNFISIDKLEEP 301

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    +   KIR S       +   +DG V V F+  +  V  GQ+ VFY  D     V+
Sbjct: 302 M----RVKAKIRYSAKEADAVIYPLEDGKVRVVFDTPQRAVTPGQSVVFYDGDI----VV 353

Query: 379 GGGII 383
           GGGII
Sbjct: 354 GGGII 358


>gi|291526521|emb|CBK92108.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium rectale DSM 17629]
          Length = 362

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 204/365 (55%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++      K+  +G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDVFKQSQEGGCCGLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV +++  F+  VI  F S Y    TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 64  AAVLDIPYYVMNFKADFKKYVIDYFVSEYERAYTPNPCIACNRYVKWESLLHRSLEIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +      R  +   +  E+DQ+Y L+  TQ+QL     P+G+ +K  
Sbjct: 124 YIATGHYAR----IAQLPNGRYTIANSVTAEKDQTYALYNLTQEQLRRTLMPVGEYEKPQ 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A E GL +A KSDSQDICFV    Y   ++         G+ V  +G ILGRH G+
Sbjct: 180 IRRIAEEAGLPVAHKSDSQDICFVPDHDYASFIENETGKTYEPGNFVDESGNILGRHKGL 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQR+GLG+    PLFV  L   ++ V++   ESL     Y+ +IN++     ++ 
Sbjct: 240 IHYTIGQRKGLGITAATPLFVKELRPATNEVVISTNESLFSDTCYISDINYMA----QEH 295

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +  G +   K+R S       +   ++G +   F++ +  +  GQA VFY     +  VL
Sbjct: 296 ITPGTRSIGKVRYSHRGADCTLTPMENGMIKCVFDEPQRAMTPGQAAVFY----QDGHVL 351

Query: 379 GGGII 383
            GG I
Sbjct: 352 CGGTI 356


>gi|22299799|ref|NP_683046.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermosynechococcus elongatus BP-1]
 gi|30173409|sp|Q8CWM0|MNMA_THEEB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|22295983|dbj|BAC09808.1| tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Thermosynechococcus elongatus BP-1]
          Length = 369

 Score =  251 bits (641), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 208/365 (56%), Gaps = 24/365 (6%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VVV +SGGVDSSV  A LK  G+ V+G+TL L       K KG CC+ + + DA R+C+ 
Sbjct: 7   VVVGLSGGVDSSVAIASLKAQGHPVVGLTLWLM------KGKGQCCS-EGLVDAARLCEQ 59

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR-QLGADVL 141
           + V H++ D  E F   ++    S YA G TPLPC  CNR VKF  +L+ +R QLG D +
Sbjct: 60  LGVPHHIVDSREIFEKYIVNYLISGYANGVTPLPCSQCNRLVKFGPMLAYSREQLGIDYI 119

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY + +     D   R  + R +D  +DQSYFL+   Q+ L  + FPLG   K   R
Sbjct: 120 ATGHYAQVKYNPTSD---RYELWRAVDRHKDQSYFLYDLPQEILAHVLFPLGQQTKAETR 176

Query: 202 DLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
            LA + GL  A K +SQD+C ++  G     + +       +G+IV + G++LG H GI 
Sbjct: 177 ALAAQYGLPTASKPESQDLCLIEAHGSMRQFLDQYLP--RQQGEIVDVYGRVLGYHQGIH 234

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQR+GLG+A  EPL+VV LD+  +RVIVG R +       +  +NW+     ++ +
Sbjct: 235 HYTIGQRKGLGIAAPEPLYVVALDREHNRVIVGDRATAGRRECTVARVNWVSIPPPKEPM 294

Query: 321 VDGFKCFVKIRSSQDPVPVFV--QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
                  V+IR    PVPV +    N + V ++F + + GV  GQA V+Y  D    R+L
Sbjct: 295 T----ATVQIRYRTPPVPVTIIPDANAEQVQLEFAEPQFGVTPGQAAVWYAGD----RLL 346

Query: 379 GGGII 383
           GGGII
Sbjct: 347 GGGII 351


>gi|326390968|ref|ZP_08212518.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|325993010|gb|EGD51452.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 376

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 144/380 (37%), Positives = 220/380 (57%), Gaps = 17/380 (4%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKG 65
           RL +  + KN    RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +  +A + +G
Sbjct: 7   RLKNFFMKKNN---RVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEEAVRVEG 63

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
            CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +K
Sbjct: 64  GCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIACNKYIK 123

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F +LL     + A  +ATGHY        D+ +RR ++ + +D  +DQ+Y L+  TQ QL
Sbjct: 124 FEELLKRAWMIDAYYVATGHYAIKEY---DEERRRYLLKKSVDTSKDQTYVLYNLTQTQL 180

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+ 
Sbjct: 181 EHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEF 240

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
               G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +  
Sbjct: 241 RDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVFGDEL-- 298

Query: 306 REINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQA 364
             I++  + +  D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+
Sbjct: 299 --ISYNNNFISIDKLEGEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRAITPGQS 356

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D     V+GGG I 
Sbjct: 357 VVFYDGDI----VVGGGTIE 372


>gi|307265916|ref|ZP_07547465.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|306919085|gb|EFN49310.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter wiegelii Rt8.B1]
          Length = 376

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 144/386 (37%), Positives = 221/386 (57%), Gaps = 17/386 (4%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--K 59
           ++    RL +L + KN    RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +  +
Sbjct: 1   MIESTRRLENLSMQKNN---RVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDKDEE 57

Query: 60  ASKRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVD 119
           A + +G CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ 
Sbjct: 58  AVRVEGGCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIA 117

Query: 120 CNRTVKFSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFA 179
           CN+ +KF +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+ 
Sbjct: 118 CNKYIKFEELLKRAWMIDAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYN 174

Query: 180 TTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI 239
            TQ QL  + FPLG  KK+ VR LA+ +GL +A K DSQ+ICFV    Y   ++      
Sbjct: 175 LTQTQLEHILFPLGKYKKDEVRKLAQNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEE 234

Query: 240 ALEGDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLE 299
              G+     G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + + 
Sbjct: 235 IKPGEFRDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVF 294

Query: 300 VHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVG 358
              +    I++  + +  D +    +   KIR +       ++  +DG V+V F+  +  
Sbjct: 295 GDEL----ISYNNNFISIDKLEGEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRA 350

Query: 359 VASGQACVFYTSDSNEARVLGGGIIS 384
           +  GQ+ VFY  D     V+GGG I 
Sbjct: 351 ITPGQSVVFYDGDI----VVGGGTIE 372


>gi|37520120|ref|NP_923497.1| tRNA-specific 2-thiouridylase MnmA [Gloeobacter violaceus PCC 7421]
 gi|73920124|sp|Q7MBC9|MNMA_GLOVI RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|35211112|dbj|BAC88492.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Gloeobacter violaceus PCC 7421]
          Length = 357

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/373 (39%), Positives = 216/373 (57%), Gaps = 26/373 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++V A+SGGVDSSV AAL+++ GY V GVTL L       + KGSCC+   + DA RVC+
Sbjct: 6   KIVAALSGGVDSSVAAALVRKQGYRVCGVTLWLM------RGKGSCCS-DGMKDAARVCE 58

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR-QLGADV 140
            +++ H++ D  ++F   ++      Y  G TPLPC  CN+ +KF  LL   R +LG   
Sbjct: 59  QLDIPHHIVDIRQQFEETIVDFLVEGYREGITPLPCSRCNKELKFGLLLEYARRKLGIGT 118

Query: 141 LATGHYIRSRLYVGDDGKR-RRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +ATGHY R+    G DG+  R  + R +D  +DQSYFL+  +Q+QL    FPLG+M K+ 
Sbjct: 119 VATGHYART----GFDGQTGRHWLARAVDRTKDQSYFLYDLSQEQLASAVFPLGEMTKDQ 174

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHNG 258
            R LA E+GL +A K +S D+C V+      +   +NA I    G+IV  +G+ILG H+G
Sbjct: 175 TRTLAAELGLSVAHKPESMDLCLVEAAG--SMRNFLNAHIDTRRGEIVDTSGKILGEHDG 232

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
             +YT+GQRRGLGVA   PL+VV +D  ++RV+VG RE        + ++NW+     E 
Sbjct: 233 AHHYTVGQRRGLGVAAPYPLYVVAVDAANNRVVVGAREEATACECTVGQVNWVSMAEPEA 292

Query: 319 AVVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKS-EVGVASGQACVFYTSDSNEAR 376
            +    +  V++R    PV    +     G  + F+ + +  ++ GQA V+Y  +    R
Sbjct: 293 PI----QAEVQVRYRSQPVQATIIPLPARGARIAFDDAPQFAISPGQAAVWYAGE----R 344

Query: 377 VLGGGIISGSKRS 389
           VLGGGII  S RS
Sbjct: 345 VLGGGIILASGRS 357


>gi|18310765|ref|NP_562699.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens str. 13]
 gi|18145446|dbj|BAB81489.1| probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium perfringens str. 13]
          Length = 350

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 206/360 (57%), Gaps = 15/360 (4%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA-SKRKGSCCAGQDVYDARRVCDTINV 85
           MSGGVDSSV A LLK  GYDVIGVT+Q++   K   +R+G CC+   V DARRV   +++
Sbjct: 1   MSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEDKEYEEREGGCCSLSAVDDARRVAQKLDI 60

Query: 86  SHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGH 145
             YV ++ + F+  VI  F   Y  G TP PC+ CN+ +KF +LL   + +GAD +ATGH
Sbjct: 61  PFYVLNFRDSFKRNVIDYFVDEYIQGRTPNPCIACNKYLKFDELLQKAKGIGADYVATGH 120

Query: 146 YIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLAR 205
           Y +     G     R  + R  D  +DQ+Y L+  TQ+QL     P G+  K+ +R++A+
Sbjct: 121 YAKIEERDG-----RFQLIRSKDDRKDQTYALYNLTQEQLEHTLMPCGEFTKDKIREIAK 175

Query: 206 EMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIG 265
           E+GLD+ +K DS++ICF+    +   +          G+ V   G +LG+H GI+ YTIG
Sbjct: 176 EIGLDVHNKKDSEEICFIPDNNHGRYICEAAPNKVRPGNFVDKYGNVLGKHKGIVYYTIG 235

Query: 266 QRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFK 325
           QR+GLG+A+G P+FV  ++  ++ V+VGP E +    +  ++IN++     E  +    +
Sbjct: 236 QRKGLGLALGRPVFVTDINPVTNTVVVGPEEDIFKTDLVCKDINFISIDKLEGPM----E 291

Query: 326 CFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
              KIR S  P    +   ++G V V FE  +  +  GQ+ VFY  D     V+GGGII 
Sbjct: 292 VEAKIRYSARPAKATISPMENGRVKVSFEDKQRAITKGQSVVFYKDD----LVVGGGIIE 347


>gi|170755439|ref|YP_001780808.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum B1 str.
           Okra]
 gi|205810574|sp|B1IIY2|MNMA2_CLOBK RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|169120651|gb|ACA44487.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum B1 str. Okra]
          Length = 356

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 210/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D  +DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYA-----IIEKHNDRYIIKKSEDDRKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++IN++      D +
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDINYIP----FDTL 294

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            D  +   KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     ++G
Sbjct: 295 KDPMEVEAKIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LLIG 350

Query: 380 GGIIS 384
           GGII 
Sbjct: 351 GGIIE 355


>gi|160892535|ref|ZP_02073325.1| hypothetical protein CLOL250_00064 [Clostridium sp. L2-50]
 gi|156865576|gb|EDO59007.1| hypothetical protein CLOL250_00064 [Clostridium sp. L2-50]
          Length = 362

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 204/365 (55%), Gaps = 17/365 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK--RKGSCCAGQDVYDARRVC 80
           V V MSGGVDSSV A LLK  GY+VIGVT+Q++    A +    G CC    V DARRV 
Sbjct: 6   VCVGMSGGVDSSVAAYLLKEQGYNVIGVTMQIWQDEDADQISEHGGCCGLSAVDDARRVA 65

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YV +++E FR  VI  F   Y  G TP PC+ CNR VK+  LL  +  +G D 
Sbjct: 66  AQLEIPYYVMNFKEDFRKYVIDYFVDEYRNGRTPNPCIACNRYVKWESLLRRSLSIGGDY 125

Query: 141 LATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +ATGHY R  +L  G     R  +     +E+DQ+Y L+  TQ QL     P+G+  K  
Sbjct: 126 IATGHYARVEQLSSG-----RYTLRVAKGIEKDQTYALYNLTQDQLSKTLMPVGEYNKTQ 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A ++G+ +A+K DSQDICFV  G Y   ++R     A+ G+ V +NG++LG H GI
Sbjct: 181 IRQIAADIGIQVANKPDSQDICFVPDGDYAGYLEREEGLKAVPGNFVDMNGKVLGTHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQR+GLG+AMG P+FVV +   ++ V++G         +   + N++     E  
Sbjct: 241 IHYTIGQRKGLGLAMGHPVFVVDIIPETNEVVIGENADTFSKELIADKTNFMSVERPE-- 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             DG +   KIR +    P  +   D D V V F++       GQA VFY  D     ++
Sbjct: 299 --DGMQVIGKIRYAHKGAPCRIYMLDADRVRVVFDEPVRAATKGQAVVFYEDD----HIV 352

Query: 379 GGGII 383
           GGG I
Sbjct: 353 GGGTI 357


>gi|225174584|ref|ZP_03728582.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dethiobacter alkaliphilus AHT 1]
 gi|225169711|gb|EEG78507.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dethiobacter alkaliphilus AHT 1]
          Length = 366

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/375 (39%), Positives = 212/375 (56%), Gaps = 16/375 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS---RKASKRKG-SCCAGQDVY 74
           K+ RV+VAMSGGVDSS+ AALLK  GY+ IGVT++L+ S      +K  G  CC+   V 
Sbjct: 3   KNNRVLVAMSGGVDSSLCAALLKEQGYEAIGVTMRLWVSPDFEDEAKHSGRGCCSLSAVD 62

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DARRV D + +  YV +++E FR  V+  F   Y  G TP PC+ CNR +KF  LL    
Sbjct: 63  DARRVADKMEMPFYVLNFKESFRTQVVDYFVDEYRRGRTPNPCIACNRYLKFDLLLKKAF 122

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
           +L A  +ATGHY R      D+   R  + +  D  +DQ+Y L+  TQ+QL    FPLG 
Sbjct: 123 ELEAWYVATGHYARVEY---DESLERFRLKKAADARKDQTYTLYNLTQKQLAHTLFPLGG 179

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
             K  VR++A + GL +ADK DSQ+ICF+    Y   ++      +  G I+ L+G  LG
Sbjct: 180 FLKSEVREMAAKYGLAVADKPDSQEICFIPDDDYKRFLREETDVESKPGPILDLDGNRLG 239

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            H G++NYT+GQR+GLG+A+G P+FVV LD  ++ +IVG    +    +   ++N+    
Sbjct: 240 THQGLVNYTVGQRKGLGIAVGRPIFVVELDVENNTLIVGDDRDVFFRALVADDLNF---- 295

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSN 373
           +  D + +  +   KIR     VP  +     G   ++F++ E  V  GQ+ VFY  D  
Sbjct: 296 ILIDELKEPRRVMAKIRYHAKEVPALLSPLPHGQAKLEFDEPERAVTPGQSVVFYEGDD- 354

Query: 374 EARVLGGGIISGSKR 388
              V+GGGII  + R
Sbjct: 355 ---VVGGGIIQQAIR 366


>gi|283795899|ref|ZP_06345052.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium sp. M62/1]
 gi|291076535|gb|EFE13899.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium sp. M62/1]
          Length = 359

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 139/367 (37%), Positives = 205/367 (55%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++   +  A +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKKQGYDVIGVTMQIWQDEEPEAVEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV ++++ FR  V+  F + Y  G TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 65  AEDLAIPYYVMNFKKEFRENVMDYFVAEYLRGRTPNPCIACNRFVKWESLLKRSLEIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  + +     +DQ+Y L+  TQ+QL     P+G+  K+
Sbjct: 125 YIATGHYARIEKLPNG-----RYALKKSATAAKDQTYALYNLTQEQLAHTLMPVGEYTKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R +A+E+ L +A K DSQ+ICF+    Y   ++        EG+ V L G +LGRH G
Sbjct: 180 EIRKMAQELNLRVAHKPDSQEICFIPDNDYAKFIREDIGKELPEGNFVDLQGNVLGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           I +YT+GQR+GL ++MG P+FVV +   ++ V++G    +    +    INW+  DGL  
Sbjct: 240 ITHYTVGQRKGLNLSMGHPVFVVEIRPETNEVVIGENSDVFSRTLRFNRINWMAVDGLHG 299

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +      +   KIR      P  V+    D     F++ +  +  GQA V Y  +     
Sbjct: 300 EE----HRFIAKIRYGHKGAPCTVREIGSDLAECVFDEPQRAITPGQAVVLYDGEY---- 351

Query: 377 VLGGGII 383
           V GGG I
Sbjct: 352 VAGGGTI 358


>gi|220917573|ref|YP_002492877.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219955427|gb|ACL65811.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 351

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 155/364 (42%), Positives = 203/364 (55%), Gaps = 13/364 (3%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSS  AALL   G++VIGVT+++ +    ++ + SCCA  DV DAR   
Sbjct: 1   MRILVAMSGGVDSSTAAALLAGHGHEVIGVTMRVADYSDVARGR-SCCAPDDVEDARAAA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +  YV + E RFR  VI  F   Y  G TP PCV CN  VKF  LL+  R LGA  
Sbjct: 60  RRLGIPFYVANVEARFRERVIDRFVDDYVEGRTPNPCVACNTEVKFDWLLARARALGAK- 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R    V + G RR ++    D  +DQSYFL+   Q  L D+ FP+G + K  V
Sbjct: 119 LATGHYAR----VEERGGRRALLT-AADPAKDQSYFLYGLGQDALRDVLFPVGALAKPVV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R  A   GL +ADK DSQ+ICFV +G   D V          G+IV   G++LGRH+G+ 
Sbjct: 174 RAEAARAGLAVADKPDSQEICFVTRGDAGDFVALRAPARIRAGEIVSTAGEVLGRHDGVH 233

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            +T+GQRRGLG+A   P +VV LD  ++RV+VG  E     R  +RE +W+  G      
Sbjct: 234 RFTVGQRRGLGIAGAVPRYVVRLDAATARVVVGSAEEASRDRFEVREASWV-SGAPPAGP 292

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
           V+  +  V+ R   +   V       G  V   +   GVA GQA VFY  D     V+GG
Sbjct: 293 VE-LRVKVRHRHEGERGTVRAVSGGAGADVRLARPVRGVAPGQAAVFYAGDE----VVGG 347

Query: 381 GIIS 384
           G I+
Sbjct: 348 GRIA 351


>gi|300868100|ref|ZP_07112736.1| tRNA-specific 2-thiouridylase mnmA [Oscillatoria sp. PCC 6506]
 gi|300333898|emb|CBN57914.1| tRNA-specific 2-thiouridylase mnmA [Oscillatoria sp. PCC 6506]
          Length = 352

 Score =  250 bits (639), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 214/366 (58%), Gaps = 25/366 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++VV +SGGVDSS  AA+L   GY+V+G+TL L       K KG CC+ + + DA ++C+
Sbjct: 3   KIVVGLSGGVDSSTAAAILHHQGYEVVGLTLWLM------KGKGQCCS-EGMVDAAQICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H + D  + F+ +++      Y AG TPLPC  CNRTVKF  +L   R+ LG + 
Sbjct: 56  QLGIPHEIVDSRDLFQASIVDYLVEGYGAGITPLPCSQCNRTVKFGPMLRYAREKLGIEK 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCR-PMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +ATGHY +    +  DG   R   R  +D  +DQSYFL+  TQ+ L    FPLGD+ K  
Sbjct: 116 IATGHYAQ----ISYDGSVDRYQLRRAVDSTKDQSYFLYDLTQEMLAGSVFPLGDIAKTE 171

Query: 200 VRDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            R +A E GL  ADK++SQD+C V+  G     + +  A   L+GDIV  +G++LG+H+G
Sbjct: 172 TRRIAAEFGLKTADKAESQDLCLVESNGSMRAFLDKYIA--PLKGDIVDKDGRVLGQHDG 229

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YTIGQR+GLG+A  EPL+V+ LD   +RVIVG R S   +   +  +NW+   + E 
Sbjct: 230 IQHYTIGQRKGLGIAWAEPLYVIGLDVARNRVIVGDRASAAQNECIVNRVNWV--SIAEP 287

Query: 319 AVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
                 +  V+IR    PVPV  +   D  V + F++ + G+  GQ  V+Y  D     +
Sbjct: 288 GAP--IRAEVQIRYRSHPVPVSVIPLPDARVKLIFDEPQFGITPGQGAVWYDGDI----L 341

Query: 378 LGGGII 383
           LGGGII
Sbjct: 342 LGGGII 347


>gi|163846255|ref|YP_001634299.1| tRNA-specific 2-thiouridylase MnmA [Chloroflexus aurantiacus
           J-10-fl]
 gi|222524010|ref|YP_002568480.1| tRNA-specific 2-thiouridylase MnmA [Chloroflexus sp. Y-400-fl]
 gi|205811637|sp|A9WFH2|MNMA_CHLAA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|254811449|sp|B9LK98|MNMA_CHLSY RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|163667544|gb|ABY33910.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Chloroflexus aurantiacus J-10-fl]
 gi|222447889|gb|ACM52155.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Chloroflexus sp. Y-400-fl]
          Length = 359

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 154/363 (42%), Positives = 218/363 (60%), Gaps = 13/363 (3%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V+VAMSGGVDSS+ AALL   G+ V GVT+ L++  +   R+  CCA +    ARRVC  
Sbjct: 4   VLVAMSGGVDSSLAAALLLEAGHQVTGVTMHLWDDDEQGLRESLCCAAEAAASARRVCAL 63

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + +  YVF+Y+  FR  VI  F  +Y  G TP PCV+CNR +KF  LL   R LG D +A
Sbjct: 64  LGIPFYVFNYQREFRRHVIDYFIRAYTHGLTPNPCVECNRMIKFRALLDRARTLGFDAVA 123

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY  +R+  G+DG+ +  + R +DLE+DQSY L    Q +L  L FP+G   K  VR+
Sbjct: 124 TGHY--ARIIQGEDGRYQ--LWRAVDLEKDQSYMLHMLGQAELSRLIFPIGAYTKREVRE 179

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A   GL  AD+ +SQDICFV  G Y ++++  +    + G IV L G+ +GRH G+  Y
Sbjct: 180 MAAARGLPSADREESQDICFVPDGDYRNLLRIESPESLVPGPIVDLEGREIGRHRGLPLY 239

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           T+GQRRGLG+  GEP +VV +D   + +IVGP  +L   R  + +  W+ D        +
Sbjct: 240 TVGQRRGLGLGGGEPRYVVAIDPARNALIVGPAAALNRARFTVIDACWVDDA----PPAE 295

Query: 323 GFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
            F C V++R+  +P+P  V +  DG + V+ E+ +  V+ GQA VFY       +VLGGG
Sbjct: 296 SFTCLVQVRAHAEPLPARVSQQPDGRWLVELERPQRAVSPGQAAVFYRGQ----QVLGGG 351

Query: 382 IIS 384
            I+
Sbjct: 352 WIA 354


>gi|20808819|ref|NP_623990.1| tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase
           [Thermoanaerobacter tengcongensis MB4]
 gi|24638308|sp|Q8R7F0|MNMA2_THETN RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|20517470|gb|AAM25594.1| predicted tRNA(5-methylaminomethyl-2-thiouridylate)
           methyltransferase, contains the PP-loop ATPase domain
           [Thermoanaerobacter tengcongensis MB4]
          Length = 364

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 216/369 (58%), Gaps = 14/369 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDA 76
           K+ RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +  +A + +G CC+   V DA
Sbjct: 3   KNNRVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDKDEEAVRVEGGCCSLAAVNDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     +
Sbjct: 63  RRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIKFEELLKRAWMI 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL  + FPLG  K
Sbjct: 123 DAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKYK 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+     G+ LG H
Sbjct: 180 KDKVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGYH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +    I++  + + 
Sbjct: 240 KGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVYGDEL----ISYNNNFIS 295

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
            D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+ VFY  D    
Sbjct: 296 IDKLEKEMRVKAKIRYTAKEQDAVIRPLEDGRVFVKFDNPQRAITPGQSVVFYDGDI--- 352

Query: 376 RVLGGGIIS 384
            V+GGGII 
Sbjct: 353 -VVGGGIIE 360


>gi|291459813|ref|ZP_06599203.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oribacterium sp. oral taxon 078 str. F0262]
 gi|291417603|gb|EFE91322.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Oribacterium sp. oral taxon 078 str. F0262]
          Length = 363

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 205/366 (56%), Gaps = 14/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK-RKGSCCAGQDVYDARRVC 80
           + +VAMSGGVDSSV AAL+K  GYD IGVT++LY        R GSCC  +D  DAR+  
Sbjct: 4   KALVAMSGGVDSSVAAALMKERGYDCIGVTMKLYEKEGGGTCRVGSCCTAEDAEDARQAA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YVF++   F   VI  FA +Y  G TP PC+DCNR +K   L    R+LG D 
Sbjct: 64  SVLGIPYYVFNFTGDFEREVIRRFAETYLKGGTPNPCIDCNRYMKHRRLYQRARELGFDS 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK-KES 199
           +ATGHY R      D G+ R ++ +  +  +DQSY L+  +Q+QL    FPLGD + KE 
Sbjct: 124 IATGHYARVSF---DAGRGRWLLKKARNAAKDQSYVLYFLSQEQLSHSVFPLGDFETKEE 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR+LA ++    A K DSQDICFV +G Y D ++         G+ V   G+ILGRH GI
Sbjct: 181 VRELAEKLHFLNARKRDSQDICFVTEGDYGDFLESYLGRSFPPGNFVDEEGRILGRHRGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           + YTIGQR+GLG+++  P++V   D   + V +   E L    +   + NW+   L++ +
Sbjct: 241 VRYTIGQRKGLGLSLEAPMYVYEKDLLKNEVYLTRGEKLYQKELIADDFNWI---LYDPS 297

Query: 320 VVDG-FKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + G      K R     VP   +   DG V V F++ E   A GQA V Y  ++    V
Sbjct: 298 EIKGAIPVTAKSRYRAKEVPAEAELLPDGRVRVRFQEPERAPAIGQAIVLYEGEN----V 353

Query: 378 LGGGII 383
           +GGG I
Sbjct: 354 VGGGTI 359


>gi|225388352|ref|ZP_03758076.1| hypothetical protein CLOSTASPAR_02087 [Clostridium asparagiforme
           DSM 15981]
 gi|225045595|gb|EEG55841.1| hypothetical protein CLOSTASPAR_02087 [Clostridium asparagiforme
           DSM 15981]
          Length = 361

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 146/366 (39%), Positives = 209/366 (57%), Gaps = 18/366 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA--SKRKGSCCAGQDVYDARRVC 80
           VVV MSGGVDSSV A LLK+ GY VIGVT+Q++        + +G CC    V DARRV 
Sbjct: 8   VVVGMSGGVDSSVAAYLLKQQGYRVIGVTMQIWQDEDGDVQEEQGGCCGLSAVDDARRVA 67

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + + +YV ++++ FR  V+  FA  Y  G TP PC+ CNR VK+  LL  +  +GAD 
Sbjct: 68  MQLEIPYYVMNFKQEFREHVMDYFAGEYLEGRTPNPCIACNRYVKWESLLRRSIAIGADY 127

Query: 141 LATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +ATGHY R  RL  G     R  + R +   +DQ+Y L+  TQ+QL     P+G   K+ 
Sbjct: 128 IATGHYARIERLENG-----RFALRRSVTEAKDQTYALYNLTQEQLSRTLMPVGSYHKDE 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A E+GL++A K DSQ+ICFV    Y   ++        EG+ V L+G +LGRH GI
Sbjct: 183 IRRMAEEIGLNVAHKPDSQEICFVPDKDYASFIEDYTGKSCPEGNFVDLHGNVLGRHKGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFED 318
            +YT+GQR+GL ++MG P+FVV +  +++ V++G  E +  + +   ++NW+  DGL   
Sbjct: 243 SHYTVGQRKGLNLSMGRPVFVVEIRPDTNEVVIGEGEDVFTNILRCSKLNWMAVDGLHGG 302

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S       ++   +D V   F++    V  GQA VFYT D     V
Sbjct: 303 RL----RVDAKIRYSHRGAACTIREIGEDLVECVFDEPVRAVTPGQAVVFYTGDY----V 354

Query: 378 LGGGII 383
            GGG I
Sbjct: 355 AGGGTI 360


>gi|269926148|ref|YP_003322771.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Thermobaculum terrenum ATCC BAA-798]
 gi|269789808|gb|ACZ41949.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Thermobaculum terrenum ATCC BAA-798]
          Length = 355

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 148/362 (40%), Positives = 204/362 (56%), Gaps = 17/362 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRVC 80
           VVVAMSGGVDSSV AA+L+  GYDVIGV L+LY+    +A      CC    + DA  VC
Sbjct: 4   VVVAMSGGVDSSVAAAMLRDQGYDVIGVNLRLYSKEDSQAYSLNKQCCTLDSMRDAEAVC 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +  Y  + E  F   V+  F S Y  G+TP PC+ CN  +KF  L      LGAD 
Sbjct: 64  RKLGIPFYALNMEREFTRDVVDYFVSEYLQGKTPNPCLACNAHIKFHHLFERAMALGADY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +RL   + G +   +   +D  +DQSY L+  +Q++L     P+G+  K   
Sbjct: 124 IATGHY--ARLRRTESGVK---LLTGVDAAKDQSYTLYMLSQRELERTLLPIGEQTKAET 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R+LAR+ GL  A+K +SQDICF+  G Y   V+R+       G IV  +G+ LG H+G+ 
Sbjct: 179 RELARKYGLVTANKPESQDICFIPSGDYRAFVRRLAPHAESPGPIVDTSGRQLGVHHGVA 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+ +G+P++VV LD   + V+VG +E L    I L ++N++ DG      
Sbjct: 239 FYTIGQRKGLGITVGKPMYVVRLDPEKNMVVVGTKEELSSREIRLCDVNYI-DG---SPR 294

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            + F+C VK+R     +P  V   DD  V V+       VA GQA VFY  +     VLG
Sbjct: 295 TEAFECEVKLRYRGASIPAIVHPEDDRSVRVEL-LGPGNVAPGQAVVFYQGEE----VLG 349

Query: 380 GG 381
           GG
Sbjct: 350 GG 351


>gi|255283411|ref|ZP_05347966.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bryantella formatexigens DSM 14469]
 gi|255266059|gb|EET59264.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Bryantella formatexigens DSM 14469]
          Length = 357

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 205/366 (56%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDV+GVT+Q++   +   +   G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAWLLKEQGYDVVGVTMQIWQDEEEQTQEENGGCCGLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             T+ + +YV +++  F+  V+  FA  Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 64  AQTLEIPYYVMNFKAEFKEKVMDYFAQEYLCGRTPNPCIACNRYVKWEALLQRSLAIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R R   G     R  +CR     +DQ+Y L+  TQ+QL     P+G+  KE 
Sbjct: 124 YIATGHYARIRQLPGG----RYTICRSATAAKDQTYALYNLTQEQLAHTLMPVGEYTKEE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A ++GL +A+K DSQ+ICFV    Y   ++         G+ V  +G +LG+H GI
Sbjct: 180 IRGIAEKIGLRVANKPDSQEICFVPDDDYASFIEEYTGREMPAGNFVTADGTVLGQHRGI 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQRRGL + MG  +FV  +   ++ V++G  E L   R+   ++N++        
Sbjct: 240 THYTIGQRRGLQLPMGHRVFVTDIRPETNEVVIGENEELFKRRLLANKLNFM-----SVP 294

Query: 320 VVDG-FKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +DG  +   KIR +    P  ++    D V   F++ +  +  GQA VFY  ++    V
Sbjct: 295 EIDGDTRVTAKIRYNHRGAPATIRMAGPDMVECIFDEPQRAMTPGQAVVFYDGEN----V 350

Query: 378 LGGGII 383
           LGGG I
Sbjct: 351 LGGGTI 356


>gi|218248292|ref|YP_002373663.1| tRNA-specific 2-thiouridylase MnmA [Cyanothece sp. PCC 8801]
 gi|226704769|sp|B7K1G5|MNMA_CYAP8 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|218168770|gb|ACK67507.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. PCC 8801]
          Length = 349

 Score =  250 bits (638), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 150/366 (40%), Positives = 208/366 (56%), Gaps = 25/366 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA+L   GY+VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSVAAAVLHHQGYEVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H++ D  + F+  ++    S Y AG TPLPC  CNR VKF  +L+  RQ LG D 
Sbjct: 56  QLGIPHHIVDSRDVFQANIVNYLVSGYEAGITPLPCSQCNRAVKFGPMLNYARQELGCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+  +R  + R +D  +DQSYFL+  +Q+ L    FPLGD  KE  
Sbjct: 116 IATGHYARIRY---DEISQRYQLLRAIDRNKDQSYFLYDLSQEMLAGTVFPLGDQTKEDT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVV--KRINAGIALEGDIVHLNGQILGRHNG 258
           R +A E  L  A K +SQD+C ++          + I+     EGDIV L G++LG+H G
Sbjct: 173 RRIAAEFDLKTASKPESQDLCLIEAHGSMKTFLDQYIHQK---EGDIVDLEGKVLGKHQG 229

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YTIGQR+GLGVA  EPL+VV LD   ++VIV  R +       +  +NW+       
Sbjct: 230 IHHYTIGQRKGLGVAAPEPLYVVKLDPIMNQVIVANRANAGRSDCTVTRLNWVSIA---- 285

Query: 319 AVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
           A     +   +IR     VPV  +   D+ V + F++ E G+  GQA VFY  +     +
Sbjct: 286 APSTPIRVETQIRYRSSAVPVDLIPLEDNRVKLVFDEPEFGITPGQAAVFYDGEI----L 341

Query: 378 LGGGII 383
           LGGGII
Sbjct: 342 LGGGII 347


>gi|291527010|emb|CBK92596.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium rectale M104/1]
          Length = 362

 Score =  250 bits (638), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 141/365 (38%), Positives = 203/365 (55%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++      K+  +G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDVFKQSQEGGCCGLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV +++  F+  VI  F S Y    TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 64  AAVLDIPYYVMNFKADFKKYVIDYFVSEYERAYTPNPCIACNRYVKWESLLHRSLEIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +      R  +   +  E+DQ+Y L+  TQ+QL     P+G+ +K  
Sbjct: 124 YIATGHYAR----IAQLPNGRYTIANSVTAEKDQTYALYNLTQEQLRRTLMPVGEYEKPQ 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A E GL +A KSDSQDICFV    Y   ++         G+ V  +G ILGRH G+
Sbjct: 180 IRRIAEEAGLPVAHKSDSQDICFVPDHDYASFIENETGKTYEPGNFVDESGNILGRHKGL 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQR+GLG+    PLFV  L   ++ V++   ESL     Y+ +IN++     +D 
Sbjct: 240 IHYTIGQRKGLGITAATPLFVKELRPATNEVVISTNESLFSDTCYISDINYMA----QDH 295

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    +   K+R S       +   ++G +   F++ +  +  GQA VFY     +  VL
Sbjct: 296 ITPDTRSIGKVRYSHRGADCTLTPMENGMIKCVFDEPQRAMTPGQAAVFY----QDGHVL 351

Query: 379 GGGII 383
            GG I
Sbjct: 352 CGGTI 356


>gi|295091002|emb|CBK77109.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium cf. saccharolyticum K10]
          Length = 359

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 139/367 (37%), Positives = 205/367 (55%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++   +  A +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKKQGYDVIGVTMQIWQDEEPEAVEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV ++++ FR  V+  F + Y  G TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 65  AEDLAIPYYVMNFKKEFRENVMDYFVAEYLRGRTPNPCIACNRFVKWESLLKRSLEIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  + +     +DQ+Y L+  TQ+QL     P+G+  K+
Sbjct: 125 YIATGHYARIEKLPNG-----RYALKKSATAAKDQTYALYNLTQEQLAHTLMPVGEYTKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R +A+E+ L +A K DSQ+ICF+    Y   ++        EG+ V L G +LGRH G
Sbjct: 180 EIRKMAQELNLRVAHKPDSQEICFIPDNDYARFIREDIGKELPEGNFVDLQGNVLGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           I +YT+GQR+GL ++MG P+FVV +   ++ V++G    +    +    INW+  DGL  
Sbjct: 240 ITHYTVGQRKGLNLSMGHPVFVVEIRPETNEVVIGENSDVFSRTLRFNRINWMAVDGLHG 299

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +      +   KIR      P  V+    D     F++ +  +  GQA V Y  +     
Sbjct: 300 EE----HRFIAKIRYGHKGAPCTVREIGSDLAECVFDEPQRAITPGQAVVLYDGEY---- 351

Query: 377 VLGGGII 383
           V GGG I
Sbjct: 352 VAGGGTI 358


>gi|288818711|ref|YP_003433059.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Hydrogenobacter thermophilus TK-6]
 gi|288788111|dbj|BAI69858.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Hydrogenobacter thermophilus TK-6]
 gi|308752298|gb|ADO45781.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Hydrogenobacter thermophilus TK-6]
          Length = 354

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 155/368 (42%), Positives = 209/368 (56%), Gaps = 20/368 (5%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG--SCCAGQDVYDARR 78
           MRV V MSGGVDSSV A LLK  G++VIGVTL+ +   ++        CC+ +DV DA +
Sbjct: 1   MRVAVGMSGGVDSSVSALLLKMAGHEVIGVTLRFHTIPESCSTDDLRVCCSPEDVKDAAK 60

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG- 137
           V + + + H  FD+E  F+  VI  F   YA G+TP PC  CNR VK   L    R++  
Sbjct: 61  VSEKLGIPHITFDWERIFKERVIDYFVQEYAEGKTPNPCAICNRDVKTGFLARYLREVAQ 120

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
            D LATGHY R   Y G     +R++ R  D  +DQSYFL    ++ L  L FPLGD+ K
Sbjct: 121 VDRLATGHYARLVEYKG-----KRLIARAKDKSKDQSYFLALVRKKDLELLEFPLGDLTK 175

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
           E VR +A E  L +A K DSQ++CF+   K  + +K    G A  G I H++G++LG H 
Sbjct: 176 EQVRRIAVEYSLPVAQKRDSQEVCFLMGKKPGEFIKE-RVGEA-SGYIKHVSGRVLGTHT 233

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI N+TIGQRRGLGV+  EPL+VV +D  ++ VIVG  E +    + L++IN+    L  
Sbjct: 234 GIYNFTIGQRRGLGVSYHEPLYVVDIDAQTNTVIVGSEELIYKSSLKLKDINF---HLHI 290

Query: 318 DAVVDGFKCFVKIRSSQDPVPVF-VQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           D    G   +  +R     V V  ++   DG  V+FE    G+  GQ C FY  D     
Sbjct: 291 DKW--GKDVYAVVRYRTQAVKVKDIKETKDGFVVEFETPVRGITPGQVCAFYEGDV---- 344

Query: 377 VLGGGIIS 384
           +LGGGII+
Sbjct: 345 LLGGGIIA 352


>gi|307243659|ref|ZP_07525800.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Peptostreptococcus stomatis DSM 17678]
 gi|306492969|gb|EFM64981.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Peptostreptococcus stomatis DSM 17678]
          Length = 350

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 214/364 (58%), Gaps = 17/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV++ MSGGVDSSV A LL+++GY+V+G T+ L++ +  +K          + DAR VC+
Sbjct: 3   RVLLGMSGGVDSSVAAFLLQKEGYEVVGATMALWDFKDGNK-------DTSIEDARVVCN 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + H+V D+ E F++ V+  F   Y AG+TP PCV CN+T+KF  L    R+LG D +
Sbjct: 56  KLKIDHHVLDFREDFKDLVVDNFIDEYFAGKTPNPCVFCNKTIKFGLLFDKARELGCDYV 115

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY  + +   +   +  I     D  +DQ+Y L+   Q++L    FP+G   K+++R
Sbjct: 116 ATGHY--ALVDFNEKSGKYEIKKASSD-SKDQTYVLYNLNQEKLARTLFPIGKYDKDTIR 172

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           D+A+E+GL++ +K DSQDICF+    Y   +K  +      G+ V  +G++LGRH GII+
Sbjct: 173 DMAKEIGLEVHNKPDSQDICFIPDHDYEAFLKENSKKKVEVGNFVDRSGKVLGRHKGIIS 232

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+  G+P +VV ++     +++G  + L    +  R++N++     +D VV
Sbjct: 233 YTIGQRKGLGITFGKPTYVVAINGQDKSIVLGDNDDLFKTSLTARDVNFV--EWSQDEVV 290

Query: 322 DGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
                + K+R +  P    V       V VDF + +  + SGQ+ VFY+ D    R+LGG
Sbjct: 291 GPIDVYAKVRYAAKPAQAKVTYIGKYRVRVDFVEPQRAITSGQSVVFYSED----RLLGG 346

Query: 381 GIIS 384
           GII 
Sbjct: 347 GIIE 350


>gi|205829096|sp|B1XM11|MNMA_SYNP2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 353

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 148/366 (40%), Positives = 203/366 (55%), Gaps = 25/366 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V V +SGGVDSSV A +L R GY V GVTL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVAVGLSGGVDSSVTAGILHRQGYTVEGVTLWLM------KGKGQCCS-EGMVDAADICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR-QLGADV 140
            + + H++ D  + F+  ++    S Y  G TPLPC  CNR VKF  +L   + +LG D 
Sbjct: 56  QLGIPHHIVDSRDLFQKYIVDYVVSGYEVGVTPLPCSQCNRMVKFGPMLQWAKAELGIDQ 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    +D   R  + R +D  +DQSYFL+  TQ+ L    FPLG+M K   
Sbjct: 116 IATGHYARIRY---NDQTGRYELLRAVDRHKDQSYFLYDLTQEMLAGTLFPLGEMTKGET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVV--KRINAGIALEGDIVHLNGQILGRHNG 258
           R +A EM L  A K +SQD+C ++          K I      EG+IV L+G++LG H G
Sbjct: 173 RQIAAEMQLSTAKKPESQDLCLIEAHGSMKTFLDKYIEQ---REGEIVDLDGKVLGHHTG 229

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YTIGQR+GLG+A  EPL+VV LD   +RV+V  R+        ++ +NWL       
Sbjct: 230 IHHYTIGQRKGLGIAAPEPLYVVKLDNVMNRVVVSTRDRAGQSECTVQRMNWLA----LP 285

Query: 319 AVVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +  V++R     VPV V     D + + FE+ + G+  GQA V Y  D    RV
Sbjct: 286 GITSPIRAEVQVRYRSGAVPVTVIPLEGDRLKLVFEEPQFGITPGQAAVLYDGD----RV 341

Query: 378 LGGGII 383
           LGGGII
Sbjct: 342 LGGGII 347


>gi|291531960|emb|CBK97545.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium siraeum 70/3]
          Length = 358

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 139/363 (38%), Positives = 206/363 (56%), Gaps = 13/363 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + V+AMSGGVDSSV A L+K+ G+D IGVT++L+ N      R+ SCC+  DV D R V 
Sbjct: 4   KAVIAMSGGVDSSVAAYLMKQRGFDCIGVTMKLFANEDIGISREHSCCSLDDVDDVRSVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
            ++++ +YVF++ +RF   VI  F  +Y  G TP PC+DCNR +KF  L    ++L  D 
Sbjct: 64  YSLDMPYYVFNFSDRFETDVIDRFIHAYENGITPNPCIDCNRYLKFDKLYMRAKELDRDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY R    V  DG  R ++ + +D  +DQSY L+  TQ+QL    FPLG M+K   
Sbjct: 124 VVTGHYAR----VEKDGNGRFLLKKALDDTKDQSYVLYCLTQEQLSHTIFPLGKMRKSQA 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A   G   A K+DSQDICFVQ G Y D +++       +GD +  NG ++GRH G+I
Sbjct: 180 REIAESQGFINARKADSQDICFVQNGSYADFIEQYTGKNYPDGDFLDTNGNVIGRHKGVI 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GLG++  EPL+V  ++  S+ V +   + L    +   +IN +        +
Sbjct: 240 RYTVGQRKGLGISAPEPLYVKAVNPVSNTVTLSYNDGLYSSIVKAGDINLIS----VPEI 295

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               +   K+R         V +N + +   F++ +  V  GQA V Y  D+    V+GG
Sbjct: 296 KGEMRVKAKVRYRHTEQWATVTQNGETLTAVFDEPQRAVTCGQALVLYDGDT----VVGG 351

Query: 381 GII 383
           G I
Sbjct: 352 GTI 354


>gi|289578840|ref|YP_003477467.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter italicus Ab9]
 gi|289528553|gb|ADD02905.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter italicus Ab9]
          Length = 364

 Score =  249 bits (637), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 216/369 (58%), Gaps = 14/369 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDA 76
           K+ RVVV MSGGVDSSV A LLK  GY+VIGVT+Q++  +  +A + +G CC+   V DA
Sbjct: 3   KNNRVVVGMSGGVDSSVSAYLLKEQGYEVIGVTMQIWQDKDEEAVRVEGGCCSLSAVNDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     +
Sbjct: 63  RRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIKFEELLKRAWMI 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL  + FPLG  K
Sbjct: 123 EAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKYK 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ VR LA+++GL +A K DSQ+ICFV    Y   ++         G+     G+ LG H
Sbjct: 180 KDEVRKLAKDLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGYH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G  + +    +    I++  + + 
Sbjct: 240 KGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLGYGDEVYGDEL----ISYNNNFIS 295

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
            D +    +   KIR +       ++  +DG V+V F+  +  +  GQ+ VFY  D    
Sbjct: 296 IDKLEGEMRVKAKIRYTAKEQDAVIRPLEDGKVFVKFDSPQRAITPGQSVVFYDGDI--- 352

Query: 376 RVLGGGIIS 384
            V+GGGII 
Sbjct: 353 -VVGGGIIE 360


>gi|148379169|ref|YP_001253710.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 3502]
 gi|153931319|ref|YP_001383546.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A str.
           ATCC 19397]
 gi|153936775|ref|YP_001387095.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A str.
           Hall]
 gi|205810260|sp|A7FT69|MNMA1_CLOB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|205810283|sp|A5I123|MNMA1_CLOBH RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|148288653|emb|CAL82734.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 3502]
 gi|152927363|gb|ABS32863.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 19397]
 gi|152932689|gb|ABS38188.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. Hall]
          Length = 356

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 212/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAIGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYA-----IIEKHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L   ++  ++ N++  D L E  
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTKLIAKDTNYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|75910268|ref|YP_324564.1| tRNA-specific 2-thiouridylase MnmA [Anabaena variabilis ATCC 29413]
 gi|123608374|sp|Q3M5R7|MNMA_ANAVT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|75703993|gb|ABA23669.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anabaena variabilis ATCC 29413]
          Length = 352

 Score =  249 bits (636), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 146/364 (40%), Positives = 210/364 (57%), Gaps = 21/364 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSS  AA+L   GY+VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSTAAAILHNQGYEVIGLTLWLM------KGKGQCCS-EGMIDAAYICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR-QLGADV 140
            + + H V D  + F+  ++    + Y AG TPLPC  CN+TVKF  ++   R QLG D 
Sbjct: 56  QLGIPHEVVDMRDVFQTHIVDYLVTGYGAGITPLPCSQCNKTVKFGPMVQYAREQLGCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R      D+   R  + R +D  +DQSYFL+  +Q  L    FPLG+M+K   
Sbjct: 116 IATGHYARISY---DEASGRYQLLRAVDRNKDQSYFLYDLSQDLLAASLFPLGEMEKADT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQILGRHNGI 259
           R +A E GL  ADK +SQD+C V+          ++  IA + GDIV   G+ILG+H+G+
Sbjct: 173 RRIATEHGLKTADKPESQDLCLVESNGSMRAF--LDKYIAPKKGDIVDTAGKILGQHDGV 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+VV LD  +++V+VG R         +  +NW+   + E +
Sbjct: 231 HHYTIGQRKGLGIAAPEPLYVVELDAVNNKVVVGDRTKATQEECTVSRVNWV--SIPEPS 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                   ++ RS+ +PV V    N   V + F++ +  +  GQA V+Y  D    +VLG
Sbjct: 289 TPIRAAVQIRYRSAPEPVTVIPLENSR-VRLVFDEPQFSITPGQAAVWYDGD----KVLG 343

Query: 380 GGII 383
           GGII
Sbjct: 344 GGII 347


>gi|315652097|ref|ZP_07905095.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium saburreum DSM 3986]
 gi|315485589|gb|EFU75973.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium saburreum DSM 3986]
          Length = 363

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 143/366 (39%), Positives = 205/366 (56%), Gaps = 16/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDV GVT+Q++ S       GS  CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAYLLKEAGYDVTGVTMQIWQSEDEEDMSGSGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              I + +YV ++ + F++ VI  F + Y    TP PC+ CNR VK+  LL  +  LGAD
Sbjct: 65  ARDIGIPYYVMNFRDEFKDKVIDYFVNEYVQARTPNPCIACNRYVKWESLLERSMMLGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  +       +DQ+Y L+  TQ QL     P+GD +K+
Sbjct: 125 YIATGHYARIEKLENG-----RYALRTSKTSAKDQTYALYNLTQDQLSRTLMPVGDYEKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A++  L +A+K DSQ+ICFV    Y   V+        EG+ V  +G+ILG+H G
Sbjct: 180 EIREIAKKFNLRVANKPDSQEICFVSDNDYASFVESEIGKKMPEGNFVTADGEILGKHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I++YTIGQR+GLG+A+G P+FV  +  +++ V++G  E +  + +    +N +    F  
Sbjct: 240 ILHYTIGQRKGLGIALGHPIFVTEIRPDTNEVVIGENEDVFGYSLEANNLNAMAVEKF-- 297

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              DG +   KIR S       ++   +D + +DF+K    +  GQA V Y        V
Sbjct: 298 --FDGMRAVGKIRYSHKGEHCSIKVIGEDRIRIDFDKKVRAITPGQAVVLY---DESGLV 352

Query: 378 LGGGII 383
           LGGG I
Sbjct: 353 LGGGTI 358


>gi|291547860|emb|CBL20968.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcus sp. SR1/5]
          Length = 362

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 135/365 (36%), Positives = 205/365 (56%), Gaps = 13/365 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS-KRKGSCCAGQDVYDARRVC 80
           +V++AMSGGVDSSV A L K  G + IG T++LYN+      R+ +CC+  DV DAR V 
Sbjct: 3   KVIIAMSGGVDSSVAALLTKESGDECIGATMKLYNNEDIGVHREKTCCSLDDVEDARSVA 62

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++ +YVF++   F   V+  F  +Y  G TP PC+DCNR +KF  +    +++G D 
Sbjct: 63  YQMDMPYYVFNFTADFHTEVMDRFVDAYENGCTPNPCIDCNRYLKFDKMFHRMQEIGYDY 122

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY R      D+ + R ++ + +D  +DQSY L+  TQ+QL  ++ PLG ++K+ V
Sbjct: 123 IVTGHYARVEY---DEKRDRYLLKKAVDDTKDQSYVLYMLTQEQLAHVKLPLGGLRKDQV 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + G   A K DSQDICFV  G Y   +++       EGD V   G  +GRH GII
Sbjct: 180 RVIAEKHGFINARKHDSQDICFVPDGDYAKFIEKYTGKKTPEGDFVDKEGNYIGRHKGII 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQRRGLG+     L+V  +   ++ V++G  E L    +    +N +      D++
Sbjct: 240 HYTIGQRRGLGIPAASRLYVCEISPKTNTVVLGDNEDLFSSELEADNVNLIS----VDSL 295

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            +  +   KIR      P    +  DG+ +V F++ +  +  GQA V Y  D     V+G
Sbjct: 296 TEPKRVTAKIRYRHKEQPATAWQTPDGILHVKFDEPQRAITKGQAVVMYDGDE----VVG 351

Query: 380 GGIIS 384
           GG+I+
Sbjct: 352 GGVIN 356


>gi|260588149|ref|ZP_05854062.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Blautia hansenii DSM 20583]
 gi|260541676|gb|EEX22245.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Blautia hansenii DSM 20583]
          Length = 361

 Score =  249 bits (635), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 143/369 (38%), Positives = 210/369 (56%), Gaps = 17/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRV 79
           +VVV +SGGVDSSV A LLK+ GYDVIGVT+Q++     +  +  G CC    V DARRV
Sbjct: 5   KVVVGLSGGVDSSVAAYLLKKQGYDVIGVTMQIWQEEDNEFQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV ++ + F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  AQILDIPYYVMNFRKEFKEKVIDYFNQEYLEGRTPNPCIACNRYVKWESLLKRSLDIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G    R  +  +     +DQ+Y L+  TQ+QL     P+G+  KE
Sbjct: 125 YIATGHYARVEQLPNGRYAIRNSVTAK-----KDQTYALYNLTQEQLSRTLMPVGEYTKE 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R +A+E GL +A K DSQ+ICFV    Y   ++        EG+ V  +G ++G+H G
Sbjct: 180 EIRRIAQEAGLPVAHKKDSQEICFVPDNDYAGFIEESTGKKLEEGNYVLEDGTVIGKHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           II+YTIGQR+GL ++MG P+FV  +  +++ V++G  E L V  +    +N++      D
Sbjct: 240 IIHYTIGQRKGLNLSMGHPVFVTEIRPDTNEVVIGENEDLFVTDLICDRVNFMAI----D 295

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +G +   KIR +       ++   +G V V F +S+  V  GQA VFY  +     V
Sbjct: 296 HLEEGKEFTAKIRYNHPGAVCTLEDLGEGKVKVLFRESQRAVTPGQAVVFYDGEY----V 351

Query: 378 LGGGIISGS 386
            GGGII G 
Sbjct: 352 AGGGIILGK 360


>gi|262066104|ref|ZP_06025716.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium periodonticum ATCC 33693]
 gi|291380199|gb|EFE87717.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium periodonticum ATCC 33693]
          Length = 362

 Score =  249 bits (635), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 145/387 (37%), Positives = 212/387 (54%), Gaps = 38/387 (9%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
           V SE ++   ++ D N K ++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    + 
Sbjct: 7   VASEFSKY--IEFDSNKKGIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS- 63

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
                        DA++VCD + + HYV D  + F+  V+  F + Y  G TP PC+ CN
Sbjct: 64  -------------DAKKVCDDLGIEHYVLDVRDEFKEKVMDYFVNEYMNGRTPNPCMVCN 110

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLF 178
           R +KF  +L      GA  +ATGHY + +   L VGDD              +DQ YFL 
Sbjct: 111 RHIKFGKMLDFILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLS 158

Query: 179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAG 238
              + +L  + FP+GD++K  +R+LA+++G+ +  K DSQ+ICFV  GK  + +     G
Sbjct: 159 QIQKDRLSKIIFPVGDLEKPKLRELAKQIGVRVYSKKDSQEICFVDDGKLKEFLIENTKG 218

Query: 239 IALE-GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRES 297
            A + G+IV  NG ILG+H G   YTIGQR+GLG++  EPL+V+  DK+++ +IVG  E 
Sbjct: 219 KAQKPGNIVDKNGNILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDKDNNNIIVGENED 278

Query: 298 LEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV 357
           L    +    +N       E   +D  +CF K RS        +++N D   V F  ++V
Sbjct: 279 LFKDELTATRLNLFSVPSLES--LDNLECFAKTRSRDILHKCVLKKNGDNFQVKFIDNKV 336

Query: 358 -GVASGQACVFYTSDSNEARVLGGGII 383
             +  GQ  VFY +D N   V+ GG I
Sbjct: 337 RAITPGQGIVFYNNDGN---VIAGGFI 360


>gi|322805504|emb|CBZ03068.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum H04402 065]
          Length = 356

 Score =  248 bits (634), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 211/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYA-----IIEKHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++  D L E  
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|153938615|ref|YP_001390533.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum F str.
           Langeland]
 gi|205810312|sp|A7GCM3|MNMA1_CLOBL RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|152934511|gb|ABS40009.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. Langeland]
 gi|295318614|gb|ADF98991.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. 230613]
          Length = 356

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 211/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYA-----IIEKHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGSILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++  D L E  
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQTPSKAIITPIEDGRVRVNFHEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|237794471|ref|YP_002862023.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Ba4 str. 657]
 gi|229260617|gb|ACQ51650.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Ba4 str. 657]
          Length = 356

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 141/366 (38%), Positives = 211/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY   + +       R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYAIIKKH-----NDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++  D L E  
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   DDG V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQIPSKAIITPIDDGRVRVNFHEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|238922734|ref|YP_002936247.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium rectale ATCC 33656]
 gi|238874406|gb|ACR74113.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium rectale ATCC 33656]
          Length = 362

 Score =  248 bits (634), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 203/365 (55%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++      K+  +G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQDEDVFKQSQEGGCCGLSAVEDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV +++  F+  VI  F S Y    TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 64  AAVLDIPYYVMNFKADFKKYVIDYFVSEYERAYTPNPCIACNRYVKWESLLHRSLEIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +      R  +   +  E+DQ+Y L+  TQ+QL     P+G+ +K  
Sbjct: 124 YIATGHYAR----IAQLPNGRYTIANSVTAEKDQTYALYNLTQEQLRRTLMPVGEYEKPQ 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A E GL +A KSDSQDICFV    Y   ++         G+ V  +G ILGRH G+
Sbjct: 180 IRRIAEEAGLPVAHKSDSQDICFVPDHDYASFIENETGKTYEPGNFVDESGNILGRHKGL 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I+YTIGQR+GLG+    PLFV  L   ++ V++   ESL     Y+ +IN++     ++ 
Sbjct: 240 IHYTIGQRKGLGITAATPLFVKELRPATNEVVISTNESLFSDTCYISDINYMA----QEH 295

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    +   K+R S       +   ++G +   F++ +  +  GQA VFY     +  VL
Sbjct: 296 ITPDTRSIGKVRYSHRGADCTLTPMENGMIKCVFDEPQRAMTPGQAAVFY----QDGHVL 351

Query: 379 GGGII 383
            GG I
Sbjct: 352 CGGTI 356


>gi|218133009|ref|ZP_03461813.1| hypothetical protein BACPEC_00870 [Bacteroides pectinophilus ATCC
           43243]
 gi|217991882|gb|EEC57886.1| hypothetical protein BACPEC_00870 [Bacteroides pectinophilus ATCC
           43243]
          Length = 375

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 141/372 (37%), Positives = 208/372 (55%), Gaps = 20/372 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           RVVV MSGGVDSSV A LLK  GYDVIGVT+Q++    +   +  G CC    V DARRV
Sbjct: 16  RVVVGMSGGVDSSVAACLLKEQGYDVIGVTMQIWQDEDSCSMEENGGCCGWSAVEDARRV 75

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV +++  FR  VI  F + Y  G TP PC+ CNR VK+  LL  + ++GAD
Sbjct: 76  AQQLDIPYYVMNFKNEFRENVIEYFVNEYKNGRTPNPCIACNRYVKWESLLKRSMEIGAD 135

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +      R ++   +   +DQ+Y L+  TQ+QL     P+G+  KE 
Sbjct: 136 YIATGHYAR----IEQLSNGRYVVRNSVTAAKDQTYALYNLTQEQLRHTLMPIGEYDKEH 191

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRIN-----AGIALEGDIVHLNGQILG 254
           +R +A + GL +A+K DSQDICFV  G Y   +   +     +   + G+ V+L G+++G
Sbjct: 192 IRQIAAQRGLMVANKPDSQDICFVPDGDYAGFIMNSDYAQSCSKACVPGNFVNLAGEVIG 251

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
           RH G ++YTIGQR+GLG+AMG P+FVV +   ++ V++G        R+    +N++   
Sbjct: 252 RHKGYLHYTIGQRKGLGLAMGHPVFVVDIRPETNEVVIGDNSDCFSDRLVADRLNFMA-- 309

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
              D + +      +IR S       V+  +DD +   F++ +  V  GQA V Y     
Sbjct: 310 --VDRLTEPKHLMARIRYSHKGGECTVRMIDDDRIECVFDEPQRAVTKGQAVVLY----E 363

Query: 374 EARVLGGGIISG 385
           +  V GGG I G
Sbjct: 364 DGHVFGGGTIIG 375


>gi|168178604|ref|ZP_02613268.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916]
 gi|226948452|ref|YP_002803543.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A2 str.
           Kyoto]
 gi|182670342|gb|EDT82316.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916]
 gi|226842334|gb|ACO85000.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A2 str. Kyoto]
          Length = 356

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 210/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYA-----IIEKHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++  D L E  
Sbjct: 239 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +    DD V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQTPSKAIITPIEDDRVRVNFHEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|167036708|ref|YP_001664286.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|320115132|ref|YP_004185291.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
 gi|166855542|gb|ABY93950.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|319928223|gb|ADV78908.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter brockii subsp. finnii Ako-1]
          Length = 376

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 146/393 (37%), Positives = 217/393 (55%), Gaps = 43/393 (10%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKG 65
           RL +  + KN    RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +  +A + +G
Sbjct: 7   RLENFFMKKNN---RVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEEAVRVEG 63

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
            CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +K
Sbjct: 64  GCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIACNKYIK 123

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL
Sbjct: 124 FEELLKRAWMIDAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQL 180

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+ 
Sbjct: 181 EHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEF 240

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
               G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G            
Sbjct: 241 RDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLG------------ 288

Query: 306 REINWLGDGLFEDAVVDGFKCFV-------------KIRSSQDPVPVFVQRNDDG-VYVD 351
                 GD +F D ++     F+             KIR +       ++  +DG V+V 
Sbjct: 289 -----YGDEVFGDELISYNNNFISIDKLEREMRVKAKIRYNAKEQDAVIRPLEDGKVFVK 343

Query: 352 FEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
           F+  +  +  GQ+ VFY  D     V+GGG I 
Sbjct: 344 FDNPQRAITPGQSVVFYEGDI----VVGGGTIE 372


>gi|167745698|ref|ZP_02417825.1| hypothetical protein ANACAC_00390 [Anaerostipes caccae DSM 14662]
 gi|167655010|gb|EDR99139.1| hypothetical protein ANACAC_00390 [Anaerostipes caccae DSM 14662]
          Length = 356

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 144/366 (39%), Positives = 205/366 (56%), Gaps = 18/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR--KGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GY+VIGVT+Q++   +       G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDEEQELLEENGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV ++++ F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 64  AQALDIPYYVMNFKQDFKEHVIDYFIDEYLDGRTPNPCIACNRYVKWESLLKRSLDIGAD 123

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G     R  + R    E+DQ+Y L+  TQ QL     P+G+  K+
Sbjct: 124 YIATGHYARIEKLSNG-----RYALKRSATPEKDQTYALYNLTQNQLSKTLMPVGEYTKD 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A ++ L +A K DSQDICFV  G Y D ++         G+ V ++G ILG H G
Sbjct: 179 EIREIAEKIHLPVAHKPDSQDICFV-DGSYGDFIEETTGQKIRPGNFVDMDGNILGTHKG 237

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YT+GQRRGLG+++ +P +VV +DK  + V++G  E L    +Y   +N +     E 
Sbjct: 238 IVCYTVGQRRGLGLSLKQPGYVVRIDKERNEVVIGSNEDLMTDTLYGDHVNLMSVSSIE- 296

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              DG +   K+R +    P  V  +  D + V F++ +  V  GQA VFY  D     V
Sbjct: 297 ---DGMRFQAKVRYNHRGAPCTVSMDGKDRIKVLFDEPQRAVTPGQAVVFYDGDY----V 349

Query: 378 LGGGII 383
            GG  I
Sbjct: 350 AGGATI 355


>gi|225376291|ref|ZP_03753512.1| hypothetical protein ROSEINA2194_01929 [Roseburia inulinivorans DSM
           16841]
 gi|225211937|gb|EEG94291.1| hypothetical protein ROSEINA2194_01929 [Roseburia inulinivorans DSM
           16841]
          Length = 358

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/367 (38%), Positives = 206/367 (56%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK--ASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++        ++ G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAYLLKKQGYDVIGVTMQIWQDEDEFTQEKNGGCCGLSAVNDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + + +YV ++++ F+  V+  F + Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 64  ADRLEIPYYVMNFKQEFKKNVMDYFTAEYLKGRTPNPCIACNRYVKWEALLDRSLAIGAD 123

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    V      R  +   +  E+DQ+Y L+  TQ QL     P+GD  K+ 
Sbjct: 124 YIATGHYAR----VEQLPNGRYAIKNSVTAEKDQTYALYNLTQTQLSRTLMPVGDYHKDE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVV-KRINAGIALEGDIVHLNGQILGRHNG 258
           +R +A E+GL +A K DS +ICF+    Y   + K     +   G+ V  +G+ILGRH G
Sbjct: 180 IRQIAEEIGLMVAHKKDSMEICFIPDDDYAGFIDKECGKLVPPPGNFVSTDGKILGRHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YT+GQR+GLG+A+G P+FV  +   ++ V++G  E +    +Y   +N++      D
Sbjct: 240 ITHYTVGQRKGLGIALGYPVFVTEIRPETNEVVLGSNEDVFTTELYADHVNFMS---LPD 296

Query: 319 AVVDG-FKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
             +DG  +   KIR S       V R  +D ++  FE+    V  GQA V Y  D     
Sbjct: 297 --IDGEMELKAKIRYSHSGSMCKVTRTGEDQIHCVFEEPVRAVTPGQAVVLYDGD----Y 350

Query: 377 VLGGGII 383
           + GGG+I
Sbjct: 351 IAGGGVI 357


>gi|160940314|ref|ZP_02087659.1| hypothetical protein CLOBOL_05203 [Clostridium bolteae ATCC
           BAA-613]
 gi|158436894|gb|EDP14661.1| hypothetical protein CLOBOL_05203 [Clostridium bolteae ATCC
           BAA-613]
          Length = 351

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 202/362 (55%), Gaps = 18/362 (4%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRVCDTIN 84
           MSGGVDSSV A LLK  GYDVIGVT+Q++     +  + +G CC    V DARRV   + 
Sbjct: 1   MSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEDTEVQEAEGGCCGLSAVDDARRVAMDLG 60

Query: 85  VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG 144
           + +YV +++E FR  V+  F   Y  G TP PC+ CNR VK+  LL  +  +GAD +ATG
Sbjct: 61  IPYYVMNFKEEFRKNVMDYFVGEYVEGRTPNPCIACNRHVKWESLLRRSMAIGADYIATG 120

Query: 145 HYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDL 203
           HY +  RL  G     R  +   +   +DQ+Y L+  TQ+QL     P+G   KE +RD+
Sbjct: 121 HYAQIDRLPGG-----RYSLKTSVTAAKDQTYALYNLTQEQLSHTLMPVGSYHKEEIRDM 175

Query: 204 AREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYT 263
           A+ +GL +A K DSQ+ICF+    Y   ++         G+ V L+G++LGRH GI +YT
Sbjct: 176 AKRLGLPVAHKPDSQEICFIPDHDYASFIEEYTGRELPPGNFVDLDGRVLGRHRGITHYT 235

Query: 264 IGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDAVVD 322
           +GQR+GL ++MG P+FVV +   ++ V++G  E +  + +   ++NW+  DGL    +  
Sbjct: 236 VGQRKGLNLSMGRPVFVVEIRPETNEVVIGNNEDVFTNVLRCDKLNWMAVDGLHGKPM-- 293

Query: 323 GFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
                 KIR S    P  ++   DD V   F +    V  GQA VFY  D     V GGG
Sbjct: 294 --DVMAKIRYSHRGSPCTIREIGDDMVECCFHEPVRAVTPGQAVVFYDGDY----VAGGG 347

Query: 382 II 383
            I
Sbjct: 348 TI 349


>gi|186685498|ref|YP_001868694.1| tRNA-specific 2-thiouridylase MnmA [Nostoc punctiforme PCC 73102]
 gi|205816898|sp|B2J5L9|MNMA_NOSP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|186467950|gb|ACC83751.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nostoc punctiforme PCC 73102]
          Length = 351

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 211/364 (57%), Gaps = 21/364 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSS  AA+L   GY+VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSTAAAILHHQGYEVIGLTLWLM------KGKGQCCS-EGMIDAADLCE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H + D  + F+  ++    + Y+AG TPLPC  CN+TVKF  ++   R+ LG D 
Sbjct: 56  QLGVPHQIVDIRDLFQTHIVDYLVTGYSAGITPLPCSQCNKTVKFGPMVQYAREELGCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R      D+   R  + R +D  +DQSYFL+  +Q  L    FPLG+++K   
Sbjct: 116 IATGHYARISY---DEATGRYQLLRAIDRNKDQSYFLYDLSQDLLAATIFPLGELEKTDT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           R +A E GL  ADK +SQD+C V+  G     + +  A     GDIV   G+ILG+H+G+
Sbjct: 173 RRIATEYGLKTADKPESQDLCLVESNGSMRAFLDKYLA--PKSGDIVDTTGKILGQHDGV 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+V+ LD  +++V+VG R  +      +  +NW+   + E +
Sbjct: 231 HHYTIGQRKGLGIAAAEPLYVIELDAENNKVVVGDRTKVTQPECTVNRVNWV--SIAEPS 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                +  ++ RS+  PV V    N   V + F++ +  +  GQA V+Y  +    +VLG
Sbjct: 289 TPIHAEVQIRYRSTPTPVTVIPLENSR-VRLVFDEPQFSITPGQAAVWYDGE----KVLG 343

Query: 380 GGII 383
           GGII
Sbjct: 344 GGII 347


>gi|325290391|ref|YP_004266572.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Syntrophobotulus glycolicus DSM 8271]
 gi|324965792|gb|ADY56571.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Syntrophobotulus glycolicus DSM 8271]
          Length = 352

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 205/364 (56%), Gaps = 17/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +V VAMSGGVDSSV A LLKR+GYDV+GVT+Q++   +   ++ +CC+   V DARRV  
Sbjct: 3   KVFVAMSGGVDSSVAALLLKREGYDVVGVTMQIWP--QPEDKEKACCSLDAVNDARRVAW 60

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV ++ + F   VI  F   Y AG TP PC+ CNR +KF   L     +GAD +
Sbjct: 61  KLGIPHYVLNFRDDFEEKVIRYFCREYLAGRTPNPCIACNRYLKFDLFLQKALAMGADYI 120

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           +TGHY R R    ++   R  + + +D  +DQSY L+   Q QL    FPLG  KKE  R
Sbjct: 121 STGHYARIRR---NEQTERYELRKGLDQTKDQSYALYNLQQDQLQHTLFPLGTYKKEETR 177

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            LA+E GL +A K DSQ+ICFV       + + + + +   G  V  +G ++G H GI  
Sbjct: 178 KLAQEGGLPVAFKKDSQEICFVDHSHAQFIEEYLQSPLT-PGKFVDADGSVVGIHQGIYR 236

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL-GDGLFEDAV 320
           YTIGQ +GLG+AMG P++V  ++  S+ V VG  E L    +   ++N++ G+G      
Sbjct: 237 YTIGQHKGLGLAMGYPVYVTKIEPESNTVRVGKMEELFQDALLAEDLNFVSGEG-----P 291

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               K  VKIR +   VP  +    +G + V FE  +  +  GQA VFY  D     VLG
Sbjct: 292 TGPMKVQVKIRYNAQAVPAVIHPRAEGKMKVVFEIPQKSITPGQAVVFYDHDI----VLG 347

Query: 380 GGII 383
           GG I
Sbjct: 348 GGTI 351


>gi|205815324|sp|B0KC14|MNMA1_THEP3 RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
          Length = 364

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 143/382 (37%), Positives = 213/382 (55%), Gaps = 40/382 (10%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDA 76
           K+ RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +  +A + +G CC+   V DA
Sbjct: 3   KNNRVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEEAVRVEGGCCSLSAVNDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     +
Sbjct: 63  RRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIACNKYIKFEELLKRAWMI 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL  + FPLG  K
Sbjct: 123 DAYYVATGHYAIKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKYK 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+     G+ LG H
Sbjct: 180 KDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGYH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G                  GD +F
Sbjct: 240 KGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLG-----------------YGDEVF 282

Query: 317 EDAVVDGFKCFV-------------KIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASG 362
            D ++     F+             KIR +       ++  +DG V+V F+  +  +  G
Sbjct: 283 GDELISYNNNFISIDKLEREMRVKAKIRYNAKEQDAVIRPLEDGKVFVKFDNPQRAITPG 342

Query: 363 QACVFYTSDSNEARVLGGGIIS 384
           Q+ VFY  D     V+GGG I 
Sbjct: 343 QSVVFYEGDI----VVGGGTIE 360


>gi|320160878|ref|YP_004174102.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaerolinea thermophila UNI-1]
 gi|319994731|dbj|BAJ63502.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaerolinea thermophila UNI-1]
          Length = 361

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 143/367 (38%), Positives = 203/367 (55%), Gaps = 14/367 (3%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           +D  VVVAMSGGVDSSV AALL   GY VIG+ L+L+ S +  + +  CC    +  ARR
Sbjct: 4   RDETVVVAMSGGVDSSVAAALLVEQGYRVIGMMLRLW-SEEGKEDQNRCCTPDAMALARR 62

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   + +  Y  D  E+F+  V+  F   YA+G TP PC+ CNR +++  L    + LGA
Sbjct: 63  VAAKLGIPFYAVDVREKFKEVVVSHFLEGYASGITPNPCLKCNRYIRWGVLHEYAQSLGA 122

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
              ATGHY R R     + +    + R +D+E+DQSY L    Q+QL    FP+G+  K 
Sbjct: 123 TWFATGHYARLRRLESGEVQ----LLRGVDVEKDQSYVLSVLPQEQLRHTFFPVGEYHKP 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            VR+LAR  GL +A+++DSQD+CF+  G Y D + R    ++  G IV+  G+ILG H G
Sbjct: 179 EVRELARRFGLPVANRADSQDLCFLAGGDYRDFLSRHAPEVSRPGVIVNRQGEILGEHQG 238

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           +  YTIGQR+GLG+A   PL+V+  D   +R++VG    L    +    +NW+       
Sbjct: 239 LAFYTIGQRKGLGIAFPRPLYVLEKDVVRNRLVVGEEHELGRSTLIAERVNWISG----Q 294

Query: 319 AVVDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
             V   +  VKIR  +++   V +    D V V+F+     +  GQ CVFY  +      
Sbjct: 295 PPVSSIQVEVKIRYKAREAHGVVIPLTPDRVKVEFDHPLRDITPGQQCVFYQGEI----C 350

Query: 378 LGGGIIS 384
           LGGG IS
Sbjct: 351 LGGGTIS 357


>gi|15895501|ref|NP_348850.1| tRNA-specific 2-thiouridylase MnmA [Clostridium acetobutylicum ATCC
           824]
 gi|24638326|sp|Q97GY2|MNMA_CLOAB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|15025232|gb|AAK80190.1|AE007723_8 TRNA 5-methylaminomethyl-2-thiouridylate)-methyltransferase,
           PP-loop ATPase [Clostridium acetobutylicum ATCC 824]
 gi|325509648|gb|ADZ21284.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium acetobutylicum EA 2018]
          Length = 355

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 215/367 (58%), Gaps = 15/367 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARR 78
           + +VV+ MSGGVDSSV A LLK  GYDVIGVT++L  +    ++++G CC+   V DARR
Sbjct: 2   NKKVVIGMSGGVDSSVAAYLLKEQGYDVIGVTMKLTPDDAFYTEQEGGCCSLSAVEDARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   I +  YV ++ + F+  VI  F   Y  G+TP PC+ CN+ +KF  LL     LGA
Sbjct: 62  VAYRIGIPFYVVNFTDIFKEKVIDYFTEEYLNGKTPNPCIACNKYIKFDALLKKAESLGA 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R    V ++G  R ++ +  D ++DQ+Y ++  TQ QL     P GD KK+
Sbjct: 122 DYIATGHYCR---IVEENG--RYVIRKSEDEKKDQTYVMYNMTQDQLKHTLMPCGDYKKD 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++ARE+GL++ DK DS++ICF+    +   +KR        G+ V   G++LG+H G
Sbjct: 177 RIREIAREIGLNVFDKKDSEEICFIPDNDHGGFIKRECPKAVKTGNFVDKEGKVLGKHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           II YTIGQR+GLG+A G+ +FV  +D   ++V++G  E +  + +   + N++  D L E
Sbjct: 237 IIYYTIGQRKGLGIATGKRVFVTNIDAMKNQVVIGEEEEIFENELISFKNNFIPFDKLTE 296

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
              VD    +    S     PV    +D+ V V FEK +  +  GQ+ VFY  D     +
Sbjct: 297 PMEVDAKIRYNAKASKATIYPV----DDENVKVKFEKPQRAITKGQSVVFYDGD----LL 348

Query: 378 LGGGIIS 384
           +GGGII 
Sbjct: 349 VGGGIIK 355


>gi|187780204|ref|ZP_02996677.1| hypothetical protein CLOSPO_03800 [Clostridium sporogenes ATCC
           15579]
 gi|187773829|gb|EDU37631.1| hypothetical protein CLOSPO_03800 [Clostridium sporogenes ATCC
           15579]
          Length = 359

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 211/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 7   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 66

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 67  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 126

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 127 VATGHYA-----IIEKHNDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 181

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 182 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 241

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GLG+A G+P++VV ++   + V++G  E L    +  ++ N++  D L E  
Sbjct: 242 YYTIGQRKGLGIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYIPFDTLKEPM 301

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   +DG V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 302 EVEA-----KIRYSQIPSKAIITTVEDGRVRVNFHEKQRAITKGQSVVFYKDD----LLI 352

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 353 GGGIIE 358


>gi|256752949|ref|ZP_05493777.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|256748170|gb|EEU61246.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter ethanolicus CCSD1]
          Length = 376

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/393 (37%), Positives = 217/393 (55%), Gaps = 43/393 (10%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKG 65
           RL +  + KN    RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +  +A + +G
Sbjct: 7   RLENFFMKKNN---RVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEEAVRVEG 63

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
            CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +K
Sbjct: 64  GCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLKGRTPNPCIACNKYIK 123

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL
Sbjct: 124 FEELLKRAWMIDAYYVATGHYAVKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQL 180

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+ 
Sbjct: 181 EHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEF 240

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
               G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G            
Sbjct: 241 RDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLG------------ 288

Query: 306 REINWLGDGLFEDAVVDGFKCFV-------------KIRSSQDPVPVFVQRNDDG-VYVD 351
                 GD +F D ++     F+             KIR +       ++  +DG V+V 
Sbjct: 289 -----YGDEVFGDELISYNNNFISIDKLEREMRVKAKIRYNAKEQDAVIRPLEDGRVFVK 343

Query: 352 FEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
           F+  +  +  GQ+ VFY  D     V+GGG I 
Sbjct: 344 FDNPQRAITPGQSVVFYDGDI----VVGGGTIE 372


>gi|331002457|ref|ZP_08325975.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae oral taxon 107
           str. F0167]
 gi|330410273|gb|EGG89707.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae oral taxon 107
           str. F0167]
          Length = 363

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 140/365 (38%), Positives = 208/365 (56%), Gaps = 14/365 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDV GVT+Q++ S       GS  CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAYLLKEAGYDVTGVTMQIWQSEDEEDMSGSGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              I + +YV ++ + F++ VI  F + Y    TP PC+ CNR VK+  LL  +  LGAD
Sbjct: 65  ARDIGIPYYVMNFRDEFKDKVIDYFVNEYVQARTPNPCIACNRYVKWESLLERSMMLGAD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +R+   ++G+    M +     +DQ+Y L+  TQ QL     P+GD +K+ 
Sbjct: 125 YIATGHY--ARIEKLENGRFALRMSKTS--AKDQTYALYNLTQDQLSKTLMPVGDYEKDE 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R++A++  L +A+K DSQ+ICFV    Y   V+         G+ V  +G+ILG+H GI
Sbjct: 181 IREIAKKFNLRVANKPDSQEICFVSDNDYASFVESEIGKKMPVGNFVTADGEILGKHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           ++YTIGQR+GLG+A+G P+FV  +  +++ V++G  E +  + +    +N     +  ++
Sbjct: 241 LHYTIGQRKGLGIALGHPIFVTEIRPDTNEVVIGENEDVFGYSLEANNLN----AMAVES 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
             DG +   KIR S       ++   +D + +DF+K    +  GQA V Y        VL
Sbjct: 297 FFDGMRAVGKIRYSHKGEHCTIKVLGEDRIRIDFDKKVRAITPGQAVVLY---DESGLVL 353

Query: 379 GGGII 383
           GGG I
Sbjct: 354 GGGTI 358


>gi|257063219|ref|YP_003142891.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Slackia heliotrinireducens DSM 20476]
 gi|256790872|gb|ACV21542.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Slackia heliotrinireducens DSM 20476]
          Length = 353

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 144/365 (39%), Positives = 204/365 (55%), Gaps = 19/365 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV+V MSGGVDSSV A LL R GY+V+G T+ LY+  +            D+ DAR V +
Sbjct: 4   RVLVGMSGGVDSSVTAYLLLRQGYEVVGATMNLYDPGRLGVPDVRDGESNDLEDARSVAN 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + ++H+V D+   F N V+ PFA +YA G TP PC+ CNR +KF  +L   R+LG D +
Sbjct: 64  RLGIAHHVLDFGCEFENNVVRPFAQAYADGLTPNPCIACNRHLKFGLMLKAARELGCDGI 123

Query: 142 ATGHYIR--SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           ATGHY R   RL    DG  R ++ + +D  +DQ+Y L+  TQ QL     PLG+  K+ 
Sbjct: 124 ATGHYARIAQRL----DG--RFVLMKGLDDAKDQAYVLYHMTQDQLAHTVLPLGEYTKQQ 177

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A E G   A K +SQDICFV  G Y   ++R    +   GD++  NG +LG+H G 
Sbjct: 178 VRAIAAEQGFANARKHESQDICFVPDGDYVGFLERYAGLVPEPGDVLDENGAVLGQHRGA 237

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           I YT+GQR+G+G+A  + L+V   D  ++ + +GP ++L      +   NW+   L ++ 
Sbjct: 238 IRYTLGQRKGIGIASTQALYVTAKDMAANTITMGPADALLADGCTVGNWNWI---LPDEG 294

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V      VK    Q P    V   +DG V  DF++     A GQ+ V Y  D+    VL
Sbjct: 295 PV---HAMVKTHYRQKPHGAMVVPQEDGTVRFDFDEPSRLAAPGQSAVAYIGDT----VL 347

Query: 379 GGGII 383
           GGGI+
Sbjct: 348 GGGIV 352


>gi|134298633|ref|YP_001112129.1| tRNA-specific 2-thiouridylase MnmA [Desulfotomaculum reducens MI-1]
 gi|172044262|sp|A4J2K1|MNMA_DESRM RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|134051333|gb|ABO49304.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Desulfotomaculum reducens MI-1]
          Length = 367

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/366 (38%), Positives = 209/366 (57%), Gaps = 14/366 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA--SKRKGSCCAGQDVYDARRV 79
           RV+VAMSGGVDSSV AALL++ GYD++GVT+Q+++            CC+   V DARRV
Sbjct: 6   RVLVAMSGGVDSSVTAALLQQQGYDIVGVTMQIWDPEVTVVGDDYVGCCSLTAVDDARRV 65

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV ++ E F   VI  F   Y  G TP PC+ CNR +KF  LL   RQ+G D
Sbjct: 66  ANVLGIPYYVLNFRELFTEKVIQYFVDEYFQGRTPNPCIACNRFIKFEALLQRARQMGFD 125

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +RL   ++ +R  +  + +D ++DQSY L+  TQ Q+     PL D  K+ 
Sbjct: 126 YIATGHY--ARLGYSEEFQRYTVK-KALDDKKDQSYVLYGFTQDQIAHTLMPLADYTKDQ 182

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +A+EMGL    K +SQ+ICFV    Y + +   + G    G    L G +LG H GI
Sbjct: 183 VRGIAKEMGLPTYSKPESQEICFVHDNNYRNFLDERSQGGIKPGPFKDLAGNVLGEHKGI 242

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YTIGQRRGLG+A GE  +V+ +D +++ V VG  E++    +   E N++   LFE+ 
Sbjct: 243 PFYTIGQRRGLGLATGERTYVIDIDPDNNVVTVGSEEAIWGTELIASENNFI---LFEN- 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    +   ++R +  P P  ++   +G V V F+  +  +  GQA V+Y  D     ++
Sbjct: 299 LTGPQELEAQVRYNSKPSPAIIEPYGEGLVKVTFKYPQRAITPGQAVVYYQGDY----LV 354

Query: 379 GGGIIS 384
           GGG I 
Sbjct: 355 GGGTIE 360


>gi|108804192|ref|YP_644129.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rubrobacter xylanophilus DSM 9941]
 gi|123177389|sp|Q1AWB1|MNMA_RUBXD RecName: Full=Bifunctional protein nifU/mnmA; Includes: RecName:
           Full=NifU-like protein; Includes: RecName:
           Full=tRNA-specific 2-thiouridylase mnmA
 gi|108765435|gb|ABG04317.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Rubrobacter xylanophilus DSM 9941]
          Length = 488

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/362 (40%), Positives = 202/362 (55%), Gaps = 23/362 (6%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VV AMSGGVDS+V A LLK  GY+V+ VT +L++    S+   SCC+   V  AR     
Sbjct: 146 VVAAMSGGVDSAVTALLLKERGYEVVAVTFRLHDGEPGSR---SCCSPDTVLFARETAHG 202

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + H+  +  E F   V+  F  SYAAG TP PCV CN  VKF     +  +LG   +A
Sbjct: 203 LGIPHFTLNLRELFDRRVMRDFVGSYAAGRTPNPCVACNAHVKFHAAAFLADRLGLRHVA 262

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY R    VG+       + RP D  +DQ+Y L+    + L    FPLGD +K  VR 
Sbjct: 263 TGHYAR----VGEG----PCLERPEDGRKDQTYVLWPVPPRLLGRTIFPLGDYRKSEVRR 314

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A E GL +A   +SQDICF+  G Y   V+R     +  G+IV   G++LGRH G++++
Sbjct: 315 IAEERGLAVARTPESQDICFIPDGDYRSFVRRRVR--SEPGEIVDRQGRVLGRHAGVVDF 372

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           T+GQRRGLG++   PL+V  +   S +V+VG R  LEV R+ +R  NW  D         
Sbjct: 373 TVGQRRGLGISAPTPLYVTEVRPRSRQVVVGSRRELEVRRMLVRGANWFLD--------P 424

Query: 323 GFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGI 382
                V++R + +PVP  ++    G  V   +   GVA GQ+ VFYT D   A+V+GGGI
Sbjct: 425 REAALVQVRYNGEPVPCELEEGAGGWEVALLEPVFGVAPGQSAVFYTRDG--AKVVGGGI 482

Query: 383 IS 384
           I+
Sbjct: 483 IA 484


>gi|226226536|ref|YP_002760642.1| tRNA-specific 2-thiouridylase MnmA [Gemmatimonas aurantiaca T-27]
 gi|226089727|dbj|BAH38172.1| tRNA-specific 2-thiouridylase MnmA [Gemmatimonas aurantiaca T-27]
          Length = 381

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/376 (39%), Positives = 205/376 (54%), Gaps = 19/376 (5%)

Query: 18  PKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDAR 77
           PK  RV+VAMSGGVDSSV AA+L   G DV+GVT++L+    A      CC+     DAR
Sbjct: 6   PKGARVLVAMSGGVDSSVAAAILMEHGCDVVGVTMKLHGD-GADVPDRPCCSLDATSDAR 64

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RVC+ + + HYV +  + F + V+  F   YA G TP+PCV CN   KF DLL     + 
Sbjct: 65  RVCEKLGIPHYVTNLVDHFSHDVLDDFVQEYARGRTPIPCVRCNTFTKFRDLLHKADAID 124

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
           A  LATGHY R     G     + +M R +D  +DQSYFL+   +  L  L  P+G   K
Sbjct: 125 APWLATGHYARIGHRHG-----QAVMVRGLDTSKDQSYFLWGIDRPVLDRLVLPIGAQTK 179

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKR---INAGIALEGDIVHLNGQILG 254
              RD+AR  GL  A+K +SQDICFV  G +  V+      +A     G +   +G+I+G
Sbjct: 180 AETRDIARRFGLRTAEKIESQDICFVPDGDHVRVIAEHLGADAPALQPGPLRLASGEIIG 239

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            H G   +TIGQR+GL     EP+FVV +  +   V+VGPRE+L    +  RE+NWL   
Sbjct: 240 EHQGFARFTIGQRKGLPGGFAEPMFVVEIVPSERAVVVGPREALLGRGVEARELNWLA-- 297

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSN 373
              +A   G +  V++R+   P P  + R D  G+ +  +++   ++ GQ+ V +  D  
Sbjct: 298 ---EAPPVGAQVQVQVRNRARPSPATIVRVDPQGIELALDEAVQAISPGQSLVVFDGDV- 353

Query: 374 EARVLGGGIISGSKRS 389
              VLGGGII    R+
Sbjct: 354 ---VLGGGIIERGMRA 366


>gi|255524816|ref|ZP_05391766.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium carboxidivorans P7]
 gi|296188647|ref|ZP_06857035.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium carboxidivorans P7]
 gi|255511483|gb|EET87773.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium carboxidivorans P7]
 gi|296046911|gb|EFG86357.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium carboxidivorans P7]
          Length = 358

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 138/366 (37%), Positives = 213/366 (58%), Gaps = 15/366 (4%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKR-KGSCCAGQDVYDARR 78
           + +VV+ MSGGVDSSV A LLK+ GYDVIGVT+Q++   +  +  +G CC+   V DARR
Sbjct: 2   NKKVVIGMSGGVDSSVAAYLLKQQGYDVIGVTMQVWQEDEEYEAVEGGCCSLSAVEDARR 61

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +++  YV ++++ F+  VI  F   Y  G TP PCV CN+ +KF  LL    +LGA
Sbjct: 62  VAYKLDIPFYVMNFKDIFKKNVIDYFIDEYMQGRTPNPCVACNKFIKFDALLKKAMELGA 121

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY      V +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KKE
Sbjct: 122 DYVATGHYA-----VVEKHDNRYILRKSEDDKKDQTYALYNLTQFQLEHTLMPCGVYKKE 176

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL + +K DS++ICF+    +   +K+        G+ V   G +LGRH G
Sbjct: 177 RIREIAKEIGLLVHNKKDSEEICFIPDNDHGGYIKKQVPSKVKPGNFVDKEGNVLGRHKG 236

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I+ YTIGQR+GLG+A G P++V  ++   + V++G    +    +  ++IN++      D
Sbjct: 237 IVYYTIGQRKGLGIAFGVPMYVTDINPLRNEVVLGSENDIFKTELIAKDINFIP----FD 292

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
           ++    +   K+R S  P   ++   D+G V V+FE  +  +  GQ+ VFY +D     +
Sbjct: 293 SLQGTMEIQAKVRYSAKPSRAWITALDNGRVKVEFENKQRAITKGQSVVFYNND----LL 348

Query: 378 LGGGII 383
           LGGG+I
Sbjct: 349 LGGGVI 354


>gi|87306814|ref|ZP_01088960.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Blastopirellula marina DSM 3645]
 gi|87290187|gb|EAQ82075.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Blastopirellula marina DSM 3645]
          Length = 363

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/378 (38%), Positives = 205/378 (54%), Gaps = 35/378 (9%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGV-------------------TLQLYNSRKASKRKGSC 67
           MSGGVDSSV A LL  +G++VIGV                    L + N R   K+   C
Sbjct: 1   MSGGVDSSVAAHLLLEEGHEVIGVFMRHGEQSPVASCQIDGQSALPILNDRPDHKQ--GC 58

Query: 68  CAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFS 127
           C+  D  DARRV D + +  Y  + +  F   +I  F   Y AG TP PCV CN  +KF 
Sbjct: 59  CSASDAADARRVADNLQIPFYALNLQREF-GQIIDYFVDEYVAGRTPNPCVMCNNWIKFG 117

Query: 128 DLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCD 187
            L      +GA+ +ATGHY R    + D       + R +D  +DQ+Y LF   ++ L  
Sbjct: 118 KLFDYADSVGAEYVATGHYAR---LITDQTDALPRLVRGVDSGKDQTYVLFGIGREYLRR 174

Query: 188 LRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVH 247
           +  P+G  +K  +R+LA ++G+ +ADK DSQ+ICFV  GK+ + +K   A +   G+IV 
Sbjct: 175 MLLPVGQFEKSRIRELAGQIGMRVADKKDSQEICFVTSGKHDEFIKSRRADLQTAGEIVT 234

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
             G+++G H+GI  YTIGQR+GLGVA+GEP FVV +D  +++V++G +E L    +  R+
Sbjct: 235 TAGEVVGTHDGIEKYTIGQRKGLGVALGEPRFVVRIDAETNQVVIGEKEELGRTELTARD 294

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACV 366
            NWL      D      +C  +IR + D  P  V+   DG + V F++   GVA GQA V
Sbjct: 295 CNWL-----VDLPAGPLRCRAQIRYNSDDAPATVEHLPDGRIAVTFDEPRRGVAPGQAVV 349

Query: 367 FYTSDSNEARVLGGGIIS 384
            Y  D    +VLGGG I 
Sbjct: 350 CYDGD----QVLGGGWIE 363


>gi|167039428|ref|YP_001662413.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X514]
 gi|300915481|ref|ZP_07132794.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X561]
 gi|307725247|ref|YP_003904998.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X513]
 gi|166853668|gb|ABY92077.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X514]
 gi|300888541|gb|EFK83690.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X561]
 gi|307582308|gb|ADN55707.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Thermoanaerobacter sp. X513]
          Length = 376

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 146/393 (37%), Positives = 217/393 (55%), Gaps = 43/393 (10%)

Query: 8   RLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKG 65
           RL +  + KN    RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +  +A + +G
Sbjct: 7   RLENFFMKKNN---RVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEEAVRVEG 63

Query: 66  SCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVK 125
            CC+   V DARRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +K
Sbjct: 64  GCCSLSAVNDARRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIK 123

Query: 126 FSDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           F +LL     + A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL
Sbjct: 124 FEELLKRAWMIDAYYVATGHYAVKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQL 180

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDI 245
             + FPLG  KK+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+ 
Sbjct: 181 EHILFPLGKYKKDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEF 240

Query: 246 VHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYL 305
               G+ LG H GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G            
Sbjct: 241 RDTRGRFLGYHKGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLG------------ 288

Query: 306 REINWLGDGLFEDAVVDGFKCFV-------------KIRSSQDPVPVFVQRNDDG-VYVD 351
                 GD +F D ++     F+             KIR +       ++  +DG V+V 
Sbjct: 289 -----YGDEVFGDELISYNNNFISIDKLEREMRVKAKIRYNAKEQDAVIRPLEDGKVFVK 343

Query: 352 FEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
           F+  +  +  GQ+ VFY  D     V+GGG I 
Sbjct: 344 FDNPQRAITPGQSVVFYDGDI----VVGGGTIE 372


>gi|331082285|ref|ZP_08331411.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|330400771|gb|EGG80372.1| tRNA-specific 2-thiouridylase mnmA [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 361

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 142/369 (38%), Positives = 209/369 (56%), Gaps = 17/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRV 79
           +VVV +SGGVDSSV A LLK+ GYDVIGVT+Q++     +  +  G CC    V DARRV
Sbjct: 5   KVVVGLSGGVDSSVAAYLLKKQGYDVIGVTMQIWQEEDNEFQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +++ +YV ++ + F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  AQILDIPYYVMNFRKEFKEKVIDYFNQEYLEGRTPNPCIACNRYVKWESLLKRSLDIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R  +L  G    R  +  +     +DQ+Y L+  TQ+QL     P+G+  KE
Sbjct: 125 YIATGHYARVEQLPNGRYAIRNSVTAK-----KDQTYALYNLTQEQLSRTLMPVGEYTKE 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R +A+E GL +A K DSQ+ICFV    Y   ++        EG+ V  +G ++G+H G
Sbjct: 180 EIRRIAQEAGLPVAHKKDSQEICFVPDNDYAGFIEESTGKKLEEGNYVLEDGTVIGKHKG 239

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           II+YTIGQR+GL ++MG P+FV  +  +++ V++G  E L V  +    +N++      D
Sbjct: 240 IIHYTIGQRKGLNLSMGHPVFVTEIRPDTNEVVIGENEDLFVTDLICDRVNFMAI----D 295

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            + +G +   KIR +       ++   +G V V F + +  V  GQA VFY  +     V
Sbjct: 296 HLEEGKEFTAKIRYNHPGAVCTLEDLGEGKVKVLFREPQRAVTPGQAVVFYDGEY----V 351

Query: 378 LGGGIISGS 386
            GGGII G 
Sbjct: 352 AGGGIILGK 360


>gi|322420793|ref|YP_004200016.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M18]
 gi|320127180|gb|ADW14740.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Geobacter sp. M18]
          Length = 357

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 156/375 (41%), Positives = 212/375 (56%), Gaps = 27/375 (7%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARR 78
           K  ++ VAMSGGVDSS VAALLK  G +VIG+ ++L+      +R+G     Q   DAR 
Sbjct: 6   KGKKIAVAMSGGVDSSTVAALLKEQGAEVIGINMKLF------RREGE--DPQAKGDARI 57

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V + + +  +    EE F   ++  F S Y  GETP PCV CNR VKF  LL    +LGA
Sbjct: 58  VAEYLGIEFHQVHLEEEFARLIMEDFRSQYLGGETPNPCVRCNRYVKFGLLLDKALELGA 117

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDM-KK 197
           D LATGHY+R+     DD     ++ +   L +DQSYFL+  TQ QL  + FPLGDM  K
Sbjct: 118 DYLATGHYVRTSR---DDSGTYHLL-KAAHLAKDQSYFLYTLTQPQLARVLFPLGDMPSK 173

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
           + VR  A   G+ +A KSDSQ+ICFV    Y   +++        G+IVH+NG +LGRHN
Sbjct: 174 DEVRKRAAAFGIPVAQKSDSQEICFVPGDDYVAFLEKDGRLAGKSGEIVHVNGTVLGRHN 233

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL--GDGL 315
           G   YTIGQRRGLG+A  EPL+VV +D  ++RV+VG    L    +   +++W+   DG 
Sbjct: 234 GTHRYTIGQRRGLGIAWKEPLYVVAIDAINARVVVGEVGILFAPGLTACDLSWVVPPDG- 292

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFYTSDSNE 374
                 +  +   KIR  Q+PV   V+   DG   V F + +  V  GQ+ VFY  +   
Sbjct: 293 ------ETVQTTCKIRYRQNPVECSVKLLGDGRGEVRFSEPQKSVTPGQSVVFYQDEE-- 344

Query: 375 ARVLGGGIISGSKRS 389
             ++GGG I G+  S
Sbjct: 345 --LVGGGRIVGALSS 357


>gi|17228854|ref|NP_485402.1| tRNA-specific 2-thiouridylase MnmA [Nostoc sp. PCC 7120]
 gi|24638319|sp|Q8YX56|MNMA_ANASP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|17130706|dbj|BAB73316.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Nostoc sp. PCC 7120]
          Length = 352

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 145/364 (39%), Positives = 211/364 (57%), Gaps = 21/364 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSS  AA+L   GY+VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSTAAAILHNQGYEVIGLTLWLM------KGKGQCCS-EGMIDAAYICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS-VTRQLGADV 140
            + + H V D  + F+  ++    + Y AG TPLPC  CN+TVKF  ++   + +LG D 
Sbjct: 56  QLGIPHEVVDMRDVFQTHIVDYLVTGYGAGITPLPCSQCNKTVKFGPMVQYASEKLGCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+   R  + R +D  +DQSYFL+  +Q  L    FPLG+M+K   
Sbjct: 116 IATGHYARIRY---DEATGRYQLLRAVDRNKDQSYFLYDLSQDLLAASLFPLGEMEKADT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQILGRHNGI 259
           R +A E GL  ADK +SQD+C V+          ++  IA + GDIV   G++LG+H+G+
Sbjct: 173 RRIATEHGLKTADKPESQDLCLVESNGSMRAF--LDKYIAPKKGDIVDTAGKVLGQHDGV 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+VV LD   ++V+VG R         +  +NW+   + E +
Sbjct: 231 HHYTIGQRKGLGIAAPEPLYVVELDAVHNKVVVGDRTKATQEECTVNRVNWV--SIAEPS 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                   ++ RS+ +PV V    N   V + F++ +  +  GQA V+Y  D N  +VLG
Sbjct: 289 TPIRAAVQIRYRSAPEPVTVIPLENSR-VRLVFDEPQFSITPGQAAVWY--DGN--KVLG 343

Query: 380 GGII 383
           GGII
Sbjct: 344 GGII 347


>gi|205815331|sp|B0K584|MNMA1_THEPX RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
          Length = 364

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 143/382 (37%), Positives = 213/382 (55%), Gaps = 40/382 (10%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDA 76
           K+ RVVV MSGGVDSSV A LLK  G+DVIGVT+Q++  +  +A + +G CC+   V DA
Sbjct: 3   KNNRVVVGMSGGVDSSVSAYLLKEQGFDVIGVTMQIWQDKDEEAVRVEGGCCSLSAVNDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           RRV + I + +YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KF +LL     +
Sbjct: 63  RRVANKIGIKYYVMNFKDVFKEKVIDYFVDEYLRGRTPNPCIACNKYIKFEELLKRAWMI 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            A  +ATGHY        D+ + R ++ + +D  +DQ+Y L+  TQ QL  + FPLG  K
Sbjct: 123 DAYYVATGHYAVKEY---DEERGRYLLKKSVDTSKDQTYVLYNLTQTQLEHILFPLGKYK 179

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           K+ VR+LA+ +GL +A K DSQ+ICFV    Y   ++         G+     G+ LG H
Sbjct: 180 KDEVRELAKNLGLPVASKPDSQEICFVTDNDYGKFIRENAKEEIKPGEFRDTRGRFLGYH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GII+YTIGQR+GLG+++G+PL+VV +D  ++ V++G                  GD +F
Sbjct: 240 KGIIHYTIGQRKGLGISVGKPLYVVDIDAENNVVVLG-----------------YGDEVF 282

Query: 317 EDAVVDGFKCFV-------------KIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASG 362
            D ++     F+             KIR +       ++  +DG V+V F+  +  +  G
Sbjct: 283 GDELISYNNNFISIDKLEREMRVKAKIRYNAKEQDAVIRPLEDGKVFVKFDNPQRAITPG 342

Query: 363 QACVFYTSDSNEARVLGGGIIS 384
           Q+ VFY  D     V+GGG I 
Sbjct: 343 QSVVFYDGDI----VVGGGTIE 360


>gi|302392703|ref|YP_003828523.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acetohalobium arabaticum DSM 5501]
 gi|302204780|gb|ADL13458.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acetohalobium arabaticum DSM 5501]
          Length = 361

 Score =  247 bits (630), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 140/376 (37%), Positives = 218/376 (57%), Gaps = 20/376 (5%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS-KRKGSCCAG 70
           L LD+N    RVVVAMSGGVDSS+ AA+LK++GY+VIG+T++++ S +     +  CC+ 
Sbjct: 2   LGLDQN----RVVVAMSGGVDSSLAAAILKKEGYEVIGITMKIWPSEETPVDNENGCCSL 57

Query: 71  QDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL 130
             V DARRV   +++  YV ++E+ F+  VI  F + YA   TP PCV CN+ +KF+  L
Sbjct: 58  SAVNDARRVAYKLDIPFYVINFEDLFKRTVIQNFKNEYAQARTPNPCVVCNKVIKFNAFL 117

Query: 131 SVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRF 190
           +  ++LGA  +ATGHY  +++   +DG  R ++ +    ++DQ+Y L+  TQ+QL    F
Sbjct: 118 NKAKELGAYYMATGHY--AKIIQNEDG--RYLLKKSAAPDKDQTYMLYNLTQEQLKHTIF 173

Query: 191 PLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNG 250
           PL +  K+  R+LA++  L + DK +SQ+ICF+    Y   ++  +  I   G I+ + G
Sbjct: 174 PLAEYTKQQTRELAKDYDLKVYDKPESQEICFIPDDDYRRFLQENHPEIIEPGPILDVEG 233

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
             LG H G+  YTIGQRRGLG+   + L+VV +D   + +IVG  E +    + + EINW
Sbjct: 234 NKLGEHKGLPFYTIGQRRGLGLENNKKLYVVDMDPERNALIVGDNEDVFAKELIVEEINW 293

Query: 311 LG-DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGV-YVDFEKSEVGVASGQACVFY 368
           +  + L E   V       KIR +       +   ++ V  V F + +  +  GQ+ VFY
Sbjct: 294 ISIEKLTEPKEVQA-----KIRYNSPAAEATIYPVEENVAKVVFAEPQRAITPGQSAVFY 348

Query: 369 TSDSNEARVLGGGIIS 384
               N+  V+GGG+I 
Sbjct: 349 ----NQNIVVGGGVIK 360


>gi|291558301|emb|CBL35418.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Eubacterium siraeum V10Sc8a]
          Length = 358

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 138/363 (38%), Positives = 209/363 (57%), Gaps = 13/363 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + V+AMSGGVDSSV A L+K+  +D IGVT++L+ N      R+ SCC+  DV DAR V 
Sbjct: 4   KAVIAMSGGVDSSVAAYLMKQRVFDCIGVTMKLFANEDIGISREHSCCSLDDVEDARSVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
            ++++ +YVF++ +RF   VI  F  +Y  G TP PC+DCNR +KF  L    ++L  D 
Sbjct: 64  YSLDMPYYVFNFSDRFETDVIDRFIHAYENGITPNPCIDCNRYLKFDKLYMRAKELDRDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY  +R+  G++G  R ++ + +D  +DQSY L+  TQ+QL    FPLG+M+K   
Sbjct: 124 VVTGHY--ARVEKGENG--RFLLKKALDDTKDQSYVLYCLTQEQLSHTIFPLGEMRKSQA 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A   G   A K+DSQDICFVQ G Y D +++       +GD +  NG ++GRH G+I
Sbjct: 180 REIAESQGFINARKADSQDICFVQNGSYADFIEQYTGKNYPDGDFLDTNGNVIGRHKGVI 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GLG++  EPL+V  ++   + V +   + L    +   +IN +        +
Sbjct: 240 RYTVGQRKGLGISAPEPLYVKAVNPVINTVTLSYNDGLYSSIVKAGDINLIS----VPEI 295

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               +   K+R         V +N D +   F++ +  V  GQA V Y  D+    V+GG
Sbjct: 296 KGEMRVKAKVRYRHTEQWATVTQNSDTITAVFDEPQRAVTCGQALVLYDGDT----VVGG 351

Query: 381 GII 383
           G I
Sbjct: 352 GTI 354


>gi|205814656|sp|B1X0U7|MNMA_CYAA5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 355

 Score =  246 bits (629), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 206/367 (56%), Gaps = 27/367 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA L   GYDVIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSVAAASLHHQGYDVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H++ D  E F   +I    S Y +G TPLPC  CNR VKF  +L+  ++ L  D 
Sbjct: 56  QLGVPHHIVDTRELFEANIINYLVSGYESGVTPLPCSQCNRAVKFGPMLAYAKEELNCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+  RR  + R +D  +DQSYFL+  +Q  L    FPLG+  KE  
Sbjct: 116 IATGHYARIRY---DEQTRRYQLLRAIDRNKDQSYFLYDLSQDILKGTIFPLGEQTKEET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ----QGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           R +A E  L  A K +SQD+C ++       + D   +       EG+IV L+G++LG H
Sbjct: 173 RRIAAEFDLKTASKPESQDLCLIEAHGSMASFLDQYIKPK-----EGEIVDLDGKVLGTH 227

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GI +YTIGQR+GLG+A  EPL+VV LD   +RVIVG R +       +  +NW+   + 
Sbjct: 228 QGIHHYTIGQRKGLGIAAPEPLYVVKLDAVMNRVIVGNRAAGGRSDCTVGRLNWV--SIA 285

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           E +     +  V+ RS   PV +    N+  V + F + + G+  GQA VFY  +     
Sbjct: 286 EPSSPITVEVQVRYRSKAVPVSIIPIENNR-VTLQFNEPQFGITPGQAAVFYDGEI---- 340

Query: 377 VLGGGII 383
           VLGGGII
Sbjct: 341 VLGGGII 347


>gi|254423006|ref|ZP_05036724.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Synechococcus sp. PCC 7335]
 gi|196190495|gb|EDX85459.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Synechococcus sp. PCC 7335]
          Length = 365

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 148/375 (39%), Positives = 210/375 (56%), Gaps = 22/375 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++VV +SGGVDSSV AA L   G++VIG+TL L       K KG CC+ + + DA ++CD
Sbjct: 3   KIVVGLSGGVDSSVAAATLHNQGHEVIGLTLWLM------KGKGQCCS-EGMTDAAKLCD 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS-VTRQLGADV 140
            + +++ V D  E F   ++      Y+ G TPLPC  CN TVKF  +L     ++GAD 
Sbjct: 56  HLGIAYNVVDSREVFEKYIVNYLVEGYSRGVTPLPCSQCNSTVKFGPMLDYAVNEMGADY 115

Query: 141 LATGHYIR--SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           +ATGHY R    L  G     R  + R +D  +DQSYFL+  +Q  L   +FPLGD  K 
Sbjct: 116 IATGHYARITHNLETG-----RYELRRAVDRNKDQSYFLYDLSQTHLAASQFPLGDTTKS 170

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQ-GKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
             R +A  +GL  A+K +SQD+C V+Q G     + +  A     GDIV  +GQ+LG+H 
Sbjct: 171 ETRKIAASLGLHTAEKPESQDLCLVEQHGSMKTFLDKFLA--PKPGDIVTTSGQVLGQHE 228

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI +YTIGQRRGLG+A   PL+VV LD   ++V+VG R+S+  H   +  +NW+      
Sbjct: 229 GIHHYTIGQRRGLGIAAPNPLYVVSLDVGRNQVVVGERDSVTSHGCIVHRVNWVSIAPPT 288

Query: 318 DAVVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
             +    +   + ++ Q  V P       D V + F++ + GV  GQA V+Y S   + R
Sbjct: 289 SPISVEVQIRYRSQAVQATVIPTCRVDGTDRVRIIFDEPQFGVTPGQAAVWYDS---KGR 345

Query: 377 VLGGGIISGSKRSDA 391
           VLGGGII  +   D 
Sbjct: 346 VLGGGIIEPTCSDDT 360


>gi|172038551|ref|YP_001805052.1| tRNA-specific 2-thiouridylase MnmA [Cyanothece sp. ATCC 51142]
 gi|171700005|gb|ACB52986.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. ATCC 51142]
          Length = 367

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 150/367 (40%), Positives = 206/367 (56%), Gaps = 27/367 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA L   GYDVIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 15  KVVVGLSGGVDSSVAAASLHHQGYDVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 67

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H++ D  E F   +I    S Y +G TPLPC  CNR VKF  +L+  ++ L  D 
Sbjct: 68  QLGVPHHIVDTRELFEANIINYLVSGYESGVTPLPCSQCNRAVKFGPMLAYAKEELNCDR 127

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+  RR  + R +D  +DQSYFL+  +Q  L    FPLG+  KE  
Sbjct: 128 IATGHYARIRY---DEQTRRYQLLRAIDRNKDQSYFLYDLSQDILKGTIFPLGEQTKEET 184

Query: 201 RDLAREMGLDIADKSDSQDICFVQ----QGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           R +A E  L  A K +SQD+C ++       + D   +       EG+IV L+G++LG H
Sbjct: 185 RRIAAEFDLKTASKPESQDLCLIEAHGSMASFLDQYIKPK-----EGEIVDLDGKVLGTH 239

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GI +YTIGQR+GLG+A  EPL+VV LD   +RVIVG R +       +  +NW+   + 
Sbjct: 240 QGIHHYTIGQRKGLGIAAPEPLYVVKLDAVMNRVIVGNRAAGGRSDCTVGRLNWV--SIA 297

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           E +     +  V+ RS   PV +    N+  V + F + + G+  GQA VFY  +     
Sbjct: 298 EPSSPITVEVQVRYRSKAVPVSIIPIENNR-VTLQFNEPQFGITPGQAAVFYDGEI---- 352

Query: 377 VLGGGII 383
           VLGGGII
Sbjct: 353 VLGGGII 359


>gi|73920128|sp|Q72Q44|MNMA_LEPIC RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 375

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 143/381 (37%), Positives = 219/381 (57%), Gaps = 13/381 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDARRV 79
           +++VAMSGGVDS+V A LL  DGY+VIGV L+   Y +      K SCC+ +D+ DAR V
Sbjct: 5   KIIVAMSGGVDSAVTAGLLMEDGYEVIGVNLRTWEYEAPACDTTKKSCCSPEDIRDARDV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             ++ +  YV   E+ F+  VI  F   Y  G+TP PCV+CN  VKF  L    + LG D
Sbjct: 65  GISLKIPFYVIKMEKVFQEKVIDRFIEDYQHGKTPNPCVECNTFVKFGALFEKAKALGID 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +  +G+R  I    +D+ ++Q+Y+L+  +Q+ L ++ FPLG+M K  
Sbjct: 125 KIATGHYAR----IARNGERYAI-ANGIDVGKNQAYYLYGLSQENLKNVIFPLGEMTKPE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +AR MGL +ADKS+SQ+ICF+ +  Y   +++ N      G     +G+I+G+H G 
Sbjct: 180 VRQIARRMGLPVADKSESQEICFIPENDYRKFLEKKNVEFT-PGFFKLKDGRIVGKHKGR 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            N+TIGQR+GLG+A   PL+V+ ++ + S VI+G           + ++N+ G     + 
Sbjct: 239 ENFTIGQRKGLGIAWKNPLYVISIEDDGS-VILGEENETYNESFSVIDLNFQGLAPLNEG 297

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
             +  +C V++R    P+   + +  +G+ V   +   GV  GQ+ VFY  DS+   +L 
Sbjct: 298 --ESLECRVQVRYRHIPIRCKITKMKEGLIVHPLEDVRGVTPGQSAVFYPLDSD--YLLL 353

Query: 380 GGIISGSKRSDAVEESLLSVI 400
           GGIIS       V E  +SV+
Sbjct: 354 GGIISKGSIQMRVAEPAISVL 374


>gi|258515487|ref|YP_003191709.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257779192|gb|ACV63086.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 362

 Score =  246 bits (629), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 214/371 (57%), Gaps = 21/371 (5%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN-SRKASKRKGSCCAGQDVYDAR 77
           K  +VVVAMSGGVDSSV AALL  +GY++ GVT+Q+++  +K +  +  CC+   V DAR
Sbjct: 2   KGKKVVVAMSGGVDSSVTAALLLEEGYEITGVTMQIWDPEQKDATGEEGCCSLSAVDDAR 61

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV + +N+ +YV ++ ++F  +VI  F + Y  G TP PC+ CNR VKF+ LL     +G
Sbjct: 62  RVANILNIPYYVLNFRKQFEKSVIDYFLAEYLEGRTPNPCIACNRYVKFTALLQKAISIG 121

Query: 138 ADVLATGHYIR---SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
           AD +ATGHY R   S+ Y       R I+ +  D+++DQ+Y L+  TQ Q+     PLG 
Sbjct: 122 ADFIATGHYARLGYSKEY------NRYIIKKSADIKKDQTYVLYNLTQNQIAHTLMPLGV 175

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
             KE VR++A +  L +A K +SQ+ICFV    Y   +++        G  + + G+++G
Sbjct: 176 YTKEQVREMALKYCLPVAAKPESQEICFVPDNDYRSFIQKKTDAEIKPGLFLDIQGKVIG 235

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE-INWLGD 313
            H GI  YT GQRRGLG+A GE ++VV +D   + V +G  E      I+ RE I+   +
Sbjct: 236 EHRGIPYYTYGQRRGLGIAAGERMYVVDIDPARNTVTLGYEED-----IFTRELISGQNN 290

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
            +  D ++   +   KIR +  P   V     +D V V F++ +  V  GQA VFY+ D+
Sbjct: 291 FIAIDKLIAPMEVEAKIRYNSKPYKAVIFSEGEDRVKVVFDEPQRSVTPGQAVVFYSGDT 350

Query: 373 NEARVLGGGII 383
               V+GGG I
Sbjct: 351 ----VIGGGTI 357


>gi|168183036|ref|ZP_02617700.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Bf]
 gi|182673881|gb|EDT85842.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum Bf]
          Length = 356

 Score =  246 bits (628), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 210/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIGVT+Q++ +  +  +++G CC+   V DARRV 
Sbjct: 4   KVLVGMSGGVDSSVAAYLLKEQGYEVIGVTMQIWQDDEEFIEKEGGCCSLSAVADARRVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PC+ CN+ +KFS  L     +G D 
Sbjct: 64  NKIGIPFYVMNFKDAFKRNVIDYFVDEYMEGRTPNPCIACNKFIKFSSFLDKAMAMGIDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY   + +       R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 124 VATGHYAIIKKH-----NDRYIIKKSEDDKKDQTYALYNLTQFQLERTLMPCGQYKKSKI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+E+GL + +K DS++ICF+    +   +K        EG+ V   G ILG H GI+
Sbjct: 179 REIAKEIGLRVHNKKDSEEICFIPDNDHGRYIKNRFPNKVREGNFVDKQGNILGTHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GL +A G+P++VV ++   + V++G  E L    +  ++ N++  D L E  
Sbjct: 239 YYTIGQRKGLSIAFGKPMYVVDINPFRNEVVLGDLEDLLNTELIAKDTNYIPFDTLKEPM 298

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P    +   DDG V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 299 EVEA-----KIRYSQIPSKAIITPIDDGRVRVNFHEKQRAITKGQSVVFYKDD----LLI 349

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 350 GGGIIE 355


>gi|237739900|ref|ZP_04570381.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 2_1_31]
 gi|229423508|gb|EEO38555.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 2_1_31]
          Length = 362

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 208/377 (55%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           ++ D + K ++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  IEFDSDKKGIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HYV D  + F+  V+  F + Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYVLDVRDEFKEKVMDYFVNEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIQKDRLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA+++G+ +  K DSQ+ICF+  GK  + +     G A + G+IV 
Sbjct: 169 IFPVGDLEKPKLRELAKQIGVRVYSKKDSQEICFIDDGKLKEFLIENTKGKAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG+ILG+H G   YTIGQR+GLG++  EPL+V+  DK+++ +IVG  E L    +    
Sbjct: 229 KNGKILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDKDNNNIIVGENEDLFKDELVATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        +++N D   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVPSLES--LDNLECFAKTRSRDILHKCVLKKNGDNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY +D N   V+ GG I
Sbjct: 347 FYNNDGN---VIAGGFI 360


>gi|298490709|ref|YP_003720886.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           ['Nostoc azollae' 0708]
 gi|298232627|gb|ADI63763.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           ['Nostoc azollae' 0708]
          Length = 351

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 212/365 (58%), Gaps = 23/365 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA+L   GYDVIG+TL L       K KG CC+ + + DA  VC+
Sbjct: 3   KVVVGLSGGVDSSVAAAMLHNQGYDVIGLTLWLM------KGKGQCCS-EGMIDAASVCE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H V D  + F+  ++    S Y+ G TPLPC  CN+TVKF  ++   R+ LG++ 
Sbjct: 56  QLGIPHEVVDIRDVFQANIVDYLLSGYSMGITPLPCSQCNKTVKFGPMVEYAREKLGSNA 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY + R    D+   R  + R +   +DQSYFL+  +Q  L    FPLG++ K   
Sbjct: 116 IATGHYAQVRY---DETTGRYKLLRAVYRNKDQSYFLYDLSQDLLSASVFPLGELNKTDT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           R +A E GL  ADK +SQD+C V+  G     + R    +   GDI+   G++LG+H+G+
Sbjct: 173 RRIAAEYGLTTADKPESQDLCLVESNGSMRAFLDRYL--VPKPGDILDTTGKVLGQHDGV 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+G+G+A  EPL+V+ LD  ++RV+VG R         L  +NW+   + E A
Sbjct: 231 HHYTIGQRKGIGIAADEPLYVIELDAVNNRVVVGERTKGTQSECTLNRVNWV--SIAEPA 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDD-GVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
                +  V+IR    PVPV V   +D  V + F++ +  +  GQA V+Y  D    +VL
Sbjct: 289 T--PIRAEVQIRYRSQPVPVTVIPLEDFRVRLVFDEPQFSITPGQAAVWYEGD----KVL 342

Query: 379 GGGII 383
           GGGII
Sbjct: 343 GGGII 347


>gi|326201928|ref|ZP_08191798.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium papyrosolvens DSM 2782]
 gi|325987723|gb|EGD48549.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium papyrosolvens DSM 2782]
          Length = 359

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 134/366 (36%), Positives = 208/366 (56%), Gaps = 16/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK--GSCCAGQDVYDARRV 79
           +V++ MSGGVDSSV AA+L + GY+VIGVTLQ++      ++K  G CC+   V DARRV
Sbjct: 5   KVMLGMSGGVDSSVAAAILLKQGYEVIGVTLQIWQDMDEERQKSEGGCCSLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            + + + +YV ++++ F   VI  F   Y  G TP PC+ CNR VK+  +L     +G D
Sbjct: 65  ANKLGIPYYVLNFKDIFNKTVIEYFKEEYFKGRTPNPCIACNRHVKWQAMLDKALSMGID 124

Query: 140 VLATGHYIRSRLYVGDDGKRRR-IMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY +    V  D K  R I+ + +   +DQ+Y L+  TQQQL     P+GD  K+
Sbjct: 125 YIATGHYAK----VMQDAKTGRFILKKSVTDRKDQTYALYNLTQQQLSHTLMPVGDYTKD 180

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R++A+E+GL +A K DSQ+ICF+    Y   +        + G  +   G +LG H G
Sbjct: 181 EIREIAKEIGLSVATKPDSQEICFIHDNDYGKFLSENCDKKIVPGKFLDTKGNVLGNHKG 240

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I++YT+GQR+GLG+A G+P+FVV ++  ++ V++G    +    +   ++N++       
Sbjct: 241 IVHYTVGQRKGLGIAFGKPMFVVAVNPENNTVVLGDDSEVFSETLTASDLNFIS----IP 296

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
             +DG +   KIR S    P  +   D+  + V F+  +  +  GQ+ VFY  D     V
Sbjct: 297 KPIDGMRVNAKIRYSAKEAPATINVIDENRISVVFDIPQRAITPGQSVVFYDGDV----V 352

Query: 378 LGGGII 383
           +GGG I
Sbjct: 353 VGGGTI 358


>gi|237744375|ref|ZP_04574856.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 7_1]
 gi|229431604|gb|EEO41816.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 7_1]
          Length = 362

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 209/384 (54%), Gaps = 37/384 (9%)

Query: 6   ATRLNS-LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK 64
           A+  N  ++ D + K+++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +    
Sbjct: 8   ASEFNKYIEFDSSKKNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS---- 63

Query: 65  GSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTV 124
                     DA++VCD + + HYV D  + F+  V+  F S Y  G TP PC+ CNR +
Sbjct: 64  ----------DAKKVCDDLGIEHYVLDVRDEFKKKVVDYFVSEYMNGRTPNPCMVCNRHI 113

Query: 125 KFSDLLSVTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATT 181
           KF  +L      GA  +ATGHY + +   L VGDD              +DQ YFL    
Sbjct: 114 KFGKMLDFILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIQ 161

Query: 182 QQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL 241
           + +L  + FP+GD++K  +R+LA ++G+ +  K DSQ+ICFV  GK  + +     G A 
Sbjct: 162 KDRLNKIIFPVGDLEKSKLRELAEQLGVRVYSKKDSQEICFVDDGKLKEFLIENTKGKAK 221

Query: 242 E-GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEV 300
           + G+IV  +G ILGRH G   YTIGQR+GLG++  EPL+V+  D+ ++ +IVG  E L  
Sbjct: 222 KTGNIVDRDGNILGRHKGFSFYTIGQRKGLGISSEEPLYVLAFDRETNNIIVGKNEDLFK 281

Query: 301 HRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GV 359
             +    +N       E   +D  +CF K RS        ++++ D   V F  ++V  +
Sbjct: 282 DELIATRLNLFSVSSLES--LDNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKVRAI 339

Query: 360 ASGQACVFYTSDSNEARVLGGGII 383
             GQ  VFY   +NE  V+ GG I
Sbjct: 340 TPGQGIVFY---NNEGNVIAGGFI 360


>gi|56752503|ref|YP_173204.1| tRNA-specific 2-thiouridylase MnmA [Synechococcus elongatus PCC
           6301]
 gi|81300318|ref|YP_400526.1| tRNA-specific 2-thiouridylase MnmA [Synechococcus elongatus PCC
           7942]
 gi|81561195|sp|Q5MZ36|MNMA_SYNP6 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|123556790|sp|Q31N30|MNMA_SYNE7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|56687462|dbj|BAD80684.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Synechococcus elongatus PCC 6301]
 gi|81169199|gb|ABB57539.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Synechococcus elongatus PCC 7942]
          Length = 357

 Score =  246 bits (628), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 144/371 (38%), Positives = 210/371 (56%), Gaps = 23/371 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RVVV +SGGVDSSV AALL R GY V G+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   RVVVGLSGGVDSSVAAALLHRQGYAVEGLTLWLM------KGKGQCCS-EGMVDAAGICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR-QLGADV 140
            + V ++V D  +RF+ A++      Y AG TPLPC  CNR VKF  +L   + +L AD 
Sbjct: 56  QMGVPYHVVDSRDRFQEAIVDYVVQGYEAGITPLPCSQCNRAVKFGPMLDYAKTELKADA 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    +    R  + R +D  +DQ+YFL+   Q  L  ++FPLG++ K   
Sbjct: 116 IATGHYARLRQ---NPETGRTELLRAVDRNKDQTYFLYDLPQSVLQSVKFPLGELTKPET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           R +A E+GL  A+K +SQD+C  +  G     + R     + EG+IV  +G++LG+H GI
Sbjct: 173 RQIAAELGLRTAEKPESQDLCLAEVHGSMRAFLDRYIE--SREGEIVDQSGRVLGKHTGI 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+V+ +D   +RV+VG R S       +  +NW+     +  
Sbjct: 231 HHYTIGQRKGLGIAHSEPLYVIAIDPIQNRVVVGDRHSAAQSECTVSRVNWVSIAQPDAP 290

Query: 320 VVDGFKCFVKIRSSQDPVP-VFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           +    +  V++R    PVP   +    D   + F   +  +  GQA V+Y  D    R+L
Sbjct: 291 I----QAAVQVRYRSAPVPCTVIPLAGDRARILFADPQFSITPGQAAVWYDGD----RLL 342

Query: 379 GGGIISGSKRS 389
           GGG+I   +R+
Sbjct: 343 GGGLIDRVERT 353


>gi|218439179|ref|YP_002377508.1| tRNA-specific 2-thiouridylase MnmA [Cyanothece sp. PCC 7424]
 gi|226704768|sp|B7KHE5|MNMA_CYAP7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|218171907|gb|ACK70640.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. PCC 7424]
          Length = 349

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 151/366 (41%), Positives = 205/366 (56%), Gaps = 25/366 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RVVV +SGGVDSS  AA L   GYDV+G+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   RVVVGLSGGVDSSTAAASLHHQGYDVVGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H++ D  + F   +I    S Y  G TPLPC  CNR VKF  +L+  RQ LG D 
Sbjct: 56  QLGIPHHIVDSRDVFEKNIIDYLVSGYEVGITPLPCSQCNRAVKFGPMLNYARQELGIDR 115

Query: 141 LATGHYIRSRLYVG-DDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +ATGHY R    +G D+   R  + R +D  +DQSYFL+  TQ  L    FPLG+  KE 
Sbjct: 116 IATGHYAR----IGYDEVSGRYQLLRAVDRNKDQSYFLYDLTQDLLAATLFPLGNQTKEE 171

Query: 200 VRDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            R +A E GL  ADK +SQD+C ++  G   + + +       EGDIV L G++LG+H G
Sbjct: 172 TRRIAHEFGLKTADKPESQDLCLIEAHGSMQEFLDKYIK--QKEGDIVDLKGKVLGKHKG 229

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
           I +YTIGQR+GLGVA  EPL+VV LD   +RVIVG R         +  +NW+      D
Sbjct: 230 IHHYTIGQRKGLGVAAPEPLYVVKLDPIMNRVIVGNRADAGQSECNVSRMNWVS---IPD 286

Query: 319 AVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
                 +   ++R    PV V  +   D+ + + F++ + G+  GQA V Y  D     +
Sbjct: 287 PSTP-IQTEAQVRYRSFPVRVNVIPLGDNRITLVFDEPQFGITPGQAAVLYQGDI----L 341

Query: 378 LGGGII 383
           LGGGII
Sbjct: 342 LGGGII 347


>gi|260886459|ref|ZP_05897722.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas sputigena ATCC 35185]
 gi|260863841|gb|EEX78341.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas sputigena ATCC 35185]
          Length = 344

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 207/358 (57%), Gaps = 19/358 (5%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDSS+ AALL+  GY+V+G+T+QL +  +      S        DARRV D + + 
Sbjct: 1   MSGGVDSSLCAALLQEQGYEVLGITMQLSDDSREMNGVSSAAT-----DARRVADFLGIE 55

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           H V D+   F + V+  F + Y    TP PCV CNR +KF +LLS  ++ GAD LATGHY
Sbjct: 56  HVVADFRTLFSDKVVDYFLTEYLTARTPNPCVICNRFLKFGELLSFAKEKGADFLATGHY 115

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
           +R  +   +DG     + +  D ++DQSY L+   ++ L  + FPLG  +KE  R LA++
Sbjct: 116 VR--VEKEEDGSFS--LKKGRDEKKDQSYVLYRLPREILSHILFPLGSYRKEETRALAQK 171

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
           + L +A+K++SQ+ICFV +  Y   + +        GDIV + GQILG+H G+  YTIGQ
Sbjct: 172 LSLPVANKAESQEICFVPEDDYKAYLSQHRPNRFHTGDIVDMQGQILGQHRGLPFYTIGQ 231

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           R+GLG+A   PL+V+ LD+ ++RVIVG  E L    ++  ++NWL +   ++  V     
Sbjct: 232 RKGLGIAAAHPLYVIALDEANNRVIVGKNEELYASSLFASDVNWLMEEPTQEISVHA--- 288

Query: 327 FVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGII 383
             KIR     V   V   +DG V V F + +  V  GQ+ VFY+ +    R++GG  I
Sbjct: 289 --KIRYGSREVQANVLPLEDGAVKVSFLEPQRAVTPGQSVVFYSGE----RLVGGATI 340


>gi|307691533|ref|ZP_07633770.1| putative tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ruminococcaceae bacterium D16]
          Length = 361

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 138/363 (38%), Positives = 197/363 (54%), Gaps = 12/363 (3%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRK-ASKRKGSCCAGQDVYDARRVCD 81
           +  AMSGGVDSS    LL++ GYD +G T+ L++       ++  C   +DV DA+ V  
Sbjct: 4   IAAAMSGGVDSSTAVWLLQQAGYDPVGFTMSLFSPDALPPDQRSQCHTARDVADAQAVAQ 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + +SH+  D  E F   V+ PF  +Y  G+TP PCV CNR +KF  LL   +++G  +L
Sbjct: 64  RLGISHHTLDLSESFCREVMDPFVQAYEQGQTPNPCVLCNRAIKFGALLQAAQEMGCPLL 123

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +      D G  R ++ + +  ++DQSY L+  TQQQL   RFPLG + KE +R
Sbjct: 124 ATGHYAQVE---QDSGSGRWLLKKALHPDKDQSYVLWTLTQQQLAATRFPLGQLSKEEIR 180

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A E GL  A KSDSQDICFV  G Y   +          GD V   G +LGRH GII+
Sbjct: 181 AIALEQGLVSARKSDSQDICFVPDGDYASFICHHTGKHYPSGDFVDPQGNVLGRHQGIIH 240

Query: 262 YTIGQRRGLGVAMGEP-LFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           YT+GQRRGLGV+  +  L+V  L    + V +G   +L    +   ++N +     +  +
Sbjct: 241 YTLGQRRGLGVSSNQGRLYVTGLSPQDNTVTLGSNAALLHRSLTAGQLNLIAMERLDQPI 300

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               K  V+ R ++ P  +  Q   D   + F++ +  +  GQ+ VFY  D     VLGG
Sbjct: 301 QVMAK--VRYRMTEQPA-ILEQTGPDTARLTFQEPQRAITPGQSVVFYQDDV----VLGG 353

Query: 381 GII 383
           GII
Sbjct: 354 GII 356


>gi|139438964|ref|ZP_01772424.1| Hypothetical protein COLAER_01430 [Collinsella aerofaciens ATCC
           25986]
 gi|133775675|gb|EBA39495.1| Hypothetical protein COLAER_01430 [Collinsella aerofaciens ATCC
           25986]
          Length = 366

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 143/369 (38%), Positives = 208/369 (56%), Gaps = 13/369 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV+VAMSGGVDSSV A LLK  GY+ +G T++L          G     +D+ DA+ V +
Sbjct: 5   RVLVAMSGGVDSSVTAYLLKSQGYECVGATMRL-TCPAPDPTTGMSKVDRDIADAKAVAE 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + H+V D ++ F   VI  F ++Y  G TP PC+ CNR +KF  LL     +G D +
Sbjct: 64  RLGIPHHVLDLQQTFDRNVIERFVNAYQEGLTPNPCIICNRHIKFGALLDAALDMGCDYI 123

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE-SV 200
           ATGHY ++      DG  +  + R  D ++DQSYFL++ TQ++L    FPL  + KE  V
Sbjct: 124 ATGHYAKTSQAA--DGTWQ--LHRGEDPKKDQSYFLYSLTQERLAHTIFPLAGLDKERDV 179

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A E G   A K++S+DICF+  G Y D ++R     A  GDIV  +G ++GRHNG +
Sbjct: 180 RRIAAEQGFTNAQKAESEDICFIPDGDYADYIERRCGHTAAPGDIVWRDGSVVGRHNGAL 239

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLGVAM  P++V  +D  ++ V +G  E L    +   E  W       +A 
Sbjct: 240 RYTIGQRKGLGVAMAHPVYVTGIDAANNTVHLGEAEDLTAVALTADEWIWSAPDARMEAE 299

Query: 321 VD--GFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARV 377
           +D  G +   K R  Q      + R++DG + + F++ +  +A GQA V Y  D     V
Sbjct: 300 LDAGGIRVGAKYRYRQKDQAATLTRDEDGQMLLTFDEPQRAIAPGQAVVVYRGDI----V 355

Query: 378 LGGGIISGS 386
           LGGG ++G+
Sbjct: 356 LGGGTVTGA 364


>gi|289428353|ref|ZP_06430040.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes J165]
 gi|289158502|gb|EFD06718.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes J165]
          Length = 366

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 213/376 (56%), Gaps = 25/376 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           M+V+ AMSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 1   MKVLAAMSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 60  AADRLGIPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGY 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 120 DAVATGHYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKM 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHN 257
           +VR  A  +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HN
Sbjct: 175 NVRQEATALGLSVADKPDSNDICFIPDG---DTPGWLSEKIGSADGEIRDESGALVGHHN 231

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G  ++TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W   
Sbjct: 232 GYHHFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-- 289

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                  V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D  
Sbjct: 290 ---SSEPVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD-- 344

Query: 374 EARVLGGGIISGSKRS 389
              V+G   I G+ R+
Sbjct: 345 --LVVGSATICGTDRA 358


>gi|156741716|ref|YP_001431845.1| tRNA-specific 2-thiouridylase MnmA [Roseiflexus castenholzii DSM
           13941]
 gi|156233044|gb|ABU57827.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Roseiflexus castenholzii DSM 13941]
          Length = 383

 Score =  246 bits (627), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 215/375 (57%), Gaps = 20/375 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++++AMSGGVDSS+ AALL   G+DV GVTL L+        +  CC+ +    ARRVC 
Sbjct: 15  KIMIAMSGGVDSSLAAALLHEAGHDVTGVTLHLWEGDDDRLAESLCCSQEMTESARRVCA 74

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + +YVF+Y+  FR +VI  F   YA+G TP PC++CNR +KF  LL+  R LG D +
Sbjct: 75  QLGIPYYVFNYQREFRRSVIEYFLREYASGFTPNPCLECNREIKFRALLARARALGFDYV 134

Query: 142 ATGHYIRSRL---------YVGDDGKRRRI--MCRPMDLERDQSYFLFATTQQQLCDLRF 190
           ATGHY R R+             +G +R +  + R +D E+DQSY L+   Q  L  L F
Sbjct: 135 ATGHYARIRVDKTPADHSASPSPNGAQRAVYRLLRAVDEEKDQSYMLYMLGQDDLARLMF 194

Query: 191 PLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNG 250
           P+G+  K  VR LA   GL  A++ +SQDICFV  G Y ++++         G I+ L G
Sbjct: 195 PIGEYTKAEVRALAAARGLASANRPESQDICFVPGGDYRNLLREERPDALRPGPILDLEG 254

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           + +GRH G+  YTIGQRRGLG+A G+P++V+ LD   + VIVGP  +L    +    + +
Sbjct: 255 REVGRHQGLPLYTIGQRRGLGIATGQPMYVMALDVARNAVIVGPESALRRTTLRAERVTF 314

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYT 369
           +  G + +A    F C  +IR+  D VP  V     + V V FE  +  +  GQA VFY 
Sbjct: 315 V-SGSWPEA---PFDCLAQIRAHADAVPARVTPVEPERVEVRFEHPQRAITPGQAIVFY- 369

Query: 370 SDSNEARVLGGGIIS 384
              + A VLGGG I+
Sbjct: 370 ---DGAVVLGGGRIA 381


>gi|50842596|ref|YP_055823.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes KPA171202]
 gi|289425475|ref|ZP_06427252.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes SK187]
 gi|81611733|sp|Q6A8Q1|MNMA_PROAC RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|50840198|gb|AAT82865.1| probable tRNA
           (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes KPA171202]
 gi|289154453|gb|EFD03141.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes SK187]
          Length = 366

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 213/376 (56%), Gaps = 25/376 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           M+V+ AMSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 1   MKVLAAMSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 60  AADRLGIPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGY 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 120 DAVATGHYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKM 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHN 257
           +VR  A  +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HN
Sbjct: 175 NVRQEAAALGLSVADKPDSNDICFIPDG---DTPGWLSEKIGSADGEIRDESGALVGHHN 231

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G  ++TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W   
Sbjct: 232 GYHHFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-- 289

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                  V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D  
Sbjct: 290 ---SSEPVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD-- 344

Query: 374 EARVLGGGIISGSKRS 389
              V+G   I G+ R+
Sbjct: 345 --LVVGSATICGTDRA 358


>gi|86157907|ref|YP_464692.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|123497474|sp|Q2IHX6|MNMA_ANADE RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|85774418|gb|ABC81255.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 351

 Score =  245 bits (626), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 200/364 (54%), Gaps = 13/364 (3%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           MR++VAMSGGVDSS  AALL  +G++VIGVT+++ +   A++ + SCCA  DV DAR   
Sbjct: 1   MRILVAMSGGVDSSTAAALLAGEGHEVIGVTMRVADYSDAARGR-SCCAPDDVEDARAAA 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +  YV + E RFR  VI  F   Y  G TP PCV CN  VKF  LL+  R LGA  
Sbjct: 60  RRLGIPFYVANVEARFRERVIDRFVDDYVEGRTPNPCVACNTEVKFDWLLARARALGAK- 118

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY R           RR +    D  +DQSYFL+   Q  L D+ FP+G + K +V
Sbjct: 119 LATGHYARVEER-----GGRRRLLTAADPAKDQSYFLYGLGQDALGDVLFPVGALAKPAV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R  A   GL +A+K DSQ+ICFV  G   D V          G+IV   G++LGRH+G+ 
Sbjct: 174 RAEAARAGLAVAEKPDSQEICFVTLGDAGDFVALRAPARVRPGEIVSTAGEVLGRHDGVH 233

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            +T+GQRRGLG+A   P +VV LD  ++RV+VG  E     R  +RE  W+       AV
Sbjct: 234 RFTVGQRRGLGLAGPAPRYVVRLDAAAARVVVGSAEEASRDRFEVREATWVSGAPPGGAV 293

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               +  V+ R   +   V  +    G  V   +   GVA GQA VFY  D     V+GG
Sbjct: 294 E--LRVKVRHRHEGERGTVRARAGGAGAEVRLARPVRGVAPGQAAVFYDGDE----VVGG 347

Query: 381 GIIS 384
           G I+
Sbjct: 348 GRIA 351


>gi|24214187|ref|NP_711668.1| tRNA-specific 2-thiouridylase MnmA [Leptospira interrogans serovar
           Lai str. 56601]
 gi|59799068|sp|Q8F625|MNMA_LEPIN RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|24195088|gb|AAN48686.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Leptospira interrogans serovar Lai str. 56601]
          Length = 375

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 142/381 (37%), Positives = 219/381 (57%), Gaps = 13/381 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDARRV 79
           +++VAMSGGVDS+V A LL  DGY+VIGV L+   Y +      K SCC+ +D+ DAR V
Sbjct: 5   KIIVAMSGGVDSAVTAGLLMEDGYEVIGVNLRTWEYEAPACDTTKKSCCSPEDIRDARDV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             ++ +  YV   E+ F+  VI  F   Y  G+TP PCV+CN  VKF  L    + LG D
Sbjct: 65  GISLKIPFYVIKMEKVFQEKVIDRFIEDYQHGKTPNPCVECNTFVKFGALFEKAKALGID 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +  +G+R  I    +D+ ++Q+Y+L+  +Q+ L ++ FPLG+M K  
Sbjct: 125 KIATGHYAR----IARNGERYAI-ANGIDVGKNQAYYLYGLSQENLKNVIFPLGEMTKPE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR +AR MGL +ADKS+SQ+ICF+ +  Y   +++ N      G     +G+I+G+H G 
Sbjct: 180 VRQIARRMGLPVADKSESQEICFIPENDYRKFLEKKNVEFT-PGFFKLKDGRIVGKHKGR 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            N+TIGQR+GLG+A   PL+V+ ++ + S VI+G           + ++N+ G     + 
Sbjct: 239 ENFTIGQRKGLGIAWKNPLYVISIEDDGS-VILGEENETYNESFSVIDLNFQGLAPLNEG 297

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
             +  +C V++R    P+   + +  +G+ V   +   GV  GQ+ VFY  DS+   +L 
Sbjct: 298 --ESLECRVQVRYRHIPIRCKITKMKEGLIVHPLEDVRGVTPGQSAVFYPLDSD--YLLL 353

Query: 380 GGIISGSKRSDAVEESLLSVI 400
           GGIIS       + E  +SV+
Sbjct: 354 GGIISKGSIQMRIVEPAISVL 374


>gi|225573524|ref|ZP_03782279.1| hypothetical protein RUMHYD_01717 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039121|gb|EEG49367.1| hypothetical protein RUMHYD_01717 [Blautia hydrogenotrophica DSM
           10507]
          Length = 362

 Score =  245 bits (626), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 133/365 (36%), Positives = 211/365 (57%), Gaps = 15/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS-RKASKRKGSCCAGQDVYDARRVC 80
           RVV+ MSGGVDSSV A LLK+ GY+V+GVT++ +    +++   G   + + + DA+ V 
Sbjct: 5   RVVIGMSGGVDSSVAAYLLKKAGYEVLGVTMKTWTPVSESADDPGLGGSPEVIEDAKEVA 64

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             + +S+YV D++  F + V+  F   Y  G TP PCV CNR VK+  LL+  ++LGAD 
Sbjct: 65  RALGISYYVVDFQRDFSDYVVDYFTQEYLEGRTPNPCVVCNRYVKWEALLNKAKELGADY 124

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY  +R+   ++G+     C      +DQ+Y L+  TQ QL     P+GD  KE +
Sbjct: 125 IATGHY--ARIVCLENGRYALKTCEVS--AKDQTYALYNLTQAQLAHTLMPVGDYNKEEI 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A ++GL +ADK DSQ+ICF+    Y + +++       +G+ V   G ++G+H GII
Sbjct: 181 REIASKIGLPVADKPDSQEICFIPDHDYANFIRQRTGKEVCQGNFVTAGGTVVGQHRGII 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQR+GL ++MG P+FV  +   ++ V++G  + +    +   +IN++G   FE   
Sbjct: 241 HYTIGQRKGLNLSMGRPVFVTEIRPKTNEVVIGDAQEVFASALRCTKINYMGIEKFE--- 297

Query: 321 VDGFKCFVKIRSSQDPVPVFVQR--NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            +G +   KIR +    P ++++   D  V   F + +  +  GQA VFY     E  V 
Sbjct: 298 -EGMELLAKIRYNHKGAPCWIEKVLPDGDVICRFAQPQRAITPGQAVVFY----QEGYVA 352

Query: 379 GGGII 383
            GG I
Sbjct: 353 AGGTI 357


>gi|34763143|ref|ZP_00144111.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
 gi|27887172|gb|EAA24275.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Fusobacterium nucleatum subsp. vincentii ATCC 49256]
          Length = 362

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 140/377 (37%), Positives = 204/377 (54%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+ + N  +++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  LEFNSNNSNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HYV D    F+  V+  F + Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYVLDVRNEFKEKVMDYFVNEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIEKDRLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA++MG+ +  K DSQ+ICFV  GK    +     G A + G+IV 
Sbjct: 169 IFPVGDLEKTKLRELAKQMGVRVYSKKDSQEICFVDDGKLKQFLIENTKGEAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG ILG+H G   YTIGQR+GLG++  EPL+V+  DK ++ +IVG  E L    +    
Sbjct: 229 KNGNILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDKKTNNIIVGENEDLFKDELIATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        ++++ +   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVSSLES--LDNLECFAKTRSRDILHKCLLKKDGNNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY   +NE  V+ GG I
Sbjct: 347 FY---NNEGNVIAGGFI 360


>gi|291296936|ref|YP_003508334.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Meiothermus ruber DSM 1279]
 gi|290471895|gb|ADD29314.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Meiothermus ruber DSM 1279]
          Length = 362

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 208/369 (56%), Gaps = 31/369 (8%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV+ AMSGGVDSSV AALLK+ GY+VIG  ++ +   K      +CC+    Y+ARRV D
Sbjct: 4   RVLAAMSGGVDSSVSAALLKQQGYEVIGAMMRFWPDNKKDDCFETCCSPDAAYEARRVAD 63

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I +  Y+ DY E F+  +I PF + Y  GETP PCV+CN  VKF  LL   R LG D +
Sbjct: 64  IIGIPFYLLDYREEFQEKIIDPFIAGYQQGETPNPCVNCNTRVKFDSLLKKARMLGCDYV 123

Query: 142 ATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           ATGHY+ +R   LY GD  K             DQ+YFL+ T ++ +  + FP+G ++K 
Sbjct: 124 ATGHYVINRDGGLYRGDPKK-------------DQTYFLWGTPKEAIPHMLFPVGHLEKP 170

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQILGRHN 257
            VR LA + GL  A K +SQ+ICFV QG   D + +  +  A  G ++ L  GQ +G HN
Sbjct: 171 QVRALAEQFGLPTAKKPESQNICFV-QGDLKDFLAQHLS--ARPGPLIDLETGQQIGEHN 227

Query: 258 GIINYTIGQRRGLGVAMGE-PLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           G   YT+GQ++GLG+       +VV ++  ++ VIVGPRE+     + +RE+N     L 
Sbjct: 228 GAQFYTVGQKKGLGLWKSHLERYVVQVNTTTNEVIVGPREACMWGGLEIREVN-----LL 282

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEA 375
            +A     +  V++R    PVP  V+  + G + +   + +  V  GQ+ V Y  +    
Sbjct: 283 VEAQDLPERLEVQVRYRTRPVPARVEAMEAGRMVIRLAEPQFAVTPGQSAVLYQGE---- 338

Query: 376 RVLGGGIIS 384
           R+LGGG I+
Sbjct: 339 RLLGGGFIT 347


>gi|205822073|sp|A7NK07|MNMA_ROSCS RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 371

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 215/375 (57%), Gaps = 20/375 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++++AMSGGVDSS+ AALL   G+DV GVTL L+        +  CC+ +    ARRVC 
Sbjct: 3   KIMIAMSGGVDSSLAAALLHEAGHDVTGVTLHLWEGDDDRLAESLCCSQEMTESARRVCA 62

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + +YVF+Y+  FR +VI  F   YA+G TP PC++CNR +KF  LL+  R LG D +
Sbjct: 63  QLGIPYYVFNYQREFRRSVIEYFLREYASGFTPNPCLECNREIKFRALLARARALGFDYV 122

Query: 142 ATGHYIRSRL---------YVGDDGKRRRI--MCRPMDLERDQSYFLFATTQQQLCDLRF 190
           ATGHY R R+             +G +R +  + R +D E+DQSY L+   Q  L  L F
Sbjct: 123 ATGHYARIRVDKTPADHSASPSPNGAQRAVYRLLRAVDEEKDQSYMLYMLGQDDLARLMF 182

Query: 191 PLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNG 250
           P+G+  K  VR LA   GL  A++ +SQDICFV  G Y ++++         G I+ L G
Sbjct: 183 PIGEYTKAEVRALAAARGLASANRPESQDICFVPGGDYRNLLREERPDALRPGPILDLEG 242

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           + +GRH G+  YTIGQRRGLG+A G+P++V+ LD   + VIVGP  +L    +    + +
Sbjct: 243 REVGRHQGLPLYTIGQRRGLGIATGQPMYVMALDVARNAVIVGPESALRRTTLRAERVTF 302

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYT 369
           +  G + +A    F C  +IR+  D VP  V     + V V FE  +  +  GQA VFY 
Sbjct: 303 V-SGSWPEAP---FDCLAQIRAHADAVPARVTPVEPERVEVRFEHPQRAITPGQAIVFY- 357

Query: 370 SDSNEARVLGGGIIS 384
              + A VLGGG I+
Sbjct: 358 ---DGAVVLGGGRIA 369


>gi|28211134|ref|NP_782078.1| tRNA-specific 2-thiouridylase MnmA [Clostridium tetani E88]
 gi|75542384|sp|Q894S7|MNMA2_CLOTE RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|28203574|gb|AAO36015.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Clostridium tetani E88]
          Length = 358

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 210/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS-KRKGSCCAGQDVYDARRVC 80
           +V+V MSGGVDSSV A LLK  GY+VIG T+Q++   K   +R+G CC+   V DARRV 
Sbjct: 7   KVLVGMSGGVDSSVAAYLLKEQGYEVIGATMQIWQDDKEFIEREGGCCSLSAVADARRVA 66

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           + I +  YV ++++ F+  VI  F   Y  G TP PCV CN+ +KFS  L     LG D 
Sbjct: 67  NKIGIPFYVMNFKDAFKKNVIDYFVDEYMEGRTPNPCVACNKFIKFSSFLDKAMTLGIDY 126

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + +    R I+ +  D ++DQ+Y L+  TQ QL     P G  KK  +
Sbjct: 127 VATGHYA-----IIEKQNNRYIVRKSEDDKKDQTYALYNLTQFQLERTLMPCGRYKKSEI 181

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A+++GL + +K DSQ+ICF+    +   +K        +G+ V  +G +LG H GI+
Sbjct: 182 REIAKKIGLRVHNKKDSQEICFIPDNDHGKYIKNRFPSKVRQGNFVDKSGNVLGTHKGIV 241

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFEDA 319
            YTIGQR+GL +A+G+P++VV ++   + V++G  + L    +  +++N++  D L E  
Sbjct: 242 YYTIGQRKGLDIALGKPMYVVDINPFRNEVVLGNLDDLLNTELIAKDVNYIPFDNLKEPM 301

Query: 320 VVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            V+      KIR SQ P   V     +D V V+F + +  +  GQ+ VFY  D     ++
Sbjct: 302 EVEA-----KIRYSQIPSKAVITPMENDKVKVNFTEKQRAITKGQSVVFYKGD----LLI 352

Query: 379 GGGIIS 384
           GGGII 
Sbjct: 353 GGGIIE 358


>gi|296328692|ref|ZP_06871209.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
 gi|296154291|gb|EFG95092.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 23726]
          Length = 362

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 203/377 (53%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L  D N  ++R+ VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  LKFDSNNSNIRIGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HY+ D  + F+  V+  F + Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYILDVRDEFKEKVVDYFVNEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIEKNKLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA ++G+ +  K DSQ+ICFV  GK    +     G A + G+IV 
Sbjct: 169 IFPVGDLEKTKLRELAEQLGVRVYSKKDSQEICFVDDGKLKQFLIENTKGKAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG ILG+H G   YTIGQR+GLG++  EPL+V+  D+ ++ +IVG  E L    +    
Sbjct: 229 KNGNILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDRKTNNIIVGQNEDLFRDELIATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        ++++ D   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVSSLEG--LDNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY +D N   V+ GG I
Sbjct: 347 FYNNDGN---VIAGGFI 360


>gi|310780562|ref|YP_003968894.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ilyobacter polytropus DSM 2926]
 gi|309749885|gb|ADO84546.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ilyobacter polytropus DSM 2926]
          Length = 376

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 141/358 (39%), Positives = 205/358 (57%), Gaps = 23/358 (6%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY---NSRKASKRKGSCCAGQDVYDARRV 79
           V V MSGGVDSS VA +LK+ GY+VIG+T++ +   +         +CC+  D+YDA+RV
Sbjct: 23  VAVGMSGGVDSSTVAYMLKKQGYNVIGITMKHWSGMDELSEDSNSKTCCSLDDIYDAKRV 82

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           CD +++ HYV + +E F+  V+  F   Y  G TP PC+ CNR +K   LL    ++GAD
Sbjct: 83  CDDLDIPHYVINLKEPFKEKVVDYFIEEYEKGRTPNPCMVCNRYIKLGKLLEYGIKMGAD 142

Query: 140 VLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
            +ATGHY + +   LY+GDD K            +DQ YFL    ++ L  L FP+GD++
Sbjct: 143 FVATGHYAKIKNGNLYMGDDPK------------KDQVYFLSQVKRENLKYLMFPVGDLE 190

Query: 197 KESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAG-IALEGDIVHLNGQILGR 255
           K  VR +A  +G+ +  K DSQ++CF++ GK  + +  +  G +  EGDIV  +G++LG+
Sbjct: 191 KPQVRKIAEYLGVRVYAKRDSQEVCFIEDGKLKEFLVDMTDGRVEKEGDIVTKDGKVLGK 250

Query: 256 HNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL 315
           H G   YTIGQR+GLG+    PL+V+ LD   +RVIVG  E L  + ++   IN L    
Sbjct: 251 HKGFAFYTIGQRKGLGIQHETPLYVLKLDSKKNRVIVGGNEDLFKNELFADSINVLSFDK 310

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEV-GVASGQACVFYTSD 371
            ED  +DG +C  K RS        V+   D+ + V F  ++V  V  GQ  V Y  D
Sbjct: 311 IED--IDGIECQAKTRSRDILHLCKVEVIKDNLIKVKFLDNKVRAVTPGQGLVLYDFD 366


>gi|85860332|ref|YP_462534.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Syntrophus aciditrophicus SB]
 gi|123517346|sp|Q2LWA6|MNMA1_SYNAS RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|85723423|gb|ABC78366.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Syntrophus aciditrophicus SB]
          Length = 372

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 142/363 (39%), Positives = 200/363 (55%), Gaps = 19/363 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV++A+SGGVDSSV A LLK +GY+V GVT+ L    +  + K  CC  + + DAR VC+
Sbjct: 22  RVLLAISGGVDSSVAALLLKEEGYEVAGVTMCL--GVREEENKVRCCGREAIEDARGVCE 79

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV DY       VI  F   Y  G TP PC+DCNR +KF  LL   R +G D L
Sbjct: 80  ILGIPHYVLDYAPLLETCVIDKFVREYRLGRTPNPCIDCNRYLKFGHLLDSARTMGFDYL 139

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY +      +  + R I+ +  DL +DQ+YFL+      L  + FPL D  K+ VR
Sbjct: 140 ATGHYAKI-----ERKESRWILKKAKDLVKDQTYFLYPIPVAALEHILFPLADRTKDEVR 194

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
           ++AR+  L IA+K +SQD+CFV Q  Y D ++     +   G IV  +G++LG H+G + 
Sbjct: 195 EIARQALLPIAEKPESQDLCFVTQDSYRDFLQEQGCPVH-PGPIVDRSGRVLGEHSGTVF 253

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR GLG++   PL+VV +D   + VIV  +E +    +   E+NWL     ++A  
Sbjct: 254 YTIGQRHGLGISSPFPLYVVAIDVAGNSVIVSGKEDVYAQGLVAGEMNWLTPERPQEAE- 312

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
                  +IR  +      +    D + V F + +  V  GQA V Y  D     VLGGG
Sbjct: 313 ------ARIRHRKRTCSCRIVPEGDRIRVYFAEDQDAVTPGQAVVLYQEDE----VLGGG 362

Query: 382 IIS 384
           +I 
Sbjct: 363 VIE 365


>gi|295130676|ref|YP_003581339.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes SK137]
 gi|291375276|gb|ADD99130.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes SK137]
          Length = 366

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 213/376 (56%), Gaps = 25/376 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           M+V+ AMSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 1   MKVLAAMSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 60  AADRLGIPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGY 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 120 DAVATGHYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKM 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHN 257
           +VR  A  +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HN
Sbjct: 175 NVRQEAAALGLSVADKPDSNDICFIPDG---DTRGWLSEKIGSADGEIRDESGALVGHHN 231

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G  ++TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W   
Sbjct: 232 GYHHFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-- 289

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                  V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D  
Sbjct: 290 ---SSEPVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD-- 344

Query: 374 EARVLGGGIISGSKRS 389
              V+G   I G+ R+
Sbjct: 345 --LVVGSATICGTDRA 358


>gi|237741734|ref|ZP_04572215.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 4_1_13]
 gi|294785652|ref|ZP_06750940.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 3_1_27]
 gi|229429382|gb|EEO39594.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 4_1_13]
 gi|294487366|gb|EFG34728.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 3_1_27]
          Length = 362

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 205/377 (54%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+ + N  +++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  LEFNSNNSNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HYV D    F+  V+  F + Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYVLDVRNEFKEKVMDYFVNEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIEKDRLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA++MG+ +  K DSQ+ICFV  GK    +     G A + G+IV 
Sbjct: 169 IFPVGDLEKTKLRELAKQMGVRVYSKKDSQEICFVDDGKLKQFLIENTKGEAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG ILG+H G   YTIGQR+GLG++  EPL+V+  DK ++ +IVG  E L    +    
Sbjct: 229 KNGNILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDKKTNNIIVGENEDLFKDELIATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        ++++++   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVSSLES--LDNLECFAKTRSRDILHKCLLKKDENNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY   ++E  V+ GG I
Sbjct: 347 FY---NDEGNVIAGGFI 360


>gi|160944760|ref|ZP_02091987.1| hypothetical protein FAEPRAM212_02275 [Faecalibacterium prausnitzii
           M21/2]
 gi|158443944|gb|EDP20948.1| hypothetical protein FAEPRAM212_02275 [Faecalibacterium prausnitzii
           M21/2]
          Length = 367

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/371 (35%), Positives = 204/371 (54%), Gaps = 13/371 (3%)

Query: 16  KNPKDM-RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL-YNSRKASKRKGSCCAGQDV 73
           +NP +  R ++AMSGGVDSSV A L+++ GYD  G+T++L +N         +CC+ +D+
Sbjct: 4   QNPANRPRALIAMSGGVDSSVAACLMQQAGYDCTGITMRLTHNETLGQSGYQTCCSEKDI 63

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            DA  V   +++ + V D+   FR  +I  F   Y AG TP PC+DCN+ +KF  LL   
Sbjct: 64  EDAAEVAFALDMPYQVLDFTADFRAQIIEKFIRVYEAGGTPNPCIDCNKYMKFRHLLDWA 123

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            + G + + TGHY R      D    R ++ + +D  +DQSY L+  TQ+QL  +R PLG
Sbjct: 124 EEHGMEYVVTGHYARVEQ---DAATGRWLLKKGLDEGKDQSYVLYNLTQEQLAHIRLPLG 180

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K  VR++A+E     A K DSQDICFV  G Y   +++        GD +  +G+++
Sbjct: 181 ALHKTEVREIAQEHSFINAQKHDSQDICFVPDGDYARFMEQFTGKHYPAGDFLDRSGKVV 240

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+G + YT+GQR+GLG+A+G P++V   D  ++ V VGP   L    +Y  ++NW+  
Sbjct: 241 GTHSGAVRYTLGQRKGLGLALGAPVYVCGKDMQANTVTVGPESELFDSIVYAEDVNWIAI 300

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                A+    +   + R  Q      V   ++G  ++F++ +     GQA V Y  D  
Sbjct: 301 ----PALTGPLRVTARTRYHQAEQQATVYPAENGFRLEFDQPQRAPTPGQAAVLYQGDV- 355

Query: 374 EARVLGGGIIS 384
              VLGGG I+
Sbjct: 356 ---VLGGGTIT 363


>gi|266623735|ref|ZP_06116670.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium hathewayi DSM 13479]
 gi|288864455|gb|EFC96753.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium hathewayi DSM 13479]
          Length = 369

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/366 (37%), Positives = 203/366 (55%), Gaps = 16/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS--KRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++   +    +  G CC    V DARRV
Sbjct: 15  KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEETEVQEESGGCCGLSAVDDARRV 74

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV +++E FR  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 75  AWDLGIPYYVMNFKEEFRENVIDYFVDEYRNGRTPNPCIACNRYVKWESLLKRSLDIGAD 134

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY  +R+   ++G  R  +   +   +DQ+Y L+  TQ QL     P+G   K+ 
Sbjct: 135 YIATGHY--ARIEQLENG--RYALKMSVTAAKDQTYALYNLTQYQLAHTLMPVGAYSKDQ 190

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R++A  + L +A K DSQ+ICF+    Y   ++        +G+ V L+G +LGRH GI
Sbjct: 191 IREIADRINLKVAHKPDSQEICFIPDHDYARFIEENTGKEPAKGNFVDLDGNVLGRHEGI 250

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFED 318
            +YT+GQR+GL ++MG P+FV  +   ++ V++G    +    +    INW+  DGL   
Sbjct: 251 THYTVGQRKGLNLSMGHPVFVTEIRPETNEVVIGNSADVFSDTLRCSRINWMAIDGLHGG 310

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
            +    +   KIR S    P  ++   +D V   F++ +  +  GQA VFY     E  V
Sbjct: 311 EM----RVTAKIRYSHKGAPCTIREVGEDLVECRFDEPQRAITPGQAVVFYL----ENYV 362

Query: 378 LGGGII 383
            GGG I
Sbjct: 363 AGGGTI 368


>gi|198282965|ref|YP_002219286.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218666259|ref|YP_002425168.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|259495823|sp|B7J5X6|MNMA_ACIF2 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|259495824|sp|B5ENY8|MNMA_ACIF5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|198247486|gb|ACH83079.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218518472|gb|ACK79058.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 352

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/370 (38%), Positives = 209/370 (56%), Gaps = 22/370 (5%)

Query: 20  DMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRV 79
           D + ++A+SGGVDS+V A L++  GY++ GVT++L+        +  CC  +D+ DA  +
Sbjct: 3   DKKALIALSGGVDSAVAALLMQGQGYELTGVTMRLWP-------RSRCCDEKDIEDAAEI 55

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           C  + + + V DY E FR  V+  F + Y AG TP PC  CN+ +KF  LL+   +LGA 
Sbjct: 56  CARLGIPYTVLDYREAFRRQVVDVFVAEYQAGRTPNPCARCNQFLKFDALLAEGEKLGAT 115

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +LATGHY  +RL     G     + R  D  +DQSYFLFA     L  LRFP+G M K+ 
Sbjct: 116 MLATGHY--ARLAETSSGT---ALLRGRDHAKDQSYFLFAIGAGILSRLRFPVGGMNKDE 170

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI--ALEGDIVHLNGQILGRHN 257
           VR +AR+ GL +A K DSQDICFV  G Y   ++   AG+  A EG++V  +GQ+LG H 
Sbjct: 171 VRAMARKHGLPVAAKQDSQDICFVPDGDYRRFLEDY-AGLDMAQEGEMVDSSGQVLGHHP 229

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           G +++T+GQR+GLG    +P +V+ LD   +RVIVG  + L    + L E NWL D    
Sbjct: 230 GTLHFTVGQRKGLGGGSDQPRYVLALDPAQNRVIVGGEDELYRGVVSLAECNWLTD--LS 287

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARV 377
                     ++ RS  +   + +  +D    + F + +  V  GQA V Y  +    R+
Sbjct: 288 PGETHAVTVKLRYRSRAESAMLHLL-SDARAELRFREPQRAVTPGQAAVCYQGE----RL 342

Query: 378 LGGGIISGSK 387
           LGGG I G++
Sbjct: 343 LGGGWIQGTE 352


>gi|294783011|ref|ZP_06748335.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 1_1_41FAA]
 gi|294479889|gb|EFG27666.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. 1_1_41FAA]
          Length = 362

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/387 (37%), Positives = 211/387 (54%), Gaps = 38/387 (9%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
           V SE ++    D DK  K ++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    + 
Sbjct: 7   VASEFSKYIEFDSDK--KGIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS- 63

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
                        DA++VC  + + HYV D  + F+  V+  F + Y  G TP PC+ CN
Sbjct: 64  -------------DAKKVCGDLGIEHYVLDVRDEFKEKVMDYFVNEYMNGRTPNPCMVCN 110

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLF 178
           R +KF  +L      GA  +ATGHY + +   L VGDD              +DQ YFL 
Sbjct: 111 RHIKFGKMLDFILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLS 158

Query: 179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAG 238
              + +L  + FP+GD++K  +R+LA+++G+ +  K DSQ+ICFV  GK  + +     G
Sbjct: 159 QIQKDRLSKIIFPVGDLEKPKLRELAKQIGVRVYSKKDSQEICFVDDGKLKEFLIENTKG 218

Query: 239 IALE-GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRES 297
            A + G+I+  NG+ILG+H G   YTIGQR+GLG++  EPL+V+  DK+++ +IVG  E 
Sbjct: 219 KAEKPGNIIDKNGKILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDKDNNNIIVGENED 278

Query: 298 LEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV 357
           L    +    +N       E   +D  +CF K RS        +++N D   V F  ++V
Sbjct: 279 LFKDELTATRLNLFSVPSLES--LDNLECFAKTRSRDILHKCVLKKNGDNFQVKFIDNKV 336

Query: 358 -GVASGQACVFYTSDSNEARVLGGGII 383
             +  GQ  VFY +D N   V+ GG I
Sbjct: 337 RAITPGQGIVFYNNDGN---VIAGGFI 360


>gi|239626056|ref|ZP_04669087.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridiales bacterium 1_7_47_FAA]
 gi|239520286|gb|EEQ60152.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridiales bacterium 1_7_47FAA]
          Length = 358

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/367 (38%), Positives = 207/367 (56%), Gaps = 18/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA--SKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK+ GYDVIGVT+Q++        + +G CC    V DARRV
Sbjct: 4   KVVVGMSGGVDSSVAAWLLKQQGYDVIGVTMQIWQDEDTDVQEAEGGCCGLSAVDDARRV 63

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV +++E FR  V+  F   Y AG TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 64  AMDLGIPYYVMNFKEEFRTNVMDYFVGEYVAGRTPNPCIACNRYVKWESLLRRSMAIGAD 123

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY +  +L  G     R  +   +  ++DQ+Y L+  TQ+QL     P+G   K+
Sbjct: 124 YIATGHYAQICQLPSG-----RYALKTSVTAQKDQTYALYNLTQEQLARTLMPVGSYHKD 178

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNG 258
            +R +A ++GL +A K DSQ+ICF+    +   ++        EG+ V L G +LG+H G
Sbjct: 179 EIRRMAEDIGLQVAHKPDSQEICFIPDHDHARFIEAYTGMQVPEGNFVDLEGNVLGKHKG 238

Query: 259 IINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-DGLFE 317
           I +YTIGQR+GL ++MG P+FVV +   ++ V++G  + +  + +   ++NW+  DGL  
Sbjct: 239 ISHYTIGQRKGLNLSMGHPVFVVEIRPETNEVVIGEGKDVFTNVLCCDKLNWMAIDGLHG 298

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +++    +   KIR S    P  ++    G V   F +       GQA VFY  D     
Sbjct: 299 ESM----EVTAKIRYSHKGSPCTIREIGRGLVECRFHEPVRAATPGQAVVFYDGD----Y 350

Query: 377 VLGGGII 383
           V GGG I
Sbjct: 351 VAGGGTI 357


>gi|119486285|ref|ZP_01620344.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lyngbya sp. PCC 8106]
 gi|119456498|gb|EAW37628.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Lyngbya sp. PCC 8106]
          Length = 352

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 207/368 (56%), Gaps = 26/368 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSS  AA+L    Y+V+G+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSAAAAILHHQDYEVVGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLL-SVTRQLGADV 140
            + V H++ D  E F+  ++      Y+AG TPLPC  CN+TVKF  +L     +LG D+
Sbjct: 56  QLGVPHHIVDSRELFQTHIVDYLVEGYSAGITPLPCSQCNKTVKFGPMLRHAKEELGIDL 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+   R  + R +D  +DQSYFL+  TQ  L  + FPLG++ K   
Sbjct: 116 IATGHYARIRY---DEQNNRYQLLRAVDKSKDQSYFLYDLTQDLLAGVVFPLGEVLKTET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           R +A +  L  ADK +SQD+C V+  G     + +   G    GDIV  NG++LG+H GI
Sbjct: 173 RRIAAQYNLKTADKPESQDLCLVEANGSMQAFLDKYITGKT--GDIVDENGKVLGQHEGI 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A   PL+V+ +D   + VIVG RE+       ++ +NW+        
Sbjct: 231 HHYTIGQRKGLGIAAPNPLYVIGIDAGRNLVIVGDRENATQTECIIKRVNWVSIAPPTSP 290

Query: 320 VVDGFKCFVKIRSSQDPVPVFV----QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
           +    +  V+IR    P PV V       D+ V + F++   G+  GQA V+Y  +    
Sbjct: 291 I----RAEVQIRYRTKPQPVTVVPLNSAEDEQVKLIFDEPIFGITPGQAAVWYDGEI--- 343

Query: 376 RVLGGGII 383
            VLGGGII
Sbjct: 344 -VLGGGII 350


>gi|120403098|ref|YP_952927.1| tRNA-specific 2-thiouridylase MnmA [Mycobacterium vanbaalenii
           PYR-1]
 gi|166235070|sp|A1T6X1|MNMA_MYCVP RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|119955916|gb|ABM12921.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Mycobacterium vanbaalenii PYR-1]
          Length = 357

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 155/374 (41%), Positives = 206/374 (55%), Gaps = 24/374 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           MRV+VAMSGGVDSSV AA +   G+DV+GV L L +S   + R GS  CC+ +D  DARR
Sbjct: 1   MRVLVAMSGGVDSSVAAARMVDAGHDVVGVHLAL-SSAPGTLRTGSRGCCSKEDAGDARR 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V D + +  YV+D+ +RF+  VI  F  SYA GETP PCV CN  +KFS L +    LG 
Sbjct: 60  VADVLGIPFYVWDFADRFKEDVIDDFVESYARGETPNPCVRCNERIKFSALSARALALGF 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D LATGHY R       DG+ RR     +D ++DQSY L   T +QL    FP+GD  K 
Sbjct: 120 DALATGHYARLT-----DGRLRRA----VDHDKDQSYVLAVLTAEQLRHAVFPIGDTPKP 170

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHN 257
           ++R+ A   GL +ADK+DS DICF+  G   D    + A I +  G +V   G +L  H+
Sbjct: 171 AIREEAARRGLAVADKADSHDICFIPSG---DTRAFLGARIGVRRGSVVDATGAVLAEHD 227

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G+  +TIGQR+GLG+      G P +V  +D  +  V VG    LEV  + L E      
Sbjct: 228 GVHGFTIGQRKGLGIPGPGPDGRPRYVTGIDAETGTVHVGDVTDLEVTSL-LGEAPVFTS 286

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
           G+  DA V+   C V++R+    V    +  D  + V       GVA GQ  V Y SD +
Sbjct: 287 GVAPDAPVE---CAVQVRAHGGVVDAVAELRDGALEVSLRTPLRGVAPGQTLVLYRSDPD 343

Query: 374 EARVLGGGIISGSK 387
              VLG   IS ++
Sbjct: 344 GDEVLGSATISAAR 357


>gi|167772092|ref|ZP_02444145.1| hypothetical protein ANACOL_03466 [Anaerotruncus colihominis DSM
           17241]
 gi|167665890|gb|EDS10020.1| hypothetical protein ANACOL_03466 [Anaerotruncus colihominis DSM
           17241]
          Length = 349

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 141/362 (38%), Positives = 196/362 (54%), Gaps = 22/362 (6%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V+VAMSGGVDSSV A LLKR GY+V G T +L+N           C   +V DAR VCD 
Sbjct: 5   VLVAMSGGVDSSVAALLLKRQGYEVAGATFELFNG----------CPEGNVRDARAVCDC 54

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + HYVFDY   F+  V+  F  SY  G+TP PCV CNR+VKF   L    +LG   ++
Sbjct: 55  LGIRHYVFDYRALFQKRVLEHFVDSYLTGKTPNPCVACNRSVKFGAFLQDAMRLGYTHIS 114

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY        D    R  + R     +DQSY L+  +Q+QL  L  P+    K+ VR 
Sbjct: 115 TGHYAGVAY---DQTAGRYCLQRSRQTRKDQSYVLYHLSQEQLSRLLLPVDGYTKDEVRA 171

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
            A E GL +  K+DSQDICFV  G Y   ++R     +  G+ +   G+++GRH G+++Y
Sbjct: 172 FAAEAGLPVQAKADSQDICFVPDGDYAAFIERYTGQASEPGNFIDDEGRVIGRHRGVLHY 231

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQRRGLGVA G   +V  LD  ++ V +    S+   ++   ++  +   + E  +  
Sbjct: 232 TIGQRRGLGVAFGTHRYVRRLDPGANTVTLSDESSVFCDQLIADDLRLIAFDVLETPL-- 289

Query: 323 GFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   KIR +  P P  +   D+G ++V F+  +  +  GQA VFY  D    RVLGG 
Sbjct: 290 --RACAKIRYAHTPAPATITMLDEGRIHVRFDTPQRAITPGQAVVFYDDD----RVLGGA 343

Query: 382 II 383
            I
Sbjct: 344 TI 345


>gi|323141806|ref|ZP_08076673.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phascolarctobacterium sp. YIT 12067]
 gi|322413729|gb|EFY04581.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Phascolarctobacterium sp. YIT 12067]
          Length = 357

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 206/364 (56%), Gaps = 13/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           + ++AMSGGVDSSV A ++    Y+  GVT++L+ N      +  SCC+  DV DAR V 
Sbjct: 4   KALIAMSGGVDSSVSALMMLEQDYECTGVTMKLFANEDIGVSKANSCCSIDDVADARSVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
            ++ + +YVF++ +RF   VI  F  +Y  G TP PC+DCNR +KF  L    ++LG D 
Sbjct: 64  TSLGMLYYVFNFADRFERDVIDRFVDAYVNGRTPNPCIDCNRYLKFDQLFVRAQELGCDY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY +      D+ K R ++ + +D  +DQSY L+A TQ+QL    FPLG + K  V
Sbjct: 124 VVTGHYAQISY---DEAKGRYLLRKAVDPLKDQSYVLYALTQEQLAHAMFPLGGLYKTQV 180

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A + G   A K DSQDICF+Q G Y D ++         G+ V   G +LGRH GII
Sbjct: 181 REIAEKHGFVNAQKHDSQDICFIQTGTYADFIEARLGRKFNPGNFVDEAGNVLGRHKGII 240

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YT+GQR+GLG+A+ +P++V  +D  ++ VI+   E L    +  + IN +      DA+
Sbjct: 241 HYTVGQRKGLGLALPQPMYVKEIDTKNNAVILTTNEGLFTKNVTAKNINLID----CDAI 296

Query: 321 VDGFKCFVKIR-SSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            +  +   +IR   Q+      Q + D + + F+  +  +  GQ+ V Y  D     V+G
Sbjct: 297 TEPRRVKARIRYHQQEQWATVTQPDADTLQLVFDDPQRAITKGQSVVMYDGDV----VVG 352

Query: 380 GGII 383
           GG I
Sbjct: 353 GGTI 356


>gi|314923325|gb|EFS87156.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL001PA1]
          Length = 396

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 152/381 (39%), Positives = 215/381 (56%), Gaps = 25/381 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           ++V+ AMSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 31  VKVLAAMSGGVDSAVAAARLVETGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 89

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 90  AADRLGIPFYVWDFSDRFVVEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGY 149

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 150 DAVATGHYARTKVI---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKV 204

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHN 257
           +VR  A  +GL +ADK DS DICF+  G   D    ++  I L +G+I   +G ++G HN
Sbjct: 205 NVRQEAAALGLSVADKPDSNDICFIPDG---DTPGWLSDKIGLADGEIRDESGALVGHHN 261

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G  ++TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I +    W   
Sbjct: 262 GYHHFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEVIRPVWC-- 319

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                  V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D  
Sbjct: 320 ---SGEPVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAVVFYDGD-- 374

Query: 374 EARVLGGGIISGSKRSDAVEE 394
              V+G   I G+ R+    E
Sbjct: 375 --LVVGSATICGTDRAGVKAE 393


>gi|260494072|ref|ZP_05814203.1| tRNA methyl transferase [Fusobacterium sp. 3_1_33]
 gi|260198218|gb|EEW95734.1| tRNA methyl transferase [Fusobacterium sp. 3_1_33]
          Length = 362

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 206/377 (54%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           ++ D + K+++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  IEFDSSKKNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HYV D  + F+  V+  F S Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYVLDVRDEFKKKVVDYFVSEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIQKDRLNKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA ++G+ +  K DSQ+ICFV  GK  + +     G A + G+IV 
Sbjct: 169 IFPVGDLEKSKLRELAEQLGVRVYSKKDSQEICFVDDGKLKEFLIENTKGKAEKTGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            +G ILGRH G   YTIGQR+GLG++  EPL+V+  D+ ++ +IVG  E L    +    
Sbjct: 229 KDGNILGRHKGFSFYTIGQRKGLGISSEEPLYVLAFDRETNNIIVGKNEDLFKDELIATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        ++++ D   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVSSLES--LDNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY   ++E  V+ GG I
Sbjct: 347 FY---NDEGNVIAGGFI 360


>gi|312898012|ref|ZP_07757421.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Megasphaera micronuciformis F0359]
 gi|310620937|gb|EFQ04488.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Megasphaera micronuciformis F0359]
          Length = 358

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/366 (39%), Positives = 200/366 (54%), Gaps = 16/366 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK---GSCCAGQDVYDARRV 79
           + VAMSGGVDSSV A LLK  GY+VIG+TL+L+    A K +    +CC+   V DA+ V
Sbjct: 5   IAVAMSGGVDSSVTAGLLKEQGYEVIGITLRLWEEEPACKVERNIHACCSLDSVNDAKAV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + + HY  D+ + FR+ VI  F  SYA G+TP PC+ CNR +KF  L    +Q GAD
Sbjct: 65  ADVLGIRHYTLDFRDVFRHDVIDYFIDSYAHGKTPNPCIACNRFIKFGLLWDQAQQFGAD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           +LATGHY R    V D+ ++   + R  D  +DQSY L+  TQ  L  + FP+ D++K  
Sbjct: 125 LLATGHYAR---IVYDNERKIYTLRRGKDERKDQSYVLYQLTQDLLKHIIFPMADLEKTK 181

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
            R+LA+E GL + +K +SQDICF+    Y   +K+    I   G      G+ +G H GI
Sbjct: 182 TRELAKEWGLPVFNKPESQDICFIPDNDYKGFLKKEAPYIFKAGRFTDGQGRTVGTHKGI 241

Query: 260 INYTIGQRR-GLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFED 318
             YTIGQRR       G P +VV LD+ ++ V VG    L    I   ++ W      E 
Sbjct: 242 AAYTIGQRRGLNLGGPGGPYYVVSLDEKNNEVRVGSERELFSAEIKAHDVTWT-----ET 296

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
              + FK + KIR +    P  V    + + V F+K +    +GQA V Y  D    RVL
Sbjct: 297 VREEPFKAYGKIRYAAQAAPCTVYPAGNEMKVVFDKPQRAATAGQALVLYEDD----RVL 352

Query: 379 GGGIIS 384
           GGG I+
Sbjct: 353 GGGTIT 358


>gi|256845062|ref|ZP_05550520.1| tRNA methyl transferase [Fusobacterium sp. 3_1_36A2]
 gi|256718621|gb|EEU32176.1| tRNA methyl transferase [Fusobacterium sp. 3_1_36A2]
          Length = 362

 Score =  243 bits (621), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 204/377 (54%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+ + N  +++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  LEFNSNNSNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HYV D    F+  V+  F + Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYVLDVRNEFKEKVMDYFVNEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIEKDRLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA+++G+ +  K DSQ+ICFV  GK    +     G A + G+IV 
Sbjct: 169 IFPVGDLEKTKLRELAKQIGVRVYSKKDSQEICFVDDGKLKQFLIENTKGEAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG ILG+H G   YTIGQR+GLG++  EPL+V+  DK ++ +IVG  E L    +    
Sbjct: 229 KNGNILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDKKTNNIIVGENEDLFKDELIATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        ++++ +   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVSSLES--LDNLECFAKTRSRDILHKCLLKKDGNNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY   +NE  V+ GG I
Sbjct: 347 FY---NNEGNVIAGGFI 360


>gi|153953713|ref|YP_001394478.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium kluyveri DSM 555]
 gi|219854333|ref|YP_002471455.1| hypothetical protein CKR_0990 [Clostridium kluyveri NBRC 12016]
 gi|205813712|sp|A5N749|MNMA_CLOK5 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|146346594|gb|EDK33130.1| TrmU [Clostridium kluyveri DSM 555]
 gi|219568057|dbj|BAH06041.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 356

 Score =  243 bits (620), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 135/364 (37%), Positives = 207/364 (56%), Gaps = 15/364 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASK-RKGSCCAGQDVYDARRVC 80
           +VVV MSGGVDSSV A LLK  GY+VIGVT+Q++      +  +  CC+   V DA+ V 
Sbjct: 4   KVVVGMSGGVDSSVAAHLLKEQGYEVIGVTMQVWQEDDYYEDMESGCCSLSAVEDAKMVA 63

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +N+ HYV +++E F+  VI  F   Y  G+TP PC+ CN+ +KF +LL     LGAD 
Sbjct: 64  YHLNIPHYVMNFKEAFKKNVIDYFIQEYMEGKTPNPCIACNKYIKFDELLKRAMDLGADY 123

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY      + D    R  + +  D  +DQ+Y L+  TQ QL     P G  KKE +
Sbjct: 124 VATGHYATVEK-IND----RYTLRKSKDHNKDQTYALYNLTQFQLAHTLMPCGIYKKEEI 178

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++ARE+GL +  K DS++ICF+    +   +KRI      EG+ +   G +LG+H GI+
Sbjct: 179 REIAREIGLMVHSKRDSEEICFIPDNDHGAYIKRITKDKVKEGNFIDKEGNVLGKHKGIV 238

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YT+GQR+GLG++ G P +V+ +   ++ V++G  E +    +  +++N+L    FE+ +
Sbjct: 239 YYTLGQRKGLGLSFGVPTYVIDIKPYTNEVVLGSEEDIFKTDLVAKDVNFLP---FEN-L 294

Query: 321 VDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
               K   KIR S  P    +   +++ + V F   +  +  GQ+ VFY  +     ++G
Sbjct: 295 TSPMKVEAKIRYSSKPAEATISCLDEERIKVKFTDRQRAITKGQSVVFYKDNI----LIG 350

Query: 380 GGII 383
           GGII
Sbjct: 351 GGII 354


>gi|328907390|gb|EGG27156.1| tRNA-specific 2-thiouridylase MnmA [Propionibacterium sp. P08]
          Length = 366

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 151/381 (39%), Positives = 212/381 (55%), Gaps = 25/381 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           M+V+ AMSGG+DS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 1   MKVLAAMSGGIDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 60  AADRLGIPFYVWDFSDRFAAEVIDPFIAEYQAGRTPNPCLRCNERIKFAALLERGLDLGY 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY ++++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 120 DAVATGHYAQAKVI---DGVTK--LYRSVDPGKDQSYVLAVLDQDQLAHSLFPLGNSLKT 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHN 257
            VR  A  +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++GRHN
Sbjct: 175 DVRQEAAALGLSVADKPDSNDICFIPDG---DTPGWLSEKIGSADGEIRDESGALVGRHN 231

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G   +TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L V+ I      W   
Sbjct: 232 GYHRFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVYHIEAIRPVWC-- 289

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                   D +   V++R+  DPVP  V     GV V+ E    GVA GQA VFY  D  
Sbjct: 290 ---SGEPADTWHGQVQVRAHGDPVPATVSTVPSGVSVELEDPLRGVAPGQAAVFYDGD-- 344

Query: 374 EARVLGGGIISGSKRSDAVEE 394
              V+G   I G+ R+    E
Sbjct: 345 --LVVGSATICGTDRAGTTAE 363


>gi|282853930|ref|ZP_06263267.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes J139]
 gi|282583383|gb|EFB88763.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes J139]
          Length = 366

 Score =  243 bits (620), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 213/376 (56%), Gaps = 25/376 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           M+V+ AMSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 1   MKVLAAMSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 59

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 60  AADRLGIPFYVWDFSDRFVVEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGY 119

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 120 DAVATGHYARTKVI---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKV 174

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHN 257
           +VR  A  +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HN
Sbjct: 175 NVRQEAAALGLSVADKPDSNDICFIPDG---DTPGWLSDKIGSADGEIRDESGALVGHHN 231

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G  ++TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W   
Sbjct: 232 GYHHFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-- 289

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                  V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D  
Sbjct: 290 ---SGEPVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAVVFYDGD-- 344

Query: 374 EARVLGGGIISGSKRS 389
              V+G   I G+ R+
Sbjct: 345 --LVVGSATICGTDRA 358


>gi|163815111|ref|ZP_02206492.1| hypothetical protein COPEUT_01267 [Coprococcus eutactus ATCC 27759]
 gi|158449520|gb|EDP26515.1| hypothetical protein COPEUT_01267 [Coprococcus eutactus ATCC 27759]
          Length = 363

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 144/378 (38%), Positives = 210/378 (55%), Gaps = 19/378 (5%)

Query: 9   LNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGS 66
           +  +D DK      V V MSGGVDSSV A LLK  GY+VIGVT+Q++    R        
Sbjct: 1   MKLIDTDKK----TVCVGMSGGVDSSVAALLLKEQGYNVIGVTMQIWQDEDRDVVSAHAG 56

Query: 67  CCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKF 126
           CC    V DARRV   +++ +YV +++E F+  VI  F   Y  G TP PC+ CNR VK+
Sbjct: 57  CCGLSAVDDARRVASQLDIPYYVMNFKEEFKKYVIDYFVDEYKHGRTPNPCIACNRYVKW 116

Query: 127 SDLLSVTRQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLC 186
             LL+    +G D +ATGHY  +R+    +G+      R +D  +DQ+Y L+  TQ+QL 
Sbjct: 117 ESLLTRCMAIGGDYIATGHY--ARIIQLPNGRYTLQEARGID--KDQTYALYNLTQEQLA 172

Query: 187 DLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIV 246
               P+G+  K  +R +A + GL +A K DSQDICFV  G Y   ++      A+ GD V
Sbjct: 173 RTLMPVGEYSKPEIRKIAEDHGLMVAHKPDSQDICFVPDGDYAGYLENEAGLKAVPGDFV 232

Query: 247 HLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLR 306
            ++G ++GRH GII+YTIGQR+GLG+AMG P+FVV +   +++V++G    +   R+   
Sbjct: 233 DIHGNVIGRHKGIIHYTIGQRKGLGLAMGHPVFVVDIIPETNQVVIGENGDVFSERLTCN 292

Query: 307 EINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQAC 365
            +N++        + +      KIR +       +++ ++D V   F++    V  GQA 
Sbjct: 293 RLNFMSIA----DLTEPMHVKAKIRYNHKGSMCTIRKIDEDLVEAVFDEPVRAVTKGQAV 348

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  D     VLGGG I
Sbjct: 349 VFYECD----HVLGGGSI 362


>gi|313113898|ref|ZP_07799457.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Faecalibacterium cf. prausnitzii KLE1255]
 gi|310623777|gb|EFQ07173.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 367

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 198/364 (54%), Gaps = 12/364 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVC 80
           R ++AMSGGVDSSV A L+++ GYD  G+T++L  N         +CC+ +D+ DA  V 
Sbjct: 11  RALIAMSGGVDSSVAAWLMQQAGYDCTGITMRLTRNETLGQSGFHTCCSEKDIEDAAEVA 70

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +++ + V D+   FR  +I  F   Y AG TP PC+DCN+ +KF  LL   R  G + 
Sbjct: 71  YAMDIPYEVLDFTADFREQIIEKFVRVYEAGGTPNPCIDCNKYMKFRHLLDWARAHGMEY 130

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           + TGHY R      D+   R ++ + +D  +DQSY L+  TQ+QL  +R PLG + K  V
Sbjct: 131 VVTGHYARVEQ---DEATGRFLLKKGLDEGKDQSYVLYNLTQEQLAHIRLPLGGLHKTEV 187

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R++A +     A K DSQDICFV  G Y   ++         GD +  +G+++G HNG +
Sbjct: 188 REIAEQHKFVNARKHDSQDICFVPDGDYARFMEDFTGKHYPAGDFLDESGRVVGPHNGAV 247

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
            YTIGQR+GLG+AMG P++V   D  ++ V VGP E L    +Y  E+NW+        +
Sbjct: 248 RYTIGQRKGLGLAMGAPVYVCGKDMQANTVTVGPEEMLFDRIVYADEVNWIAI----PEL 303

Query: 321 VDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
               +   + R  Q      V   + G  ++F++ +     GQA V Y  D+    VLGG
Sbjct: 304 TGPLRVTARTRYHQVEQAATVYPAECGFRLEFDQPQRAPTPGQAVVLYQGDT----VLGG 359

Query: 381 GIIS 384
           G I+
Sbjct: 360 GTIT 363


>gi|188586399|ref|YP_001917944.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|205816905|sp|B2A5K1|MNMA_NATTJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|179351086|gb|ACB85356.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 368

 Score =  243 bits (619), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 142/367 (38%), Positives = 205/367 (55%), Gaps = 16/367 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY----NSRKASKRKGSCCAGQDVYDAR 77
           RV+VAMSGGVDSSV A +LK  GY+VIG  ++++    +     +    CC+   V+DA+
Sbjct: 6   RVLVAMSGGVDSSVAALMLKEQGYEVIGAHMRIWYREEDEELYEQNVKGCCSLAAVHDAK 65

Query: 78  RVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG 137
           RV D I +  YV +++E F + V+  F   Y  G TP PC+ CNR +K+ + L     L 
Sbjct: 66  RVADKIGIPFYVLNFKEPFYDWVVKNFIDEYLQGRTPNPCIACNRFIKWEEFLKRAMALE 125

Query: 138 ADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKK 197
            D +ATGHY +    V D+ K R ++ R  D  +DQSY L   TQ+QL    FPLGD  K
Sbjct: 126 CDYIATGHYSK---IVYDNLKNRYLLYRGKDKTKDQSYMLSQLTQEQLARTLFPLGDYYK 182

Query: 198 ESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHN 257
           E VR++A +  L +ADK DSQ+ICFV    Y + ++ +       G I+   G  LG H 
Sbjct: 183 EDVRNIAEQNELGVADKPDSQEICFVPNNDYGEFLQSVVPEHINPGPILDAQGNKLGEHK 242

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI  YTIGQRRGLG+++G P++V+ +D +++ +IVG +E L    +   EIN +     E
Sbjct: 243 GIAFYTIGQRRGLGISLGRPVYVIDIDADNNALIVGDKEELYSDGLIAEEINLIPYEQIE 302

Query: 318 DAVVDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +++    +C  KIR +   V   +Q   +D + V F +    V  GQ   FY  D     
Sbjct: 303 NSI--DIEC--KIRYNSRNVSSTLQPYGNDQLLVKFNQPVEAVTPGQGVTFYQDD----L 354

Query: 377 VLGGGII 383
           V+GGG I
Sbjct: 355 VIGGGTI 361


>gi|19704100|ref|NP_603662.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
 gi|81479855|sp|Q8R5X3|MNMA1_FUSNN RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|19714304|gb|AAL94961.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Fusobacterium nucleatum subsp. nucleatum ATCC 25586]
          Length = 362

 Score =  242 bits (618), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 139/377 (36%), Positives = 202/377 (53%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L  D N  ++RV VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  LKFDSNNSNIRVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HY+ D  + F+  V+  F + Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYILDVRDEFKEKVVDYFVNEYMNGRTPNPCMVCNRYIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                 A  +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKDASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIEKNKLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+LA ++G+ +  K DSQ+ICFV  GK    +     G A + G+IV 
Sbjct: 169 IFPVGDLEKTKLRELAEQLGVRVYSKKDSQEICFVDDGKLKQFLIENTKGKAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG ILG+H G   YTIGQR+GLG++  EPL+V+  D+ ++ +IVG  E L    +    
Sbjct: 229 KNGNILGKHKGFSFYTIGQRKGLGISSEEPLYVLAFDRKTNNIIVGQNEDLFRDELIATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       E   +D  +CF K RS        ++++ D   V F  ++V  +  GQ  V
Sbjct: 289 LNLFSVSSLEG--LDNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKVRAITPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY +D N   V+ GG I
Sbjct: 347 FYNNDGN---VIAGGFI 360


>gi|282896191|ref|ZP_06304214.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Raphidiopsis brookii D9]
 gi|281198880|gb|EFA73758.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Raphidiopsis brookii D9]
          Length = 350

 Score =  242 bits (618), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 144/372 (38%), Positives = 205/372 (55%), Gaps = 37/372 (9%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA+L   GYDVIG+TL L       K KG CC+ + + DA  +C 
Sbjct: 4   KVVVGLSGGVDSSVAAAILHNQGYDVIGLTLWLM------KGKGQCCS-EGMVDAATICQ 56

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR-QLGADV 140
            +++ H + D  + F+  ++    S Y+AG TPLPC  CNRTVKF  +L   + +L +D 
Sbjct: 57  QLDIPHEIVDMRDVFQTNIVDYLVSGYSAGITPLPCSQCNRTVKFGPMLQYAKDKLQSDT 116

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R      D    R  + R  D  +DQSYFL+  +Q+ L    FPLG++ K   
Sbjct: 117 IATGHYARIAY---DHRTERYQLLRAFDRNKDQSYFLYDLSQELLAGTIFPLGELNKNDT 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQG--------KYFDVVKRINAGIALEGDIVHLNGQI 252
           R +A E GL  ADK +SQD+C V+          KY              GDIV  +G++
Sbjct: 174 RKIASEYGLKTADKPESQDLCLVESNGSMRAFLDKYLS---------PKPGDIVDSDGKV 224

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           LG+H+G+ +YTIGQR+GLG+A  EPL+V+ LD  ++ V+VG R         +  +NW+ 
Sbjct: 225 LGKHDGVHHYTIGQRKGLGIAAAEPLYVIKLDTVNNLVVVGDRTKGTEKECTVERVNWV- 283

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSD 371
             + E       +  V+IR    PV    +    D V + F++ +  +  GQA V+Y  D
Sbjct: 284 -SMVEPRGT--IRGEVQIRYRSQPVLATIIPGEKDCVQMVFDEPQFSITPGQAAVWYEGD 340

Query: 372 SNEARVLGGGII 383
               +VLGGGII
Sbjct: 341 ----KVLGGGII 348


>gi|313674593|ref|YP_004052589.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Marivirga tractuosa DSM 4126]
 gi|312941291|gb|ADR20481.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Marivirga tractuosa DSM 4126]
          Length = 378

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 210/386 (54%), Gaps = 19/386 (4%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDA 76
           K  RV+VAMSGG+DSS+ A LL   GY+VIG+T++   Y S  +SK++  CC+   + DA
Sbjct: 3   KKGRVLVAMSGGIDSSLAAVLLHEQGYEVIGMTMKTWDYASSGSSKKETGCCSLDSINDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           R +   +   HY+ D  E F + VI  F   Y AG TP PCV CN  +K+  LL    +L
Sbjct: 63  RNLAVNLGFPHYILDIREEFGDYVIDHFTDEYLAGRTPNPCVLCNTHIKWDSLLRRADKL 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
           G D +ATGHY + R   G     R I+ R  DL +DQSY L+  +Q+ L     PLGD+ 
Sbjct: 123 GCDYIATGHYAKVREENG-----RYIISRGKDLNKDQSYALWGVSQESLSRTILPLGDLT 177

Query: 197 KESVRDLAREMGL-DIADKSDSQDICFVQQGKYFDVVKRINAGIALE---GDIVHLNGQI 252
           K  +R +A + G  ++ +KS+S +ICFV    Y   +KR   G+  E   G+ V  +G +
Sbjct: 178 KPEIRKMAEDKGFYELVNKSESYEICFVPDNDYRGFLKRRVEGLEEEVKGGEFVLEDGTV 237

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           +G H G   YT+GQR+GLG+A+G P++V  + K+ +RV++G  + L    +Y++ +    
Sbjct: 238 VGTHEGYPFYTVGQRKGLGIALGYPVYVTEIQKDKNRVVLGTFDELSRDGMYVKNLVMSK 297

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
               ED +        K+R + D  P  +++  D + V F      +A GQA VFY  D 
Sbjct: 298 YTSLEDRL----DTVTKVRYNDDGAPAVIEQVGDTMKVFFGNGVPAIAPGQAAVFYEGDD 353

Query: 373 NEARVLGGGIISGSKRSDAVEESLLS 398
               V+GGG I  S     ++   LS
Sbjct: 354 ----VIGGGWIHSSFNQQKLKNEALS 375


>gi|254416844|ref|ZP_05030593.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Microcoleus chthonoplastes PCC 7420]
 gi|196176390|gb|EDX71405.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Microcoleus chthonoplastes PCC 7420]
          Length = 359

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 147/374 (39%), Positives = 213/374 (56%), Gaps = 25/374 (6%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA L   GY+V+G+TL L       K KG CC+ + + DA  +C+
Sbjct: 8   KVVVGLSGGVDSSVAAATLHHQGYEVVGLTLWLM------KGKGQCCS-EGMVDAAFICE 60

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H++ D  E F+  ++    S Y +G TPLPC  CN+TVKF  +L+  R+ LG D 
Sbjct: 61  QLGIPHHIVDSREVFQANIVDYLVSGYESGITPLPCSQCNKTVKFGPMLAYARETLGIDK 120

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D    R  + R +D  +DQSYFL+  +Q+ L    FPLG+++K   
Sbjct: 121 IATGHYARIRY---DAKSDRYQLLRAVDSNKDQSYFLYDLSQELLAASIFPLGELEKTQT 177

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA-LEGDIVHLNGQILGRHNGI 259
           R LA E  L  A K +SQD+C V+   +  +   ++  I+   GDIV  NG++LG+H GI
Sbjct: 178 RQLAAEYQLKTAAKPESQDLCLVE--SHGSMRTFLDQYISQTTGDIVDTNGKVLGQHQGI 235

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+VV +D  ++RVIVG R S       +  +NW+        
Sbjct: 236 HHYTIGQRKGLGIAAPEPLYVVAIDAGANRVIVGDRASATQPDCTVGRVNWISI----HP 291

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
                +  V++R    PV V V   D + + + F++ +  +  GQA V Y  +     +L
Sbjct: 292 PTTPIQASVQVRYRSHPVDVTVIPLDGNRMKLIFDQPQFSITPGQAAVLYDGE----MLL 347

Query: 379 GGGIISGSKRSDAV 392
           GGGII   +  DAV
Sbjct: 348 GGGII--ERNQDAV 359


>gi|225570688|ref|ZP_03779711.1| hypothetical protein CLOHYLEM_06788 [Clostridium hylemonae DSM
           15053]
 gi|225160515|gb|EEG73134.1| hypothetical protein CLOHYLEM_06788 [Clostridium hylemonae DSM
           15053]
          Length = 361

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 135/369 (36%), Positives = 205/369 (55%), Gaps = 15/369 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNS--RKASKRKGSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++    R   +  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAYLLKEQGYDVIGVTMQIWQEEERAVQEENGGCCGLSAVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV ++ + F+  VI  F   Y  G TP PC+ CNR VK+  LL  +  +GAD
Sbjct: 65  AAQLGIPYYVMNFRQEFKEHVIDYFVDEYTHGRTPNPCIACNRYVKWESLLKRSMDIGAD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R         +R  +     D  +DQ+Y L+  TQ+QL     P+G  +KE 
Sbjct: 125 YIATGHYARIEQL---PNERYALKVSATDT-KDQTYALYNLTQEQLRRTLMPVGMYEKEE 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R +A  +GL++A+K DSQDICFV  G Y   +++     +L G+ V  +G ++G H GI
Sbjct: 181 IRRIAGSLGLEVANKPDSQDICFVPDGDYASYIEKEAGVKSLPGNFVTSDGTVVGTHKGI 240

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           ++YT+GQR+GLG+++G P+FV+ +   ++ ++VG  E      +    +N++  G     
Sbjct: 241 VHYTVGQRKGLGLSLGHPVFVLDIRPGTNEIVVGSNEESMSRYVRADNVNFMSVG----G 296

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
           + +  + + KIR +        ++   D +   F++ +     GQA V Y  +     VL
Sbjct: 297 LPEKKRVWAKIRYNHRGAWCTAEKTGPDEIVCTFDEPQRAATPGQAVVLYDGEY----VL 352

Query: 379 GGGIISGSK 387
           GGG I G +
Sbjct: 353 GGGTIIGDE 361


>gi|268316383|ref|YP_003290102.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Rhodothermus marinus DSM 4252]
 gi|262333917|gb|ACY47714.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Rhodothermus marinus DSM 4252]
          Length = 382

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 141/370 (38%), Positives = 201/370 (54%), Gaps = 20/370 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS---CCAGQDVYDARR 78
           RV+VAMSGGVDSSV AALL   GY+V+G+T++ ++   +  R G    CC+ + + DAR 
Sbjct: 6   RVLVAMSGGVDSSVTAALLHEQGYEVVGITMKTWDYTSSGVRTGKEVGCCSLESMNDARA 65

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
           V   +   H++ D  E F + VI  F   Y AG TP PC+ CN  +K++ LL    +LG 
Sbjct: 66  VAVRLGFPHFIVDIREEFGDWVIERFTEEYLAGRTPNPCILCNTHIKWAALLRRADRLGC 125

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R R    D+   R ++ R  DL +DQSY L+   Q+ L     PLGD  K 
Sbjct: 126 DYIATGHYARIRY---DESLGRYVISRGRDLNKDQSYVLWGIAQEHLARTLLPLGDYTKP 182

Query: 199 SVRDLAREMGLD-IADKSDSQDICFVQQGKYFDVVKRINAGIALE---GDIVHLNGQILG 254
            +R +A EMG + +A K DS +ICF+    Y   +++    +  +   G  V  +G ++G
Sbjct: 183 EIRRMAAEMGFERLAQKPDSYEICFIPDNDYRRFLRQRVPDLDRKVGPGKFVLKDGTVVG 242

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG-D 313
            H G   YTIGQR GLG+A+G P +V ++D  ++ + VGPRE L   R+  R+IN +   
Sbjct: 243 THRGYPFYTIGQRHGLGLALGYPAYVTHIDSETNTITVGPREELLRQRLVARQINLVKYP 302

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
            L E+    G     KIR   +  P  V +  D ++V F +    +  GQA V Y  D  
Sbjct: 303 DLREERPAIG-----KIRYKDEGAPCLVWQEGDALHVAFAEPRPAITPGQAVVLYEGDD- 356

Query: 374 EARVLGGGII 383
              VL GG I
Sbjct: 357 ---VLAGGWI 363


>gi|295104304|emb|CBL01848.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Faecalibacterium prausnitzii SL3/3]
          Length = 367

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 131/371 (35%), Positives = 202/371 (54%), Gaps = 13/371 (3%)

Query: 16  KNPKDM-RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL-YNSRKASKRKGSCCAGQDV 73
           +NP +    ++AMSGGVDSSV A L+++ GYD  G+T++L +N         +CC+ +D+
Sbjct: 4   QNPANRPHALIAMSGGVDSSVAACLMQQAGYDCTGITMRLTHNETLGQSGYQTCCSEKDI 63

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            DA  V   +++ + V D+   FR  +I  F   Y AG TP PC+DCN+ +KF  LL   
Sbjct: 64  EDAAEVAFALDMPYQVLDFTADFRAQIIEKFIRVYEAGGTPNPCIDCNKYMKFRHLLDWA 123

Query: 134 RQLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            + G + + TGHY R      D    R ++ + +D  +DQSY L+  TQ+QL  +R PLG
Sbjct: 124 EEHGMEYVVTGHYARVEQ---DAATGRWLLKKGLDEGKDQSYVLYNLTQEQLAHIRLPLG 180

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQIL 253
            + K  VR +A+E     A K DSQDICFV  G Y   +++        GD +  +G+++
Sbjct: 181 ALHKTEVRKIAQEHSFINAQKHDSQDICFVPDGDYARFMEQFTGKHYPAGDFLDRSGKVV 240

Query: 254 GRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G H+G + YT+GQR+GLG+A+G P++V   D  ++ V VGP   L    +Y  ++NW+  
Sbjct: 241 GTHSGAVRYTLGQRKGLGLALGAPVYVCGKDMQANTVTVGPESELFDRIVYAEDVNWIAI 300

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                A+    +   + R  Q      V   ++G  ++F++ +     GQA V Y  D  
Sbjct: 301 ----PALTGPLRVTARTRYHQAEQQATVYPAENGFRLEFDQPQRAPTPGQAAVLYQGDV- 355

Query: 374 EARVLGGGIIS 384
              VLGGG I+
Sbjct: 356 ---VLGGGTIT 363


>gi|119512160|ref|ZP_01631251.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nodularia spumigena CCY9414]
 gi|119463191|gb|EAW44137.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Nodularia spumigena CCY9414]
          Length = 351

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/364 (39%), Positives = 210/364 (57%), Gaps = 21/364 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSS  AA+L   GY+VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSTAAAILHHQGYEVIGLTLWLM------KGKGQCCS-EGMIDAADICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H V D  E F+  ++    + Y+AG TPLPC  CN+TVKF  ++   R+ L  D 
Sbjct: 56  QLGVPHEVVDIREVFQTQIVDFLVTGYSAGITPLPCSQCNKTVKFGPMVQYAREKLDCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +      D+   R  + R +D  +DQSYFL+  +Q+ L    FPLG + K   
Sbjct: 116 IATGHYAQINY---DEATGRYQLLRAVDRNKDQSYFLYDLSQELLKATVFPLGKLDKADT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ-QGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           R +A E GL  A+K +SQD+C V+  G     + +  A     GDIV + G++LG+H+G+
Sbjct: 173 RRIAAEYGLTTANKPESQDLCLVESNGSMRAFLDKYLA--PKPGDIVDVAGKVLGQHDGV 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YTIGQR+GLG+A  EPL+V+ LD  +++V+VG R         + ++NW+   + E +
Sbjct: 231 HHYTIGQRKGLGIAAAEPLYVIELDAVNNKVVVGDRTKGTQPECTVNQVNWV--SMAEPS 288

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
                +  ++ RSS  PV V    N   V + F++ +  +  GQA V+Y  D    +VLG
Sbjct: 289 TPIRAEVQIRYRSSPTPVTVIPLENSR-VRLVFDEPQFSITPGQAAVWYDGD----KVLG 343

Query: 380 GGII 383
           GGII
Sbjct: 344 GGII 347


>gi|257470341|ref|ZP_05634432.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Fusobacterium ulcerans ATCC 49185]
 gi|317064551|ref|ZP_07929036.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium ulcerans ATCC 49185]
 gi|313690227|gb|EFS27062.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium ulcerans ATCC 49185]
          Length = 359

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 142/378 (37%), Positives = 215/378 (56%), Gaps = 37/378 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L  D+N K   + VAMSGGVDSS VA LLK+ GY+V GVT++              C  +
Sbjct: 12  LQYDENNKSTTIAVAMSGGVDSSTVAYLLKKQGYNVFGVTMK-------------TCKPE 58

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
           D  DA++VCD + + +Y+ D  + F+  V+  F   Y  G+TP PC+ CN+ +K   L+ 
Sbjct: 59  DS-DAKKVCDDLGIPYYLLDVTKEFKEKVMDYFVDEYLKGKTPNPCMVCNKYIKLGLLID 117

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
             R  GAD +ATGHY + +   L +GDD  +            DQ YFL    +  L  L
Sbjct: 118 FARSKGADFMATGHYTQMKDGVLSMGDDAGK------------DQVYFLSQMKKDNLKYL 165

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
           +FP+G+++K  VR+LA+ +G+ +  K DSQ+ICFV+ GK  + +  ++ G A + G+I+ 
Sbjct: 166 KFPIGNLEKPKVRELAQLLGVRVYAKKDSQEICFVEDGKLKEFLMEMSNGKAGKPGNIID 225

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
           +NG++LG+H G+  YTIGQR+GLG+A+  PL+V+ LD   + VIVGP E L  + +    
Sbjct: 226 VNGKVLGKHKGLSFYTIGQRKGLGIALESPLYVIELDSKRNCVIVGPNEMLFKNSLIAES 285

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEV-GVASGQAC 365
           +N +     ED  ++G +C+ K RS        ++    G + V+F +++V  V  GQ  
Sbjct: 286 VNLISVDNIED--LNGIECWAKTRSRDQLHKCKLEVLSSGNIKVNFIENQVRAVTPGQGV 343

Query: 366 VFYTSDSNEARVLGGGII 383
           VFY  D    +VLG G I
Sbjct: 344 VFYDEDH---KVLGSGFI 358


>gi|126656453|ref|ZP_01727714.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. CCY0110]
 gi|126622139|gb|EAZ92846.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. CCY0110]
          Length = 349

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 148/367 (40%), Positives = 204/367 (55%), Gaps = 27/367 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSSV AA L+  GY VIG+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KVVVGLSGGVDSSVAAASLQHQGYTVIGLTLWLM------KGKGQCCS-EGMVDAAFICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + V H++ D  E F   +I    S Y +G TPLPC  CNR VKF  +L+  R+ L  D 
Sbjct: 56  QLGVPHHIVDTRELFEANIINYLVSGYESGVTPLPCSQCNRAVKFGPMLAYAREELNCDR 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D+   R  + R +D  +DQSYFL+  +Q  L    FPLG+  KE  
Sbjct: 116 IATGHYARIRY---DEQMDRYQLLRAIDRNKDQSYFLYDLSQDILKGTIFPLGEQTKEET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQ----QGKYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           R +A E  L  A K +SQD+C ++       + D   +       EG+IV L+G++LG H
Sbjct: 173 RRIAAEFDLKTASKPESQDLCLIEAHGSMASFLDQYIKPK-----EGEIVDLDGKVLGTH 227

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
            GI +YTIGQR+GLG+A  EPL+VV LD   +RVIVG R +       +  +NW+     
Sbjct: 228 QGIHHYTIGQRKGLGIAAPEPLYVVKLDAVMNRVIVGNRAAGGRSDCTVGRLNWVSIAEP 287

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
              +    +  V+ RS    V +    N+  V + F++++ G+  GQA VFY    N   
Sbjct: 288 SSPITAAVQ--VRYRSKAVAVTIIPIENNR-VKLQFDEAQFGITPGQAAVFY----NGEI 340

Query: 377 VLGGGII 383
           VLGGGII
Sbjct: 341 VLGGGII 347


>gi|314966673|gb|EFT10772.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL082PA2]
 gi|314981402|gb|EFT25496.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL110PA3]
 gi|315092068|gb|EFT64044.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL110PA4]
 gi|315103674|gb|EFT75650.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL050PA2]
 gi|327327498|gb|EGE69274.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL103PA1]
          Length = 396

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 151/381 (39%), Positives = 214/381 (56%), Gaps = 25/381 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           ++V+ AMSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR
Sbjct: 31  VKVLAAMSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARR 89

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG 
Sbjct: 90  AADRLGIPFYVWDFSDRFVVEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGY 149

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D +ATGHY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K 
Sbjct: 150 DAVATGHYARTKVI---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKV 204

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHN 257
           +VR  A  +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HN
Sbjct: 205 NVRQEAAALGLSVADKPDSNDICFIPDG---DTPGWLSDKIGSADGEIRDESGALVGHHN 261

Query: 258 GIINYTIGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G  ++TIGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W   
Sbjct: 262 GYHHFTIGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-- 319

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
                  V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D  
Sbjct: 320 ---SGEPVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAVVFYDGD-- 374

Query: 374 EARVLGGGIISGSKRSDAVEE 394
              V+G   I G+ R+    E
Sbjct: 375 --LVVGSATICGTDRAGVKAE 393


>gi|187778511|ref|ZP_02994984.1| hypothetical protein CLOSPO_02106 [Clostridium sporogenes ATCC
           15579]
 gi|187772136|gb|EDU35938.1| hypothetical protein CLOSPO_02106 [Clostridium sporogenes ATCC
           15579]
          Length = 353

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 206/364 (56%), Gaps = 19/364 (5%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V +AMSGGVDSSV A +LK  GYDVIG+ + L+   +        C      DARRV + 
Sbjct: 6   VALAMSGGVDSSVSAYILKERGYDVIGIYMDLWRDEREE-----YCNKSASEDARRVAEK 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +N+  +V + E++F++ VI  F   Y +G TP PCV CN+T+KF    +  ++ GAD +A
Sbjct: 61  LNIPFHVINIEKKFKDNVIDYFIDEYLSGRTPNPCVACNKTIKFEAFFNAAKEFGADFMA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +      ++   R+++ +  D ++DQ+Y ++   Q QL     P G+ KK+ +R+
Sbjct: 121 TGHYCKI-----EERNERKVIVKAEDDKKDQTYMMYNLKQYQLDRTIMPCGEYKKDHIRE 175

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A  +GLD+ +K DSQ+ICF+    +   +KR       EG+ V   G I+G+H GII Y
Sbjct: 176 IAESIGLDVYNKKDSQEICFIPDNDHGGFIKRNYKRKISEGNFVDKEGNIIGKHKGIIYY 235

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P +V+ ++  ++ V++G  E +    +  +++N++     E  +  
Sbjct: 236 TIGQRKGLGIALGKPAYVIDINPITNEVVIGEEEDIFRTELIAKDVNFIPFDKLEKPM-- 293

Query: 323 GFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   K+R S  P     +   ++ V V FE  +  +  GQ+ VFY  D     + GGG
Sbjct: 294 --ELEAKVRYSAKPSKATIIPLENNKVKVVFENKQRAITKGQSVVFYDKDV----LAGGG 347

Query: 382 IISG 385
           II G
Sbjct: 348 IIEG 351


>gi|256027773|ref|ZP_05441607.1| tRNA (5-methylaminomethyl-2-thiouridylate) -methyltransferase
           [Fusobacterium sp. D11]
 gi|289765727|ref|ZP_06525105.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. D11]
 gi|289717282|gb|EFD81294.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium sp. D11]
          Length = 362

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/387 (36%), Positives = 211/387 (54%), Gaps = 38/387 (9%)

Query: 2   VVSEATRLNSLDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKAS 61
           V SE ++   ++ D + ++++V VAMSGGVDSS VA LLK+ GYD+ GVT++ +    + 
Sbjct: 7   VASEFSKY--IEFDSSKRNIKVGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS- 63

Query: 62  KRKGSCCAGQDVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCN 121
                        DA++VCD + + HYV D  + F+  V+  F S Y  G TP PC+ CN
Sbjct: 64  -------------DAKKVCDDLGIEHYVLDVRDEFKKKVVDYFVSEYMNGRTPNPCMVCN 110

Query: 122 RTVKFSDLLSVTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLF 178
           R +KF  +L      GA  +ATGHY + +   L VGDD              +DQ YFL 
Sbjct: 111 RHIKFGKMLDFILSKGASFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLS 158

Query: 179 ATTQQQLCDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAG 238
              + +L  + FP+GD++K  +R+LA ++G+ +  K DSQ+ICFV  GK  + +     G
Sbjct: 159 QIQKDRLNKIIFPVGDLEKSKLRELAEQLGVRVYSKKDSQEICFVDDGKLKEFLIENTKG 218

Query: 239 IALE-GDIVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRES 297
            A + G+IV  +G ILGRH G   YTIGQR+GLG++  EPL+V+  D+ ++ +IVG  E 
Sbjct: 219 KAEKTGNIVDKDGNILGRHKGFSFYTIGQRKGLGISSEEPLYVLAFDRETNNIIVGKNED 278

Query: 298 LEVHRIYLREINWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV 357
           L    +    +N       E   +D  +CF K RS        ++++ D   V F  ++V
Sbjct: 279 LFKDELIATRLNLFLVSSLEG--LDNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKV 336

Query: 358 -GVASGQACVFYTSDSNEARVLGGGII 383
             +  GQ  VFY   ++E  V+ GG I
Sbjct: 337 RAITPGQGIVFY---NDEGNVIAGGFI 360


>gi|160946390|ref|ZP_02093599.1| hypothetical protein PEPMIC_00350 [Parvimonas micra ATCC 33270]
 gi|158447506|gb|EDP24501.1| hypothetical protein PEPMIC_00350 [Parvimonas micra ATCC 33270]
          Length = 350

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/357 (36%), Positives = 200/357 (56%), Gaps = 11/357 (3%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDTINVS 86
           MSGGVDS V   LL ++GY+VIGVT+ L         +  CC+   V DA+ V + + V 
Sbjct: 1   MSGGVDSCVACHLLLKEGYEVIGVTMNLVPKGHLYDEEKGCCSLSSVMDAKIVAEAMGVK 60

Query: 87  HYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATGHY 146
           HY   + E F   VI  F   Y+ G TP PCV CN+ +KF+  +   R L AD ++TGHY
Sbjct: 61  HYTMSFREEFDRKVIENFVREYSLGYTPNPCVACNKYIKFNSFVDKIRPLKADFISTGHY 120

Query: 147 IRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLARE 206
            +      D    R ++ R  D ++DQ+YFL+ T+Q+ L    FPL D++KE VR +A++
Sbjct: 121 AKVEF---DKNYNRYLLKRAKDSKKDQTYFLYNTSQEVLSKTLFPLADLEKEKVRQIAKD 177

Query: 207 MGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTIGQ 266
             +    K DS++ICFVQ   +   +K+ N  +  EG  V  NG  LG+H GI+ YT+GQ
Sbjct: 178 ENILTYSKKDSEEICFVQNRDHGLFIKQRNPELIKEGYFVDENGNKLGKHKGIVYYTVGQ 237

Query: 267 RRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGFKC 326
           R+GLG+A+G+ +FV  ++   + V +   ++L  ++I +RE N++      DA+    + 
Sbjct: 238 RKGLGIALGKRVFVSKINAIDNTVTLSDEDALYKNKIRIREENFIP----FDALEKPLEV 293

Query: 327 FVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGII 383
            VK+R  Q      +   ++ ++V+FEK       GQ+ VFY  D     V+GGGII
Sbjct: 294 SVKVRHGQSETKGLLFYKNNDLFVEFEKQVRAPNKGQSAVFYLDDI----VVGGGII 346


>gi|317133301|ref|YP_004092615.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ethanoligenens harbinense YUAN-3]
 gi|315471280|gb|ADU27884.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ethanoligenens harbinense YUAN-3]
          Length = 363

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/362 (39%), Positives = 203/362 (56%), Gaps = 15/362 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V+ AMSGGVDSSV AALLK  G  VIG+TL ++   +    + SCC+  DV DAR VC+ 
Sbjct: 12  VLAAMSGGVDSSVTAALLKEQGASVIGITLNVWPEEENPCAR-SCCSVTDVDDARAVCNV 70

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + HYV + +  F+  VI  FA+ Y  G TP PC+ CN  VKF+ +L    +  AD +A
Sbjct: 71  LGIPHYVLNTQADFKRGVIDYFAAEYLRGRTPNPCIACNARVKFTAMLRKADEFQADFIA 130

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY R    + D G  R  + R  D  +DQ+Y L+  TQ QL  + FP G  +K  +R 
Sbjct: 131 TGHYAR---ILRDAGGCR--LVRAADARKDQTYVLYMLTQTQLGRILFPCGGYEKPQIRA 185

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA+  GL    K+DSQD+CF+ +G Y   ++   AG+   G+IV  +GQ+LGRH+G+  +
Sbjct: 186 LAKAFGLPTFQKTDSQDLCFIGRGGYTGFLRENCAGLLRPGNIVDESGQVLGRHDGVYRF 245

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQ +GLG    + L+V+ +D   + V VG   +L      +   + +  G  E    D
Sbjct: 246 TIGQHKGLGAFSEKKLYVLSIDAARAEVRVGENAALFAAGALVGGTHRILPGALE----D 301

Query: 323 GFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
           G +   KIR +   VP  +   ++G   + F++ +  V  GQA VFY  D+    VLGGG
Sbjct: 302 GARVQAKIRYNAPAVPATLHTVENGALRLLFDEPQRAVTPGQAAVFYDGDT----VLGGG 357

Query: 382 II 383
            I
Sbjct: 358 TI 359


>gi|260892132|ref|YP_003238229.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ammonifex degensii KC4]
 gi|260864273|gb|ACX51379.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Ammonifex degensii KC4]
          Length = 344

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/363 (38%), Positives = 196/363 (53%), Gaps = 27/363 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV VA+SGGVDS+  A LL + GY+V GVT+                 G++   A  V  
Sbjct: 3   RVAVALSGGVDSATAAFLLLQAGYEVFGVTM--------------LVTGEEGEKAAEVAA 48

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + H+VFD  + F   VI PF  +Y AG TP PCV CNR +KF  LL    +LGAD L
Sbjct: 49  KLKIPHFVFDLRQEFAQEVIKPFVEAYLAGLTPNPCVWCNRKLKFGLLLEKALKLGADFL 108

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY R      D  + R ++ R  D  +DQSYFL++  QQQL  + FPLG   K    
Sbjct: 109 ATGHYARVWF---DPARERYLLARGKDRRKDQSYFLYSLNQQQLARVLFPLGGRTKAENL 165

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            L +++GL +  + +SQD+CF++ G Y +++K +       G I+   G+ +G H G+  
Sbjct: 166 LLVKKLGLPL--REESQDVCFLKGGDYRELIKAMAQEKVKPGPILDPQGKKIGTHRGLAF 223

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQRRGLG A G+P +V+ LD   + +IVGP E L      +  IN++   LFE    
Sbjct: 224 YTIGQRRGLGHAWGKPYYVLALDPRRNALIVGPEEMLYRPSCRVEGINFI---LFERP-P 279

Query: 322 DGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             F   V++R +   VP  +    + V V+F   +  V  GQA VFY  D     V+GGG
Sbjct: 280 GPFTAAVQVRYTSPAVPATLFPEGEAVRVEFASPQRAVTPGQAAVFYQEDL----VVGGG 335

Query: 382 IIS 384
            I+
Sbjct: 336 TIA 338


>gi|86608667|ref|YP_477429.1| tRNA-specific 2-thiouridylase MnmA [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|123502696|sp|Q2JM78|MNMA_SYNJB RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|86557209|gb|ABD02166.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 368

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 199/350 (56%), Gaps = 19/350 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           R+V A+SGGVDSS VAALL+  GY V GVTL L       + KG CC  + + DA  VC+
Sbjct: 19  RIVAALSGGVDSSTVAALLQEQGYAVEGVTLWLM------RGKGQCCT-EGLVDAAAVCE 71

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            + + H+V D  E F+  ++    + YA G TPLPC  CN+ VKF  LL+  R+ LG   
Sbjct: 72  QLGIPHHVVDSRELFQANIVDYLVAGYAEGITPLPCSQCNKLVKFGPLLAYAREKLGISQ 131

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R +  + G+ +  + R +D ++DQSYFL+  +Q+ L    FPLG+  K   
Sbjct: 132 MATGHYARVR-FNAELGRYQ--LLRAVDRQKDQSYFLYDLSQEHLAHSLFPLGEYTKAQT 188

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNGI 259
           R LA   GL  ADK +SQD+C ++   Y  +   ++  +    G+IV   G++LG H GI
Sbjct: 189 RQLAARYGLVTADKPESQDLCLIE--TYGSMRSFLDQYLGQRPGEIVDTQGRVLGSHEGI 246

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            +YT+GQR+GLG+A   PL+VV +D   +RV+VG RE       ++ ++NW+       A
Sbjct: 247 HHYTVGQRKGLGIASSRPLYVVRIDAAMNRVVVGEREEATQAEAWVSQVNWVSI----PA 302

Query: 320 VVDGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFY 368
                   V++R    PVP  V   + + V + F + + GV  GQA V+Y
Sbjct: 303 PTGSLAVEVQVRYRTPPVPAMVIPESPERVKLQFAEPQFGVTPGQAAVWY 352


>gi|54026238|ref|YP_120480.1| tRNA-specific 2-thiouridylase MnmA [Nocardia farcinica IFM 10152]
 gi|81602523|sp|Q5YRS5|MNMA_NOCFA RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|54017746|dbj|BAD59116.1| putative tRNA methyl transferase [Nocardia farcinica IFM 10152]
          Length = 372

 Score =  241 bits (614), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 151/380 (39%), Positives = 209/380 (55%), Gaps = 24/380 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARR 78
           MRV+ AMSGGVDS+V AA     G+DV+GV L L ++   + R GS  CC+ +D  DARR
Sbjct: 2   MRVLAAMSGGVDSAVAAARAVDAGHDVVGVHLAL-SATPGTLRTGSRGCCSKEDAGDARR 60

Query: 79  VCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGA 138
             D + +  YV+D+ +RF+  VI  F ++YAAGETP PC+ CN  +KFS L      LG 
Sbjct: 61  AADVLGIPFYVWDFADRFKEDVIDDFVAAYAAGETPNPCLRCNEKIKFSALADRAVALGF 120

Query: 139 DVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           D + TGHY R       DG    ++ R +D ++DQSY L   T +QL    FP+GD  K 
Sbjct: 121 DAVVTGHYARL-----SDG----VLRRAVDADKDQSYVLAVLTAEQLARAMFPVGDTPKP 171

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHN 257
            +R  A E GL +A+K DS DICF+  G   D    + A I +  G +V  +GQ+L  H 
Sbjct: 172 QIRAEAAERGLAVANKPDSHDICFIPSG---DTRAFLGARIGIRPGAVVDADGQVLAEHE 228

Query: 258 GIINYTIGQRRGLGV----AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGD 313
           G+  +TIGQR+GLG+    A G+P +V  +D  S  V VG  E L+V ++      W   
Sbjct: 229 GVHGFTIGQRKGLGLPGPAADGKPRYVTDIDPASGTVRVGSAEDLQVRQVRAERAVWT-S 287

Query: 314 GLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSN 373
           G   +  +D   C  ++R+     P   +  D G+ V   +   GVA GQA V Y  D  
Sbjct: 288 GRTPEGPID---CVAQVRAHGGTAPATAEAVDGGLVVRLHEPLTGVAKGQAVVLYRPDPL 344

Query: 374 EARVLGGGIISGSKRSDAVE 393
              VLG G ISG+ R+ A++
Sbjct: 345 GDEVLGSGTISGTARTHALD 364


>gi|227832922|ref|YP_002834629.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Corynebacterium aurimucosum ATCC 700975]
 gi|262182589|ref|ZP_06042010.1| tRNA-specific 2-thiouridylase MnmA [Corynebacterium aurimucosum
           ATCC 700975]
 gi|254811450|sp|C3PFT7|MNMA_CORA7 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|227453938|gb|ACP32691.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Corynebacterium aurimucosum ATCC 700975]
          Length = 361

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 152/377 (40%), Positives = 201/377 (53%), Gaps = 26/377 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRV 79
           MRV+VAMSGGVDSSV AA     G+DVIGV L L+   + ++ K   CC+ +D  DARR+
Sbjct: 1   MRVLVAMSGGVDSSVAAARAVEAGHDVIGVHLALHKDAQQTREKARGCCSLEDSADARRI 60

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           CD + +  YV+D+ E F+ AVI  F  SYA GETP PC+ CN  +KF+ LL     LG D
Sbjct: 61  CDKLGIPFYVWDFSEEFKEAVIGDFVDSYARGETPNPCLRCNEKIKFAALLRKGMALGFD 120

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY      +  DG  R    R +D  +DQSY L   T+++L    FP+GD  K  
Sbjct: 121 AVATGHYAT----IDSDGYMR----RSLDENKDQSYVLGVITKEELDHCFFPIGDTPKPQ 172

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNG 258
           +R+ A+  G   A K DS DICF+  G     + R    I L  G IV   G  L  H+G
Sbjct: 173 IREEAKRHGFSTAAKPDSYDICFIPDGNTQAFLGR---SIGLRPGMIVDTEGNELKEHDG 229

Query: 259 IINYTIGQRRGLGV----AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
             NYTIGQR+GL +    A G P +V  +D  +  V VG R  L V  I    + +L   
Sbjct: 230 AWNYTIGQRKGLDIKTPTADGSPRYVTDIDAATGTVTVGSRADLAVTHIEADRLKYLHPA 289

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVP--VFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
           +  D     F C V++R+    VP    V R  D + ++  +   GVA GQA V Y    
Sbjct: 290 MEGD-----FDCEVQVRAHGSVVPCHAHVDREADRMTLELNEPLSGVARGQAAVLYLPSP 344

Query: 373 NEAR--VLGGGIISGSK 387
           +E    VLG G I G++
Sbjct: 345 DELGDIVLGSGTICGTE 361


>gi|45658118|ref|YP_002204.1| tRNA-specific 2-thiouridylase MnmA [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45601360|gb|AAS70841.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
          Length = 366

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 141/376 (37%), Positives = 214/376 (56%), Gaps = 13/376 (3%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDARRVCDTIN 84
           MSGGVDS+V A LL  DGY+VIGV L+   Y +      K SCC+ +D+ DAR V  ++ 
Sbjct: 1   MSGGVDSAVTAGLLMEDGYEVIGVNLRTWEYEAPACDTTKKSCCSPEDIRDARDVGISLK 60

Query: 85  VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG 144
           +  YV   E+ F+  VI  F   Y  G+TP PCV+CN  VKF  L    + LG D +ATG
Sbjct: 61  IPFYVIKMEKVFQEKVIDRFIEDYQHGKTPNPCVECNTFVKFGALFEKAKALGIDKIATG 120

Query: 145 HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLA 204
           HY R    +  +G+R  I    +D+ ++Q+Y+L+  +Q+ L ++ FPLG+M K  VR +A
Sbjct: 121 HYAR----IARNGERYAI-ANGIDVGKNQAYYLYGLSQENLKNVIFPLGEMTKPEVRQIA 175

Query: 205 REMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINYTI 264
           R MGL +ADKS+SQ+ICF+ +  Y   +++ N      G     +G+I+G+H G  N+TI
Sbjct: 176 RRMGLPVADKSESQEICFIPENDYRKFLEKKNVEFT-PGFFKLKDGRIVGKHKGRENFTI 234

Query: 265 GQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVDGF 324
           GQR+GLG+A   PL+V+ ++ + S VI+G           + ++N+ G     +   +  
Sbjct: 235 GQRKGLGIAWKNPLYVISIEDDGS-VILGEENETYNESFSVIDLNFQGLAPLNEG--ESL 291

Query: 325 KCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGGIIS 384
           +C V++R    P+   + +  +G+ V   +   GV  GQ+ VFY  DS+   +L GGIIS
Sbjct: 292 ECRVQVRYRHIPIRCKITKMKEGLIVHPLEDVRGVTPGQSAVFYPLDSD--YLLLGGIIS 349

Query: 385 GSKRSDAVEESLLSVI 400
                  V E  +SV+
Sbjct: 350 KGSIQMRVAEPAISVL 365


>gi|313896558|ref|ZP_07830107.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas sp. oral taxon 137 str. F0430]
 gi|312974743|gb|EFR40209.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 365

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 207/365 (56%), Gaps = 16/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA--SKRKGSCCAGQDVYDARRV 79
           RVVVAMSGGVDSS+ AALL   GYDV+GVT++L N  +    +   SCC+   V DARRV
Sbjct: 9   RVVVAMSGGVDSSLAAALLLAQGYDVVGVTMRLSNENRDVDPENDRSCCSLSSVDDARRV 68

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + + HYV D+   F+ +VI  F   Y  G TP PC+ CNR +KF  LL  + +LGA 
Sbjct: 69  ADVLGIRHYVMDFTMPFQTSVIDYFLDEYLLGRTPNPCIACNRYIKFEGLLHKSAELGAS 128

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +  DG   R+  +  D+++DQSY L+   Q+ L  +  PLGD  K +
Sbjct: 129 HVATGHYAR----IDFDGGMYRLR-KGKDVDKDQSYVLYHLNQETLAHVLLPLGDFDKGT 183

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
            R +A E  L +A K +SQ+ICFV +  Y   +K    G ++ GDIV   G +LG H+GI
Sbjct: 184 TRRMAEEYRLPVAHKPESQEICFVPRDDYKSYMKEKRPGRSVPGDIVDRAGNVLGHHDGI 243

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW-LGDGLFED 318
             YTIGQRRGLG+A  +PL+V  LD   + V+VG  E +    +   +++W + + L E 
Sbjct: 244 SFYTIGQRRGLGIAAPQPLYVTALDAVHNHVVVGTAEEVFARELTASDLSWTMWESLDEV 303

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            +      + K  +    +P+   R    + V F + +  V  GQ+ VFY  D     VL
Sbjct: 304 CMAHAKIRYGKREAEARIMPLDGNR----LRVRFTEPQRAVTPGQSIVFYEGDV----VL 355

Query: 379 GGGII 383
           GGG+I
Sbjct: 356 GGGVI 360


>gi|294793679|ref|ZP_06758816.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella sp. 3_1_44]
 gi|294455249|gb|EFG23621.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella sp. 3_1_44]
          Length = 363

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 202/362 (55%), Gaps = 18/362 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           + VAMSGGVDSS+ AA+L + GY V G+TL L+ S               V DA+++CD 
Sbjct: 15  IAVAMSGGVDSSLTAAMLLKQGYKVFGITLWLWVSGTPYDE-----VPLAVTDAKKMCDF 69

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + H+V D  + F   V+  F   YA G TP PCV CN+ +KF  +L+   +LGA  + 
Sbjct: 70  LGIEHHVIDARDVFYENVVDYFVKEYAYGRTPNPCVFCNKNIKFDLMLNRALELGATHMV 129

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +      ++      + + +D  +DQSY ++   Q+ L  L FPLG   K   R 
Sbjct: 130 TGHYAQVNY---NEKTGLYELHKGVDPTKDQSYVMYNMNQRILSHLMFPLGGQCKTETRK 186

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA E  L +A K DS DICF+  G Y  +V     G    G+IV  +G++LG+HNG+ NY
Sbjct: 187 LAAEYDLPVAKKPDSVDICFLPHGNYQKLVVEEMKGKPESGNIVTEDGEVLGKHNGLFNY 246

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A   PL+V+  + + + VIVGP E L  +R+  +  N+L D + ++   +
Sbjct: 247 TIGQRKGLGIAYKHPLYVIGFNGDRNEVIVGPNEHLFTNRMICKFYNFLDDTIHKELKAE 306

Query: 323 GFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
           G     KIR + +P P   +  +DD + V FE+ +  +  GQ+  FY    N  ++LGG 
Sbjct: 307 G-----KIRYAANPSPCTARILDDDTMEVIFEEPQRAITPGQSVAFY----NGTQLLGGA 357

Query: 382 II 383
           +I
Sbjct: 358 VI 359


>gi|269797937|ref|YP_003311837.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Veillonella parvula DSM 2008]
 gi|282850166|ref|ZP_06259545.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella parvula ATCC 17745]
 gi|269094566|gb|ACZ24557.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyl transferase
           [Veillonella parvula DSM 2008]
 gi|282579659|gb|EFB85063.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella parvula ATCC 17745]
          Length = 353

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 203/362 (56%), Gaps = 18/362 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           + VAMSGGVDSS+ AA+L + GY V G+TL L+ S               V DA+++CD 
Sbjct: 5   IAVAMSGGVDSSLTAAMLLKQGYKVFGITLWLWVSGTPYDE-----VPLAVTDAKKMCDF 59

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + H+V D  + F   V+  F   YA G TP PCV CN+ +KF  +L+   +LGA  + 
Sbjct: 60  LGIEHHVIDARDVFYENVVDYFVKEYAYGRTPNPCVFCNKNIKFDLMLNRALELGATHMV 119

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +   Y  + G     + + +D  +DQSY ++   Q+ L  L FPLG   K   R 
Sbjct: 120 TGHYAQVN-YNEETGLYE--LHKGVDPTKDQSYVMYNMNQRILSHLMFPLGGQCKTETRK 176

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA E  L +A K DS DICF+  G Y  +V     G    G+IV  +G++LG+HNG+ NY
Sbjct: 177 LAAEYDLPVAKKPDSVDICFLPHGNYQKLVVEEMKGKPESGNIVTEDGEVLGKHNGLFNY 236

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A   PL+V+  + + + VIVGP E L  +R+  +  N+L D + ++   +
Sbjct: 237 TIGQRKGLGIAYKHPLYVIGFNGDRNEVIVGPNERLFTNRMICKFYNFLDDTIHKELKAE 296

Query: 323 GFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
           G     KIR + +P P   +  +DD + V FE+ +  +  GQ+  FY    N  ++LGG 
Sbjct: 297 G-----KIRYAANPSPCTARILDDDTMEVIFEEPQRAITPGQSVAFY----NGTQLLGGA 347

Query: 382 II 383
           +I
Sbjct: 348 VI 349


>gi|294791818|ref|ZP_06756966.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella sp. 6_1_27]
 gi|294457048|gb|EFG25410.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella sp. 6_1_27]
          Length = 363

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 202/362 (55%), Gaps = 18/362 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           + VAMSGGVDSS+ AA+L + GY V G+TL L+ S               V DA+++CD 
Sbjct: 15  IAVAMSGGVDSSLTAAMLLKQGYKVFGITLWLWVSGTPYDE-----VPLAVTDAKKMCDF 69

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + H+V D  + F   V+  F   YA G TP PCV CN+ +KF  +L+   +LGA  + 
Sbjct: 70  LGIEHHVIDARDVFYENVVDYFVKEYAYGRTPNPCVFCNKNIKFDLMLNRALELGATHMV 129

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +      ++      + + +D  +DQSY ++   Q+ L  L FPLG   K   R 
Sbjct: 130 TGHYAQVNY---NEKTGLYELHKGVDPTKDQSYVMYNMNQRILSHLMFPLGGQCKTETRK 186

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA E  L +A K DS DICF+  G Y  +V     G    G+IV  +G++LG+HNG+ NY
Sbjct: 187 LAAEYDLPVAKKPDSVDICFLPHGNYQKLVVEEMKGKPESGNIVTEDGEVLGKHNGLFNY 246

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A   PL+V+  + + + VIVGP E L  +R+  +  N+L D + ++   +
Sbjct: 247 TIGQRKGLGIAYKHPLYVIGFNGDRNEVIVGPNEHLFTNRMICKFYNFLDDTIHKELKAE 306

Query: 323 GFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
           G     KIR + +P P   +  +DD + V FE+ +  +  GQ+  FY    N  ++LGG 
Sbjct: 307 G-----KIRYAANPSPCTARILDDDTMEVIFEEPQRAITPGQSVAFY----NGTQLLGGA 357

Query: 382 II 383
           +I
Sbjct: 358 VI 359


>gi|320529055|ref|ZP_08030147.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas artemidis F0399]
 gi|320138685|gb|EFW30575.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Selenomonas artemidis F0399]
          Length = 361

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 148/365 (40%), Positives = 207/365 (56%), Gaps = 16/365 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKA--SKRKGSCCAGQDVYDARRV 79
           RVVVAMSGGVDSS+ AALL   GYDV+GVT++L N  +    +   SCC+   V DARRV
Sbjct: 5   RVVVAMSGGVDSSLAAALLLAQGYDVVGVTMRLSNENRDVDPENDRSCCSLSSVDDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + + HYV D+   F+ +VI  F   Y  G TP PC+ CNR +KF  LL  + +LGA 
Sbjct: 65  ADVLGIRHYVMDFTMPFQTSVIDYFLDEYLLGRTPNPCIACNRYIKFEGLLHKSAELGAS 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +  DG   R+  +  D+++DQSY L+   Q+ L  +  PLGD  K +
Sbjct: 125 HVATGHYAR----IDFDGGMYRLR-KGKDVDKDQSYVLYHLNQETLAHVLLPLGDFDKGT 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
            R +A E  L +A K +SQ+ICFV +  Y   +K    G ++ GDIV   G +LG H+GI
Sbjct: 180 TRRMAEEYRLPVAHKPESQEICFVPRDDYKSYMKEKRPGRSVPGDIVDRAGNVLGHHDGI 239

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW-LGDGLFED 318
             YTIGQRRGLG+A  +PL+V  LD   + V+VG  E +    +   +++W + + L E 
Sbjct: 240 SFYTIGQRRGLGIAAPQPLYVTALDAVHNHVVVGTAEEVFARELTASDLSWTMWESLDEV 299

Query: 319 AVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
            +      + K  +    +P+   R    + V F + +  V  GQ+ VFY  D     VL
Sbjct: 300 RMAHAKIRYGKREAEARIMPLDGNR----LRVRFTEPQRAVTPGQSIVFYEGDV----VL 351

Query: 379 GGGII 383
           GGG+I
Sbjct: 352 GGGVI 356


>gi|237738505|ref|ZP_04568986.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium mortiferum ATCC 9817]
 gi|229420385|gb|EEO35432.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium mortiferum ATCC 9817]
          Length = 357

 Score =  240 bits (612), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 141/375 (37%), Positives = 215/375 (57%), Gaps = 37/375 (9%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
           D+  K++++ VAMSGGVDSS VA +LK+ GYD+IG+T++              C  +D  
Sbjct: 13  DEKNKNIKIAVAMSGGVDSSTVAYILKKQGYDLIGITMR-------------TCNPED-E 58

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA++VC+ + + HYV D  + F+  V+  F   Y  G+TP PC+ CN+ +KF  L+   R
Sbjct: 59  DAKKVCEDLGIPHYVLDATKEFKTKVMDYFIEEYLQGKTPNPCMVCNKHIKFGMLIDFAR 118

Query: 135 QLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFP 191
             GAD +ATGHY + +   L +GDD              +DQ YFL    ++ L  L FP
Sbjct: 119 SKGADFMATGHYTQLKDGVLSMGDDP------------NKDQVYFLSQINKENLKYLMFP 166

Query: 192 LGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIA-LEGDIVHLNG 250
           +GD++K  VR+LA ++G+ +  K DSQ+ICFV+ GK  + +     G A  +G+IV  +G
Sbjct: 167 IGDLEKPKVRELAEQLGVRVYAKKDSQEICFVEDGKLKEFLLENTKGRAGKKGNIVTTDG 226

Query: 251 QILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINW 310
           ++LG+HNG+  YTIGQR+GLG++  +PL+V+ LD  ++ VIVG  E L    +    +N 
Sbjct: 227 KVLGKHNGLAFYTIGQRKGLGISQEKPLYVIELDSKNNNVIVGDNEQLFKGELIAENVNL 286

Query: 311 LGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEV-GVASGQACVFY 368
           +     E+  ++G  C+ K RS        ++  ++G V V F + +V  V  GQ  VFY
Sbjct: 287 ISFDRLEE--LNGVVCWAKTRSRDKLHKCQLEVLENGNVKVRFIEDKVRAVTPGQGVVFY 344

Query: 369 TSDSNEARVLGGGII 383
              + E +VLG G I
Sbjct: 345 ---NEEKKVLGSGFI 356


>gi|254303789|ref|ZP_04971147.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
 gi|148323981|gb|EDK89231.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Fusobacterium nucleatum subsp. polymorphum ATCC 10953]
          Length = 362

 Score =  240 bits (612), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 138/377 (36%), Positives = 203/377 (53%), Gaps = 36/377 (9%)

Query: 12  LDLDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQ 71
           L+ D N  ++R+ VAMSGGVDSS VA LLK+ GYD+ GVT++ +    +           
Sbjct: 15  LEFDSNNSNIRIGVAMSGGVDSSTVAYLLKQQGYDIFGVTMKTFKDEDS----------- 63

Query: 72  DVYDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS 131
              DA++VCD + + HYV D  + F+  V+  F   Y  G TP PC+ CNR +KF  +L 
Sbjct: 64  ---DAKKVCDDLGIEHYVLDVRDEFKEKVMDYFVDEYMNGRTPNPCMVCNRHIKFGKMLD 120

Query: 132 VTRQLGADVLATGHYIRSR---LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDL 188
                GA+ +ATGHY + +   L VGDD              +DQ YFL    + +L  +
Sbjct: 121 FILSKGANFMATGHYTKLKNGLLSVGDDS------------NKDQVYFLSQIEKDRLSKI 168

Query: 189 RFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVH 247
            FP+GD++K  +R+ A++MG+ +  K DSQ+ICFV  GK    +     G A + G+IV 
Sbjct: 169 IFPVGDLEKPKLREFAQQMGVRVYSKKDSQEICFVDDGKLKQFLIENTKGKAEKPGNIVD 228

Query: 248 LNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLRE 307
            NG ILG+H G   YTIGQR+GLG++  EPL+V+  D+ ++ +IVG  + L    +    
Sbjct: 229 KNGNILGKHRGFSFYTIGQRKGLGISSEEPLYVLAFDRETNNIIVGENKDLFKDELTATR 288

Query: 308 INWLGDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEV-GVASGQACV 366
           +N       +   +D  +CF K RS        ++++ D   V F  ++V  V  GQ  V
Sbjct: 289 LNLFSVSSLDS--LDNLECFAKTRSRDILHKCLLKKDGDNFQVKFIDNKVRAVTPGQGIV 346

Query: 367 FYTSDSNEARVLGGGII 383
           FY  + N   V+ GG I
Sbjct: 347 FYNIEGN---VIAGGFI 360


>gi|195952741|ref|YP_002121031.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hydrogenobaculum sp. Y04AAS1]
 gi|226704772|sp|B4U7E2|MNMA_HYDS0 RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|195932353|gb|ACG57053.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Hydrogenobaculum sp. Y04AAS1]
          Length = 342

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 149/368 (40%), Positives = 210/368 (57%), Gaps = 30/368 (8%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           M + V MSGGVDSSV A LLK  G+DVIGVTL+ Y   +  +    CC+ +DV DAR VC
Sbjct: 1   MIIAVGMSGGVDSSVAAYLLKEQGHDVIGVTLRFY-KEECKENARVCCSPKDVQDARIVC 59

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLG-AD 139
           D + + H   D+E  F+  VI  F  SY  G TP PC  CN+ VK + L    +Q    D
Sbjct: 60  DMLGIPHITLDWENLFKERVIDYFIKSYKTGLTPNPCAICNKDVKTAFLGFYLKQTADID 119

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            LATGHY+     + ++GK +R        E+DQSYF+    +Q L  L FP+G M K+ 
Sbjct: 120 FLATGHYV-----IKEEGKIKRAK------EKDQSYFMALVPKQSLDYLMFPVGYMTKQE 168

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQ-ILGRHN 257
           +RD+A+++ L +A+K +SQD+CF+   K  D+   ++  I + +GDIVH+  Q  LG+H 
Sbjct: 169 IRDIAKKINLPVANKIESQDVCFL---KGMDLEDYLSQFIDMTQGDIVHIATQKTLGKHK 225

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GI  YTIGQR GLGV+  +PL+VV  D   + + VG +E L    I L++ N L D  FE
Sbjct: 226 GIHRYTIGQRHGLGVSYHKPLYVVEKDIEKNILYVGEKEYLLKDAITLKDYNKLED--FE 283

Query: 318 DAVVDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
                    +++IR +  P+P+  ++ N D V +  ++    VA GQ    Y  D     
Sbjct: 284 KD-----NMYIQIRYNSKPIPIKHIEENKDNVIIFLKEPATQVAKGQVGAIYFGDI---- 334

Query: 377 VLGGGIIS 384
           +LGGGIIS
Sbjct: 335 LLGGGIIS 342


>gi|154484582|ref|ZP_02027030.1| hypothetical protein EUBVEN_02298 [Eubacterium ventriosum ATCC
           27560]
 gi|149734430|gb|EDM50347.1| hypothetical protein EUBVEN_02298 [Eubacterium ventriosum ATCC
           27560]
          Length = 358

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 134/366 (36%), Positives = 200/366 (54%), Gaps = 15/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSR--KASKRKGSCCAGQDVYDARRV 79
           + ++AMSGGVDSSV A  +K  GYD IGVT++LY++     SK K +CC+  DV DAR V
Sbjct: 3   KALIAMSGGVDSSVAAVFMKEKGYDPIGVTMKLYDNEDINMSKEK-TCCSLSDVEDARSV 61

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +   +YVF+++  F+  VI  F   Y  G TP PC+DCNR +KF +L    + LG D
Sbjct: 62  AYKVGFPYYVFNFKAEFKEKVIDKFVGCYMCGMTPNPCIDCNRYLKFEELYRRAKALGCD 121

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
           V+ TGHY R R    D+   +  + + +D  +DQSY L+  TQ+QL    FPLG+  K+ 
Sbjct: 122 VIVTGHYARIRF---DEATGKYQLMKGIDDSKDQSYVLYHMTQEQLAHTMFPLGEYTKDE 178

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           +R  A E GL  ADK DSQDICF+  G +   ++        +G+ + +NG+++G+HNG 
Sbjct: 179 IRKKAAETGLINADKHDSQDICFIPDGNHMKFIEEYTHKKVGKGNFLDINGKVIGQHNGY 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
             YT+GQR+G+ V      +V+ +   ++ V+VG  + L    +   + NW+      +A
Sbjct: 239 YRYTVGQRKGINVNRDGKHYVLEIRPETNEVVVGRNKDLFTEELVATDFNWISG----EA 294

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDG-VYVDFEKSEVGVASGQACVFYTSDSNEARVL 378
                K   + R  Q       +  ++G V V F++    +  GQ+ V Y  D     VL
Sbjct: 295 PTGEIKVSGRTRYHQPLTEGVAKVLENGDVKVSFDEPIRAITKGQSVVLYDGDV----VL 350

Query: 379 GGGIIS 384
           GGG I 
Sbjct: 351 GGGTIK 356


>gi|72382697|ref|YP_292052.1| tRNA-specific 2-thiouridylase MnmA [Prochlorococcus marinus str.
           NATL2A]
 gi|123620903|sp|Q46JH9|MNMA_PROMT RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|72002547|gb|AAZ58349.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Prochlorococcus marinus str. NATL2A]
          Length = 388

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 148/380 (38%), Positives = 211/380 (55%), Gaps = 35/380 (9%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           VVV +SGGVDSS+ AALL + G+DV G+TL L       K KGSCC+   + DA  +CD 
Sbjct: 23  VVVGLSGGVDSSLTAALLCKAGWDVEGLTLWLM------KGKGSCCS-DGLVDAAGICDQ 75

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLS-VTRQLGADVL 141
           + + H++ D +E F+  +I      Y  G TPLPC  CN++VKFS++L  V      + +
Sbjct: 76  LGIKHHIVDSKEIFQKEIINNVLKGYEEGITPLPCSRCNKSVKFSEMLKWVKENKNIEKI 135

Query: 142 ATGHYIRSRLY--------VGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
           ATGHY R R          +  DG +R  + R  DL +DQSYFL+   Q+ L    FPLG
Sbjct: 136 ATGHYARIRYSNESFNENDLPSDGIKRHKLLRGKDLNKDQSYFLYDLPQEILGKTIFPLG 195

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQI 252
           ++ KE  R  A +  L  A K +SQD+C  +   Y  +   I+  +  + G++V  NGQI
Sbjct: 196 ELTKEITRIEALKHSLKTAKKPESQDLCLAEH--YGSMNAFIDKYLPQKKGEVVLKNGQI 253

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           +G HNGI ++TIGQR+GLG+A   PL VV +D + +RVIV PRE        +++INW+ 
Sbjct: 254 IGSHNGIQHFTIGQRKGLGIAWEVPLHVVEIDASLNRVIVAPREDSGKSECIVKDINWVS 313

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDP-----VPVFVQRNDDGVY---VDFEKSEVGVASGQA 364
                +A  +  +  V+IR          +P+F    ++  Y   + FEK +  +  GQA
Sbjct: 314 I----EAPQEPIEVEVQIRYRSKAMKAKLIPIFDSNKENYCYKCNIHFEKDQFSITPGQA 369

Query: 365 CVFYTSDSNEARVLGGGIIS 384
            VFY  D     VLGGG+IS
Sbjct: 370 AVFYKGD----YVLGGGLIS 385


>gi|297565299|ref|YP_003684271.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Meiothermus silvanus DSM 9946]
 gi|296849748|gb|ADH62763.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Meiothermus silvanus DSM 9946]
          Length = 371

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 145/369 (39%), Positives = 205/369 (55%), Gaps = 31/369 (8%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV+VAMSGGVDSSV AALLK  GY+VIG  ++ +   K      +CC+    Y+ARRV D
Sbjct: 7   RVLVAMSGGVDSSVSAALLKAQGYEVIGAMMRFWPDNKKDDCFETCCSPDAAYEARRVAD 66

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + V  Y+ DY E F+  +I PF + YAAGETP PCV+CN  VKF  LL   R LG D +
Sbjct: 67  IVGVPFYLLDYREEFQEKIIDPFIAGYAAGETPNPCVNCNTRVKFDSLLKKARMLGCDFV 126

Query: 142 ATGHYI---RSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
           ATGHY+    + L+ GD              ++DQ+YFL+ T ++ +  + FP+G ++K 
Sbjct: 127 ATGHYVIREGNALFRGDP-------------KKDQTYFLWGTPKEAIPHMMFPVGHLEKP 173

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQILGRHN 257
            VR +A + GL  A K +SQ+ICFV QG   + +   N   A  G +V L  G+++G H 
Sbjct: 174 QVRAIAEQYGLPTAKKPESQNICFV-QGDLKEFLS--NHLTARPGPLVDLETGEVIGEHA 230

Query: 258 GIINYTIGQRRGLGVAMGE-PLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           G   YT+GQ++GLG+       +VV ++  ++ VIVGPRE+     +  RE+N     L 
Sbjct: 231 GAQFYTVGQKKGLGLFKTHLERYVVRVNPATNEVIVGPREACLWSGLEAREVN-----LL 285

Query: 317 EDAVVDGFKCFVKIRSSQDPVPVFVQR-NDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
            +         V++R    PV   V+R  D G+ V   + +  V  GQ+ V Y  D    
Sbjct: 286 VEPEELPETLEVQVRYRTKPVLGKVERLGDGGMTVRLAEPQFAVTPGQSMVLYQGD---- 341

Query: 376 RVLGGGIIS 384
           R+LGGG I 
Sbjct: 342 RLLGGGFIQ 350


>gi|311740584|ref|ZP_07714411.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Corynebacterium pseudogenitalium ATCC 33035]
 gi|311304104|gb|EFQ80180.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Corynebacterium pseudogenitalium ATCC 33035]
          Length = 365

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 151/376 (40%), Positives = 203/376 (53%), Gaps = 26/376 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRV 79
           MRV+VAMSGGVDSSV AA     G++VIGV L L+   + ++ K   CC+ +D  DARR+
Sbjct: 5   MRVLVAMSGGVDSSVAAARAVEAGHEVIGVHLALHKDAQQTREKARGCCSLEDSADARRI 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           CD + +  YV+D+ E F+  VI  F  SYA GETP PC+ CN  +KF  LL     LG D
Sbjct: 65  CDKLGIPFYVWDFSEEFKEEVITDFVDSYARGETPNPCLRCNEKIKFRALLQKGMALGFD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY      +  DG  R    R +D ++DQSY L   + ++L    FP+GD  K  
Sbjct: 125 AVATGHYAT----IDKDGYMR----RSLDEKKDQSYVLGVISAEELEHCFFPIGDTPKPQ 176

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQILGRHNG 258
           +R+ A   G   A K DS DICF+  G   +    + A I L  G IV   G  L  H+G
Sbjct: 177 IREEAAAHGFSTAKKPDSYDICFIPDG---NTQAFLGARIGLRPGMIVDQEGTELKEHDG 233

Query: 259 IINYTIGQRRGLGV----AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
             NYTIGQR+GL +    A G P +V  +D  +  V VG RE L V  I    + +L  G
Sbjct: 234 AWNYTIGQRKGLDIKAPAADGRPRYVTDIDAVTGTVTVGAREDLAVTSIQADRLKYLHPG 293

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVP--VFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
           +  D     F+C V++R+    VP    V R  D + ++ ++S  GVA GQA V Y    
Sbjct: 294 MDGD-----FECEVQVRAHGSVVPCTAHVDREADEMRLELKESLSGVARGQAAVLYLPSP 348

Query: 373 NEAR--VLGGGIISGS 386
           +E    V+G G I G+
Sbjct: 349 DELGDIVIGSGTICGT 364


>gi|170755772|ref|YP_001782543.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum B1 str. Okra]
 gi|205810298|sp|B1ILH4|MNMA1_CLOBK RecName: Full=tRNA-specific 2-thiouridylase mnmA 1
 gi|169120984|gb|ACA44820.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum B1 str. Okra]
          Length = 353

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 206/363 (56%), Gaps = 19/363 (5%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V +AMSGGVDSSV A +LK  GYDVIG+ + L+   +        C      DARRV + 
Sbjct: 6   VALAMSGGVDSSVSAYILKERGYDVIGIYMDLWRDEREE-----YCNKSAAEDARRVAEK 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +++  +V + E++F++ VI  F   Y +G TP PCV CNRT+KF    +  ++ GAD +A
Sbjct: 61  LDIPFHVINIEKKFKDNVIDYFIDEYLSGRTPNPCVACNRTIKFEAFFNAAKEFGADFMA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +     G     R+++ +  D ++DQ+Y ++   Q QL     P G+ KK+ +R+
Sbjct: 121 TGHYCKIEERNG-----RKVIVKAEDDKKDQTYMMYNLKQYQLERTIMPCGEYKKDYIRE 175

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A  +GLD+ +K DSQ+ICF+    +   +KR       EG+ V   G I+G+H GII Y
Sbjct: 176 IAENIGLDVYNKKDSQEICFIPDNDHGGFIKRNYKSKVSEGNFVDKKGNIIGKHKGIIYY 235

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P +V+ ++  ++ V++G  E +    +  R++N++     E ++  
Sbjct: 236 TIGQRKGLGIALGKPAYVIDINPITNEVVIGDEEDIFRTELIARDVNFIPFDKLEKSM-- 293

Query: 323 GFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   K+R S  P     +   ++ V V F+  +  +  GQ+ VFY  D     ++GGG
Sbjct: 294 --ELEAKVRYSAKPSKATIIPLENNKVKVVFQNKQRAITKGQSVVFYDKDM----LVGGG 347

Query: 382 IIS 384
           II 
Sbjct: 348 IIE 350


>gi|153939777|ref|YP_001392187.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. Langeland]
 gi|205810589|sp|A7GHC7|MNMA2_CLOBL RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|152935673|gb|ABS41171.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. Langeland]
 gi|295320186|gb|ADG00564.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum F str. 230613]
          Length = 353

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 205/364 (56%), Gaps = 19/364 (5%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V +AMSGGVDSSV A +LK  GYDVIG+ + L+   +        C      DARRV + 
Sbjct: 6   VALAMSGGVDSSVSAYILKERGYDVIGIYMDLWRDEREE-----YCNKSAAEDARRVAEK 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +++  +V + E++F+N VI  F   Y +G TP PCV CN+T+KF    +  ++ GAD +A
Sbjct: 61  LDIPFHVINIEKKFKNNVIDYFIDEYLSGRTPNPCVACNKTIKFEAFFNAAKEFGADFMA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +     G     R+++ +  D ++DQ+Y ++   Q QL     P G+ KK+ +R+
Sbjct: 121 TGHYCKIEERNG-----RKVIVKAEDDKKDQTYMMYNLKQYQLERTIMPCGEYKKDHIRE 175

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A  +GLD+ +K DSQ+ICF+    +   +KR       EG+ V   G I+G+H GII Y
Sbjct: 176 IAESIGLDVYNKKDSQEICFIPDNDHGGFIKRNYKRKISEGNFVDKEGNIIGKHKGIIYY 235

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P +V+ ++  ++ V++G  E +    +  +++N++     E  +  
Sbjct: 236 TIGQRKGLGIALGKPAYVIDINPITNEVVIGEEEDIFRTELIAKDVNFIPFDKLEKPM-- 293

Query: 323 GFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   K+R S  P     +   ++ V V F+  +  +  GQ+ VFY  D     + GGG
Sbjct: 294 --ELEAKVRYSAKPSKATIIPLENNKVKVVFQNKQRAITKGQSVVFYDKDI----LAGGG 347

Query: 382 IISG 385
           II G
Sbjct: 348 IIEG 351


>gi|116328677|ref|YP_798397.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116330666|ref|YP_800384.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
 gi|122281579|sp|Q04TZ4|MNMA_LEPBJ RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|122283538|sp|Q04ZN1|MNMA_LEPBL RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|116121421|gb|ABJ79464.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Leptospira borgpetersenii serovar Hardjo-bovis L550]
 gi|116124355|gb|ABJ75626.1| tRNA (5-methylaminomethyl-2-thiouridylate)- methyltransferase
           [Leptospira borgpetersenii serovar Hardjo-bovis JB197]
          Length = 377

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 140/380 (36%), Positives = 222/380 (58%), Gaps = 13/380 (3%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDARRV 79
           +++VAMSGGVDS+V A LL  +GY+VIGV L+   Y +      K SCC+ +D+ DAR V
Sbjct: 5   KIIVAMSGGVDSAVTAGLLMEEGYEVIGVNLRTWEYEAPVCDTTKKSCCSPEDIRDARDV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
             ++ +  YV   E+ F+  VI  F   Y  G+TP PCV+CN  VKF  L    + LG D
Sbjct: 65  GLSLKIPFYVVKMEKVFQEKVIDRFIDDYQHGKTPNPCVECNTFVKFGALFEKAKALGID 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY R    +  +G+R  I    +D+ ++Q+Y+L+  +Q+ L ++ FPLG M K  
Sbjct: 125 KIATGHYAR----IVRNGERYAI-SNGVDIGKNQAYYLYGLSQENLKNVTFPLGGMTKPE 179

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGI 259
           VR++AR MGL +ADK++SQ+ICF+ +  Y   +++ +      G     +G+I+G+H G 
Sbjct: 180 VREIARRMGLSVADKAESQEICFIPENDYRKFLEKKHVEFT-PGFFKLRDGRIIGKHKGR 238

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            N+TIGQR+GLG+A   PL+V+ ++ + S VI+G           + ++N+ G     + 
Sbjct: 239 ENFTIGQRKGLGIAWRNPLYVIAIEDDGS-VILGEENETYAESFSVIDVNYQGFAPLGEG 297

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
             + F+C V++R    P+   + + ++ + V+  +   GV  GQ+ VFY  +S+   +LG
Sbjct: 298 --ESFECRVQVRYRHTPIRCRITKMNEDLVVNPLEEVRGVTPGQSAVFYPLNSDYL-LLG 354

Query: 380 GGIISGSKRSD-AVEESLLS 398
           G I  GS R   A EES ++
Sbjct: 355 GIIRKGSIRMQVAKEESAIA 374


>gi|220906770|ref|YP_002482081.1| tRNA-specific 2-thiouridylase MnmA [Cyanothece sp. PCC 7425]
 gi|219863381|gb|ACL43720.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanothece sp. PCC 7425]
          Length = 368

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 141/376 (37%), Positives = 214/376 (56%), Gaps = 26/376 (6%)

Query: 15  DKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVY 74
           ++  ++  VVV +SGGVDSSV AA L   GY V+G+TL L       K KG CC+ + + 
Sbjct: 7   NQTEQNKSVVVGLSGGVDSSVAAASLHHQGYRVVGLTLWLM------KGKGQCCS-EGLV 59

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA ++C+ + V H++ D  E F++ ++    + Y+ G TPLPC  CNRTVKF  +L   +
Sbjct: 60  DAAQLCEELGVPHHIVDSRELFQSQIVDYLVAGYSDGITPLPCSQCNRTVKFGPMLHYAQ 119

Query: 135 -QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLG 193
            +LG + +ATGHY R  +   D    R  + R +D  +DQSYFL+  TQ  L    FPLG
Sbjct: 120 TELGIETIATGHYARITV---DPQTGRYQLRRAVDRSKDQSYFLYDLTQAHLAHTLFPLG 176

Query: 194 DMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVV--KRINAGIALEGDIVHLNGQ 251
           +  K + R +A +  L  A+K +SQD+C ++          K IN    ++G+IV   G+
Sbjct: 177 EQTKATTRQIAAQFNLHTAEKPESQDLCLIETHGSMQAFLDKYINP---IQGEIVDRQGR 233

Query: 252 ILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWL 311
           +LG H GI +YTIGQR+GLG+A  +PL+V+ LD+  +RVIVG RE        ++ +NW+
Sbjct: 234 VLGYHQGIHHYTIGQRKGLGIAAAQPLYVIGLDRAMNRVIVGDREEAVQSECTVQRVNWV 293

Query: 312 GDGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDG----VYVDFEKSEVGVASGQACVF 367
                +  +    +  ++ RSS  PV V     ++G    V + F++ + G+  GQA V+
Sbjct: 294 SIAPPDAPIAAEVQ--IRYRSSPVPVTVVPLPEEEGRSNRVKLIFDQPQFGITPGQAAVW 351

Query: 368 YTSDSNEARVLGGGII 383
           Y  D     +LGGGI+
Sbjct: 352 YQGDV----LLGGGIL 363


>gi|166031729|ref|ZP_02234558.1| hypothetical protein DORFOR_01429 [Dorea formicigenerans ATCC
           27755]
 gi|166028182|gb|EDR46939.1| hypothetical protein DORFOR_01429 [Dorea formicigenerans ATCC
           27755]
          Length = 359

 Score =  239 bits (610), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 144/368 (39%), Positives = 205/368 (55%), Gaps = 20/368 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRK--GSCCAGQDVYDARRV 79
           +VVV MSGGVDSSV A LLK  GYDVIGVT+Q++      K++  G CC    V DARRV
Sbjct: 5   KVVVGMSGGVDSSVAAWLLKEQGYDVIGVTMQIWQDEDEFKQQEEGGCCGLSAVEDARRV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              + + +YV +++  F+  VI  F   Y  G TP PC+ CNR VK+  LL+   ++GAD
Sbjct: 65  AARLGIPYYVMNFKNEFKKYVIDYFIDDYLHGRTPNPCIACNRYVKWESLLTRAMEIGAD 124

Query: 140 VLATGHYIR-SRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY +  +L  G    R  I      + +DQ+Y L+  TQ QL     P+G   K+
Sbjct: 125 YIATGHYAQVEQLPSG----RYSIKTSVTSM-KDQTYALYNLTQDQLSKTLMPVGKYSKD 179

Query: 199 SVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKR-INAGIALEGDIVHLNGQILGRHN 257
            VR +A  +GL +A K DSQDICFV  G Y   ++    AG    G+ V  +G I+G+H 
Sbjct: 180 EVRKMAENIGLLVAHKPDSQDICFVPDGDYATYIEENTAAGSIRPGNFVTSDGTIVGQHK 239

Query: 258 GIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFE 317
           GII+YT+GQR+GLG+++G P FV+ +   ++ V+VG  E      +    +N++      
Sbjct: 240 GIIHYTVGQRKGLGLSLGHPAFVLEIRPETNEVVVGTNEESMSRYVRANHVNFM-----S 294

Query: 318 DAVVDGFK-CFVKIRSSQDPVPVFVQRN-DDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
            A +DG K  + KIR +       V+R  +D +   F++    +  GQA V Y  +    
Sbjct: 295 VADIDGKKRAWGKIRYNHKGAWCTVERTGEDEILCTFDEPVRAITPGQALVLYDGE---- 350

Query: 376 RVLGGGII 383
            VLGGG I
Sbjct: 351 YVLGGGTI 358


>gi|237756395|ref|ZP_04584939.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sulfurihydrogenibium yellowstonense SS-5]
 gi|237691446|gb|EEP60510.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Sulfurihydrogenibium yellowstonense SS-5]
          Length = 352

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 136/366 (37%), Positives = 211/366 (57%), Gaps = 17/366 (4%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +VVV +SGGVDSS  A LLK+ GY+V+G++L+  +          CC+ +D+ DA++V +
Sbjct: 3   KVVVGLSGGVDSSTAAFLLKKQGYEVVGISLKFTDIDSCEVDTQVCCSDKDILDAKKVAE 62

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            + + HYV ++++ F   VI  F   Y +G TP PC  CNR VK        + LG D L
Sbjct: 63  FLEIPHYVINWKDIFEKKVINYFIEGYKSGLTPNPCSICNREVKTGLFAKYIKSLGFDYL 122

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHYIR+ +   +DG   +++ R +D  +DQSYF+    ++ +  L FPLG++ KE VR
Sbjct: 123 ATGHYIRTDI---EDG--VKVLKRGIDKNKDQSYFMALVEREVVDTLIFPLGNLTKEEVR 177

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A+E  + ++ K +S +ICF +     +  K +N     EG+IVH++G++LGRH GI N
Sbjct: 178 KIAQENKIPVSQKEESFEICFTKGKSPEEYFKTLNIKTN-EGEIVHISGKVLGRHKGIEN 236

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQRRGL +A  EPL+V+  D  +++++VG ++ L   ++  ++ N+L        + 
Sbjct: 237 YTIGQRRGLNIAWKEPLYVIEKDALNNKIVVGEKDYLLTDKVVAKDFNFLV------PIE 290

Query: 322 DGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              K  V+ R  Q P+       D + + V FE+     A GQ    Y  D+    +LGG
Sbjct: 291 KWKKIEVQGRYKQKPIKAKEYHFDGENLTVIFEEKVPRFAPGQILAVYDGDT----LLGG 346

Query: 381 GIISGS 386
           GIIS S
Sbjct: 347 GIISRS 352


>gi|313807611|gb|EFS46098.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL087PA2]
 gi|313818648|gb|EFS56362.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL046PA2]
 gi|313820418|gb|EFS58132.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL036PA1]
 gi|313822776|gb|EFS60490.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL036PA2]
 gi|313825290|gb|EFS63004.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL063PA1]
 gi|314925110|gb|EFS88941.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL036PA3]
 gi|314960438|gb|EFT04540.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL002PA2]
 gi|314978611|gb|EFT22705.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL072PA2]
 gi|314988029|gb|EFT32120.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL005PA2]
 gi|314989840|gb|EFT33931.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL005PA3]
 gi|315084219|gb|EFT56195.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL027PA2]
 gi|315085563|gb|EFT57539.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL002PA3]
 gi|315088383|gb|EFT60359.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL072PA1]
 gi|327443626|gb|EGE90280.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL013PA2]
 gi|328753381|gb|EGF66997.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL020PA1]
          Length = 360

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 148/370 (40%), Positives = 208/370 (56%), Gaps = 25/370 (6%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARRVCDTIN 84
           MSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR  D + 
Sbjct: 1   MSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARRAADRLG 59

Query: 85  VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG 144
           +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG D +ATG
Sbjct: 60  IPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGYDAVATG 119

Query: 145 HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLA 204
           HY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K +VR  A
Sbjct: 120 HYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKMNVRQEA 174

Query: 205 REMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHNGIINYT 263
             +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HNG  ++T
Sbjct: 175 TALGLSVADKPDSNDICFIPDG---DTPGWLSEKIGSADGEIRDESGALVGHHNGYHHFT 231

Query: 264 IGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           IGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W         
Sbjct: 232 IGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-----SSE 286

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D     V+G
Sbjct: 287 PVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD----LVVG 342

Query: 380 GGIISGSKRS 389
              I G+ R+
Sbjct: 343 SATICGTDRA 352


>gi|313764363|gb|EFS35727.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL013PA1]
 gi|313792051|gb|EFS40152.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL110PA1]
 gi|313802000|gb|EFS43234.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL110PA2]
 gi|313812853|gb|EFS50567.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL025PA1]
 gi|313815901|gb|EFS53615.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL059PA1]
 gi|313827583|gb|EFS65297.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL063PA2]
 gi|313838822|gb|EFS76536.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL086PA1]
 gi|314915354|gb|EFS79185.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL005PA4]
 gi|314918090|gb|EFS81921.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL050PA1]
 gi|314920172|gb|EFS84003.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL050PA3]
 gi|314931695|gb|EFS95526.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL067PA1]
 gi|314955597|gb|EFS99998.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL027PA1]
 gi|314957994|gb|EFT02097.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL002PA1]
 gi|314962706|gb|EFT06806.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL082PA1]
 gi|314967428|gb|EFT11527.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL037PA1]
 gi|315098625|gb|EFT70601.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL059PA2]
 gi|315101372|gb|EFT73348.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL046PA1]
 gi|315105724|gb|EFT77700.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL030PA1]
 gi|315108590|gb|EFT80566.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL030PA2]
 gi|327330347|gb|EGE72096.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL097PA1]
 gi|327450691|gb|EGE97345.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL087PA3]
 gi|327453231|gb|EGE99885.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL092PA1]
 gi|327453970|gb|EGF00625.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL083PA2]
 gi|328753227|gb|EGF66843.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL025PA2]
 gi|328754110|gb|EGF67726.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL087PA1]
          Length = 360

 Score =  239 bits (609), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 148/370 (40%), Positives = 208/370 (56%), Gaps = 25/370 (6%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARRVCDTIN 84
           MSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR  D + 
Sbjct: 1   MSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARRAADRLG 59

Query: 85  VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG 144
           +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG D +ATG
Sbjct: 60  IPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGYDAVATG 119

Query: 145 HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLA 204
           HY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K +VR  A
Sbjct: 120 HYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKMNVRQEA 174

Query: 205 REMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHNGIINYT 263
             +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HNG  ++T
Sbjct: 175 AALGLSVADKPDSNDICFIPDG---DTPGWLSEKIGSADGEIRDESGALVGHHNGYHHFT 231

Query: 264 IGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           IGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W         
Sbjct: 232 IGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-----SSE 286

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D     V+G
Sbjct: 287 PVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD----LVVG 342

Query: 380 GGIISGSKRS 389
              I G+ R+
Sbjct: 343 SATICGTDRA 352


>gi|322807224|emb|CBZ04798.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum H04402 065]
          Length = 353

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 127/363 (34%), Positives = 207/363 (57%), Gaps = 19/363 (5%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V +AMSGGVDSSV A +LK  GYDVIG+ + L+   +        C      DARRV + 
Sbjct: 6   VALAMSGGVDSSVSAYILKERGYDVIGIYMDLWRDEREE-----YCNKSAAEDARRVAEK 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +++  +V + E++F++ VI  F   Y +G TP PCV CN+T+KF    +  ++ GAD +A
Sbjct: 61  LDIPFHVINIEKKFKDNVIDYFIDEYLSGRTPNPCVACNKTIKFEAFFNAAKEFGADFMA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +     G     R+++ +  D ++DQ+Y ++   Q QL     P G+ KK+ +R+
Sbjct: 121 TGHYCKIEERNG-----RKVIVKAEDDKKDQTYMMYNLKQYQLERTIMPCGEYKKDHIRE 175

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A  +GLD+ +K DSQ+ICF+    +   +KR       +G+ V   G+I+G+H GII Y
Sbjct: 176 IAENIGLDVYNKKDSQEICFIPDNDHGGFIKRNYKSKIKQGNFVDKAGKIIGKHKGIIYY 235

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P +V+ ++  ++ V++G  E +    +  R++N++     E ++  
Sbjct: 236 TIGQRKGLGIALGKPAYVIDINPITNEVVIGDEEDIFRTELIARDVNFIPFDKLEKSM-- 293

Query: 323 GFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   K+R S  P     +   ++ V V FE  +  +  GQ+ VFY  D     ++GGG
Sbjct: 294 --ELEAKVRYSAKPSKATIIPLENNKVKVVFESKQRAITKGQSVVFYDKDM----LVGGG 347

Query: 382 IIS 384
           II 
Sbjct: 348 IIE 350


>gi|168179339|ref|ZP_02614003.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916]
 gi|226950335|ref|YP_002805426.1| tRNA-specific 2-thiouridylase MnmA [Clostridium botulinum A2 str.
           Kyoto]
 gi|182669769|gb|EDT81745.1| tRNA -methyltransferase [Clostridium botulinum NCTC 2916]
 gi|226844215|gb|ACO86881.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A2 str. Kyoto]
          Length = 353

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 128/364 (35%), Positives = 205/364 (56%), Gaps = 19/364 (5%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V +AMSGGVDSSV A +LK  GYDVIG+ + L+   +        C      DARRV + 
Sbjct: 6   VALAMSGGVDSSVSAYILKERGYDVIGIYMDLWRDEREE-----YCNKSAAEDARRVAEK 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +++  +V + E++F++ VI  F   Y +G TP PCV CN+T+KF    +  ++ GAD +A
Sbjct: 61  LDIPFHVINIEKKFKDNVIDYFIDEYLSGRTPNPCVACNKTIKFEAFFNAAKEFGADFMA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +     G     R+++ +  D ++DQ+Y ++   Q QL     P G+ KK+ +R+
Sbjct: 121 TGHYCKIEERNG-----RKVIVKAEDDKKDQTYMMYNLKQYQLERTIMPCGEYKKDHIRE 175

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A  +GLD+ +K DSQ+ICF+    +   +KR       EG+ V   G I+G+H GII Y
Sbjct: 176 IAESIGLDVYNKKDSQEICFIPDNDHGGFIKRNYKRKISEGNFVDKEGNIIGKHKGIIYY 235

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P +V+ ++  ++ V++G  E +    +  +++N++     E  +  
Sbjct: 236 TIGQRKGLGIALGKPAYVIDINPITNEVVIGEEEDIFRTELIAKDVNFIPFDKLEKPM-- 293

Query: 323 GFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   K+R S  P     +   ++ V V FE  +  +  GQ+ VFY  D     + GGG
Sbjct: 294 --ELEAKVRYSAKPSKATIIPLENNKVKVVFENKQRAITKGQSVVFYDKDI----LAGGG 347

Query: 382 IISG 385
           II G
Sbjct: 348 IIEG 351


>gi|148380860|ref|YP_001255401.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 3502]
 gi|153934263|ref|YP_001385167.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 19397]
 gi|153935159|ref|YP_001388636.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. Hall]
 gi|205810535|sp|A7FXG3|MNMA2_CLOB1 RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|205810559|sp|A5I5Y9|MNMA2_CLOBH RecName: Full=tRNA-specific 2-thiouridylase mnmA 2
 gi|148290344|emb|CAL84469.1| tRNA(5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 3502]
 gi|152930307|gb|ABS35807.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. ATCC 19397]
 gi|152931073|gb|ABS36572.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Clostridium botulinum A str. Hall]
          Length = 353

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 128/363 (35%), Positives = 210/363 (57%), Gaps = 19/363 (5%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           V +AMSGGVDSSV A +LK  GYDVIG+ + L+      +RKG C       DARRV + 
Sbjct: 6   VALAMSGGVDSSVSAYILKERGYDVIGIYMDLWRD----ERKGYCNKSA-AEDARRVAEK 60

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           +++  +V + E++F++ VI  F   Y +G TP PCV CN+T+KF    +  ++ GAD +A
Sbjct: 61  LDIPFHVINIEKKFKDNVIDYFIDEYLSGRTPNPCVACNKTIKFEAFFNAAKEFGADFMA 120

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +     G     R+++ +  D ++DQ+Y ++   Q QL     P G+ KK+ +R+
Sbjct: 121 TGHYCKIEERNG-----RKVIVKAEDDKKDQTYMMYNLKQYQLERTIMPCGEYKKDHIRE 175

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           +A  +GLD+ +K DSQ+ICF+    +   +KR       +G+ V   G+I+G+H GII Y
Sbjct: 176 IAENIGLDVYNKKDSQEICFIPDNDHGGFIKRNYKSKIKQGNFVDKAGKIIGKHKGIIYY 235

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A+G+P +V+ ++  ++ V++G  E +    +  +++N++     E ++  
Sbjct: 236 TIGQRKGLGIALGKPAYVIDINPITNEVVIGDEEDIFRTELIAKDVNFIPFDKLEKSM-- 293

Query: 323 GFKCFVKIRSSQDPV-PVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
             +   K+R S  P     +   ++ V V F+  +  +  GQ+ VFY  D     ++GGG
Sbjct: 294 --ELEAKVRYSAKPSKATIIPLENNKVKVVFQNKQRAITKGQSVVFYDKDM----LVGGG 347

Query: 382 IIS 384
           II 
Sbjct: 348 IIE 350


>gi|328950099|ref|YP_004367434.1| tRNA-specific 2-thiouridylase mnmA [Marinithermus hydrothermalis
           DSM 14884]
 gi|328450423|gb|AEB11324.1| tRNA-specific 2-thiouridylase mnmA [Marinithermus hydrothermalis
           DSM 14884]
          Length = 374

 Score =  239 bits (609), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 145/365 (39%), Positives = 200/365 (54%), Gaps = 20/365 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           RV+ AMSGGVDSSV AALLK  GY+VIG  ++ +   K      +CC+    Y+ARRV D
Sbjct: 8   RVLAAMSGGVDSSVTAALLKEQGYEVIGAMMRFWPDNKPEDCFNTCCSPDAAYEARRVAD 67

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            I +  Y+ DY E F   +I PF   Y  GETP+PCV CN  VKF  LL   R LG D +
Sbjct: 68  QIGIPFYLLDYREVFEVEIIQPFLEGYRRGETPIPCVWCNTRVKFDALLKKARMLGCDYV 127

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
           ATGHY+R       +G +     R  D  +DQ+YFL+ T ++ +  + FP+G M+K  VR
Sbjct: 128 ATGHYVRR-----VEGPQGIEFHRGGDPRKDQTYFLWGTPREAMPHILFPVGHMQKPEVR 182

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHL-NGQILGRHNGII 260
            LA   GL  A K +SQ+ICFV  G     ++    G    G ++ L  G+++G H G  
Sbjct: 183 RLAERFGLITAKKPESQNICFV-PGSVRAFLEEHLGGQP--GPVIDLETGEVIGEHAGAQ 239

Query: 261 NYTIGQRRGLGVAMGE-PLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            YT+GQR+GLG+       +VV +   ++ VIVGPRE+ +   +  REIN L D      
Sbjct: 240 FYTVGQRKGLGLWKTHLERYVVEVRPQTNEVIVGPREACQWRGLEAREINLLLDPETLPE 299

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYV-DFEKSEVGVASGQACVFYTSDSNEARVL 378
           VV       ++R  Q P    V+    G +V +F++ +  V  GQ+ V Y  D    R+L
Sbjct: 300 VVT-----AQVRYRQRPARARVRELGAGRFVLEFDEPQFAVTRGQSVVLYDGD----RLL 350

Query: 379 GGGII 383
           GGG+I
Sbjct: 351 GGGVI 355


>gi|254431220|ref|ZP_05044923.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanobium sp. PCC 7001]
 gi|197625673|gb|EDY38232.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Cyanobium sp. PCC 7001]
          Length = 399

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/389 (38%), Positives = 215/389 (55%), Gaps = 33/389 (8%)

Query: 14  LDKNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDV 73
           L   P + RV V +SGGVDSS+ AALL   G++V G+TL L +       KG+CCA + +
Sbjct: 25  LRHWPGEHRVAVGLSGGVDSSLTAALLVEAGWEVEGLTLWLMSG------KGACCA-EGL 77

Query: 74  YDARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVT 133
            DA  +C+ + V H+V D+ + FR  ++      YAAG TPLPC  CNR VKF+ +L+  
Sbjct: 78  VDAAGICEQLGVPHHVVDFRDHFRAQIVDFLVDGYAAGVTPLPCSRCNREVKFAPMLAWA 137

Query: 134 R-QLGADVLATGHYIRSR-------LYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQL 185
           R Q G + LATGHY R R       L V  DG+ R  + R +D  +DQSYFL+   Q+ L
Sbjct: 138 REQRGLERLATGHYARVRRADAADPLPVPGDGRGRHQLLRGLDARKDQSYFLYDLPQEVL 197

Query: 186 CDLRFPLGDMKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGD 244
             L FPLG++ K   R  A   GL  A K +SQD+C      +  +   ++A +   +G+
Sbjct: 198 GRLVFPLGELTKPDTRQEAERHGLRTAHKPESQDLCLADH--HGSMRAFLDAHLPPRDGE 255

Query: 245 IVHLNGQILGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIY 304
           IV  +G+++GRH+GI ++TIGQR+GLGVA  EPL VV LD   +RV+V PR         
Sbjct: 256 IVLQDGRVVGRHDGIEHFTIGQRKGLGVAWSEPLHVVRLDAAFNRVVVAPRREAARGDCV 315

Query: 305 LREINWLGDGLFEDAVVDGFKCFVKIRSSQD-----PVPVF----VQRNDDGVYVDFEKS 355
           +  +NW+      DA ++     V+ RS+ +     P+P        +    V ++F + 
Sbjct: 316 VGAVNWVSMAA-PDAPLE-VMVQVRYRSAPEWALLTPLPATEVDQAAQRPHRVRLEFAEE 373

Query: 356 EVGVASGQACVFYTSDSNEARVLGGGIIS 384
           +  +  GQA VFY  +     +LGGG+I 
Sbjct: 374 QFSITPGQAAVFYAGEV----LLGGGLIQ 398


>gi|327331848|gb|EGE73585.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL096PA3]
          Length = 360

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/370 (40%), Positives = 208/370 (56%), Gaps = 25/370 (6%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARRVCDTIN 84
           MSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR  D + 
Sbjct: 1   MSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARRAADRLG 59

Query: 85  VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG 144
           +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG D +ATG
Sbjct: 60  IPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGYDAVATG 119

Query: 145 HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLA 204
           HY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K +VR  A
Sbjct: 120 HYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKMNVRQEA 174

Query: 205 REMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHNGIINYT 263
             +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HNG  ++T
Sbjct: 175 TALGLSVADKPDSNDICFIPDG---DTPGWLSDKIGSADGEIRDESGALVGHHNGYHHFT 231

Query: 264 IGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           IGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W         
Sbjct: 232 IGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-----SSE 286

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D     V+G
Sbjct: 287 PVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD----LVVG 342

Query: 380 GGIISGSKRS 389
              I G+ R+
Sbjct: 343 SATICGTDRA 352


>gi|295102218|emb|CBK99763.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Faecalibacterium prausnitzii L2-6]
          Length = 370

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/364 (36%), Positives = 196/364 (53%), Gaps = 13/364 (3%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVYDARRVCD 81
            ++AMSGGVDSSV A L++RDG+D  GVT++L  N    ++   +CC+ +D+ DA  V  
Sbjct: 13  ALIAMSGGVDSSVAAWLMQRDGFDCTGVTMRLTRNEAVNTEGLHTCCSERDIEDAAEVAY 72

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVL 141
            +++ + V D+   F+  +I  F   Y AG TP PC+DCNR +KF  LL      G D +
Sbjct: 73  AMDIPYEVLDFTADFQERIIDKFIRVYEAGGTPNPCIDCNRYMKFDHLLRWAEAHGLDHV 132

Query: 142 ATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVR 201
            TGHY R      D+   R ++ + +D  +DQSY L+  TQ+QL  +R PLG + K  VR
Sbjct: 133 VTGHYARVEQ---DEATGRWLLKKGLDENKDQSYVLYNLTQEQLAHVRLPLGGLHKSEVR 189

Query: 202 DLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIIN 261
            +A +     A K DSQDICFV  G Y   ++         GD + + G+ +G H+G + 
Sbjct: 190 AIAEQQHFVNARKHDSQDICFVPDGDYARFMEEFTGKHYPAGDFLDVGGKKVGTHSGAVR 249

Query: 262 YTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVV 321
           YTIGQR+GLG+AMG P++V   D  ++ V VGP   L    +Y  E+NW+     +  + 
Sbjct: 250 YTIGQRKGLGLAMGAPVYVCAKDMQANTVTVGPESELFDTIVYANEVNWIAIPELKGPL- 308

Query: 322 DGFKCFVKIRSSQDPVPVFV-QRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGG 380
              +   + R  Q   P  V     D   ++F++ +     GQA V Y  D     VLGG
Sbjct: 309 ---RVTARTRYHQTEQPATVYPAGPDSFRLEFDQPQRAPTPGQAVVLYQGDV----VLGG 361

Query: 381 GIIS 384
           G I+
Sbjct: 362 GTIT 365


>gi|313772254|gb|EFS38220.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL074PA1]
 gi|313810119|gb|EFS47840.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL083PA1]
 gi|313830448|gb|EFS68162.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL007PA1]
 gi|313833819|gb|EFS71533.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL056PA1]
 gi|314973449|gb|EFT17545.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL053PA1]
 gi|314976129|gb|EFT20224.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL045PA1]
 gi|314983850|gb|EFT27942.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL005PA1]
 gi|315080547|gb|EFT52523.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL078PA1]
 gi|315095996|gb|EFT67972.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL038PA1]
 gi|327326276|gb|EGE68066.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL096PA2]
 gi|327445830|gb|EGE92484.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL043PA2]
 gi|327448188|gb|EGE94842.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL043PA1]
 gi|328760764|gb|EGF74330.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Propionibacterium acnes HL099PA1]
          Length = 360

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/370 (40%), Positives = 208/370 (56%), Gaps = 25/370 (6%)

Query: 27  MSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGS--CCAGQDVYDARRVCDTIN 84
           MSGGVDS+V AA L   G+DV GV L L  + + S R+GS  CC+ +D +DARR  D + 
Sbjct: 1   MSGGVDSAVAAARLVEAGHDVTGVHLALSRNPR-SHREGSRGCCSLEDSFDARRAADRLG 59

Query: 85  VSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLATG 144
           +  YV+D+ +RF   VI PF + Y AG TP PC+ CN  +KF+ LL     LG D +ATG
Sbjct: 60  IPFYVWDFSDRFVAEVIDPFIAEYRAGRTPNPCLRCNERIKFAALLERGLDLGYDAVATG 119

Query: 145 HYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRDLA 204
           HY R+++    DG  +  + R +D  +DQSY L    Q QL    FPLG+  K +VR  A
Sbjct: 120 HYARTKVV---DGVTK--LYRSVDPGKDQSYVLAVLNQDQLSHSLFPLGNSLKMNVRQEA 174

Query: 205 REMGLDIADKSDSQDICFVQQGKYFDVVKRINAGI-ALEGDIVHLNGQILGRHNGIINYT 263
             +GL +ADK DS DICF+  G   D    ++  I + +G+I   +G ++G HNG  ++T
Sbjct: 175 AALGLSVADKPDSNDICFIPDG---DTRGWLSEKIGSADGEIRDESGALVGHHNGYHHFT 231

Query: 264 IGQRRGLGVAM----GEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
           IGQRRGL + +    G+P +V+ ++  ++ V+VG  E L VH I      W         
Sbjct: 232 IGQRRGLRLGVPAPDGKPRYVLDIEPVNNTVVVGGAEGLTVHHIEAIRPVWC-----SSE 286

Query: 320 VVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
            V+ +    ++R+  DPVP  +     GV V+ E S  GVA GQA VFY  D     V+G
Sbjct: 287 PVETWHGQAQVRAHGDPVPAIISAVPGGVAVELEDSLRGVAPGQAAVFYDGD----LVVG 342

Query: 380 GGIISGSKRS 389
              I G+ R+
Sbjct: 343 SATICGTDRA 352


>gi|206901317|ref|YP_002250407.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dictyoglomus thermophilum H-6-12]
 gi|206740420|gb|ACI19478.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Dictyoglomus thermophilum H-6-12]
          Length = 345

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/365 (36%), Positives = 207/365 (56%), Gaps = 27/365 (7%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           ++V V MSGGVDSS  A LLK++GY+VIG+T+ +  S               + DA ++ 
Sbjct: 3   IKVAVGMSGGVDSSTTAYLLKKEGYEVIGLTMNIAYS-------------DSIKDAEKIA 49

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
             +N+ H+  D  + F   +I  F  SY +G TP PC  CNR +KF  LL   ++LGA+ 
Sbjct: 50  KYLNIPHFYVDLRKEFEEQIIKYFIDSYKSGYTPNPCTFCNRIIKFGLLLKKAQELGAEY 109

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           LATGHY+R    V D+ K+  ++ R  DL++DQSYFL   TQ+Q+    FPLGD+ K  V
Sbjct: 110 LATGHYVRK---VWDEEKKVFLLKRAKDLKKDQSYFLAYLTQEQIEKSLFPLGDLTKNEV 166

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R LA E+GL ++DK +SQDICF+    Y   + R    +  +G I+  +G  +G H+G+ 
Sbjct: 167 RKLAEEIGLFVSDKEESQDICFLPDRDYRKFLSRYL--VEKKGKIITEDGVEVGYHDGVF 224

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           ++TIGQRRGL VA+G+P++V  +      V+V  RE +    +Y + +N+   G+  +  
Sbjct: 225 SFTIGQRRGLRVALGKPVYVKKIIPEEGIVVVADREKIFSREVYAKNVNY-PSGMPREKE 283

Query: 321 VDGFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           ++       IR + +P P  ++  ++  +Y+ FE+ +  +  GQ  V Y  D     VL 
Sbjct: 284 LE---VKAMIRYNMEPQPALLKILSEKEIYLTFEEPQWAITPGQILVCYKDDY----VLC 336

Query: 380 GGIIS 384
           GG+I 
Sbjct: 337 GGVIE 341


>gi|257437854|ref|ZP_05613609.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Faecalibacterium prausnitzii A2-165]
 gi|257199514|gb|EEU97798.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Faecalibacterium prausnitzii A2-165]
          Length = 371

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/370 (36%), Positives = 197/370 (53%), Gaps = 13/370 (3%)

Query: 16  KNPKDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLY-NSRKASKRKGSCCAGQDVY 74
           +N K    ++AMSGGVDSSV A L+++ GYD  G+T++L  N         +CC+ +D+ 
Sbjct: 9   QNTKRPGALIAMSGGVDSSVAAWLMQQAGYDCTGITMRLTRNETLGQSGFHTCCSEKDIE 68

Query: 75  DARRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTR 134
           DA  V   +++ + V D+   FR  +I  F   Y  G TP PC+DCNR +KF  LL    
Sbjct: 69  DAAEVAFAMDIPYEVLDFTADFREKIIEKFIRVYEMGGTPNPCIDCNRYMKFDHLLRWAE 128

Query: 135 QLGADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGD 194
             G + + TGHY R      D+   R ++ + +D  +DQSY L+  TQ+QL  +R PLG 
Sbjct: 129 SHGMEYVVTGHYARVEQ---DEATGRWLLKKGLDEGKDQSYVLYNLTQEQLAHVRLPLGG 185

Query: 195 MKKESVRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILG 254
           + K  VR++A +     A K DSQDICFV  G Y   ++         GD +  NG+ +G
Sbjct: 186 LHKAEVREIAEKQHFINARKHDSQDICFVPDGDYARFMEDFTGKHYPAGDFLDENGKKVG 245

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            HNG + YTIGQR+GLG+AMG P++V   D  ++ V VGP E+L    +Y  E+NW+   
Sbjct: 246 THNGAVRYTIGQRKGLGLAMGAPVYVCAKDMQANTVTVGPEENLFDRIVYADEVNWIAI- 304

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVY-VDFEKSEVGVASGQACVFYTSDSN 373
                +    +   + R  Q      V    +G + ++F++ +     GQA V Y  D  
Sbjct: 305 ---PELTAPLRVTARTRYHQTEQAATVYPAGEGQFRLEFDQPQRAPTPGQAVVLYQGDV- 360

Query: 374 EARVLGGGII 383
              VLGGG I
Sbjct: 361 ---VLGGGTI 367


>gi|255324545|ref|ZP_05365662.1| tRNA-methyltransferase [Corynebacterium tuberculostearicum SK141]
 gi|255298451|gb|EET77751.1| tRNA-methyltransferase [Corynebacterium tuberculostearicum SK141]
          Length = 365

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 150/376 (39%), Positives = 202/376 (53%), Gaps = 26/376 (6%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKG-SCCAGQDVYDARRV 79
           MRV+VAMSGGVDSSV AA     G++VIGV L L+   + ++ K   CC+ +D  DARR+
Sbjct: 5   MRVLVAMSGGVDSSVAAARAVEAGHEVIGVHLALHKDAQQTREKARGCCSLEDSADARRI 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
           CD + +  YV+D+ E F+  VI  F  SYA GETP PC+ CN  +KF  LL     LG D
Sbjct: 65  CDKLGIPFYVWDFSEEFKEEVITDFVDSYARGETPNPCLRCNEKIKFRALLQKGMALGFD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY      + +DG  R    R +D  +DQSY L   + ++L    FP+GD  K  
Sbjct: 125 AVATGHYAT----IDEDGYMR----RSLDENKDQSYVLGVISAEELEHCFFPIGDTPKPQ 176

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIAL-EGDIVHLNGQILGRHNG 258
           +R+ A   G   A K DS DICF+  G   +    + A I L  G IV   G  L  H+G
Sbjct: 177 IREEAAAHGFSTAKKPDSYDICFIPDG---NTQAFLGARIGLRPGMIVDQEGTELKEHDG 233

Query: 259 IINYTIGQRRGLGV----AMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
             NYTIGQR+GL +    A G P +V  +D  +  V VG RE L V  I    + +L  G
Sbjct: 234 AWNYTIGQRKGLDIKAPAADGRPRYVTDIDAATGTVTVGAREDLAVTSIQADLLKYLHPG 293

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVP--VFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDS 372
           +  D     F+C V++R+    VP    V R  D + ++ ++   GVA GQA V Y    
Sbjct: 294 MDGD-----FECEVQVRAHGSVVPCIAHVDREADEMRLELKEPLSGVARGQAAVLYLPSP 348

Query: 373 NEAR--VLGGGIISGS 386
           +E    V+G G I G+
Sbjct: 349 DELGDIVIGSGTICGT 364


>gi|325281886|ref|YP_004254428.1| tRNA-specific 2-thiouridylase mnmA [Odoribacter splanchnicus DSM
           20712]
 gi|324313695|gb|ADY34248.1| tRNA-specific 2-thiouridylase mnmA [Odoribacter splanchnicus DSM
           20712]
          Length = 364

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 128/373 (34%), Positives = 210/373 (56%), Gaps = 21/373 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYN--SRKASKRKGSCCAGQDVYDARRV 79
           RV++AMSGG+DS+V A LL   GY+++GVT + ++  SR   +++  CC+   +++A+R+
Sbjct: 5   RVLMAMSGGIDSTVAAMLLLEQGYELVGVTYRTFDNISRGCMEKEKGCCSVDSLFEAKRM 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
              +   H++ D  + F++ VI  F   Y  G TP PCV CN T+K+  L+    ++  D
Sbjct: 65  AQELGFEHHILDIRQEFKDTVITNFIGEYLQGRTPNPCVICNSTIKWGKLIETANEMRCD 124

Query: 140 VLATGHYIRSRLYVG-DDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKE 198
            +ATGHY R    +G  DG  RR + +  DL +DQ+YFL+  TQ+ L    FPLG++ K 
Sbjct: 125 YIATGHYAR----IGHQDG--RRYLRKGADLSKDQTYFLWTLTQENLSRTLFPLGELTKP 178

Query: 199 SVRDLAREMGLD-IADKSDSQDICFVQQGKYFDVVKRINAGIALE---GDIVHLNGQILG 254
            VR +A + G + ++ K +SQ+ICF+    Y   +         +   G+ V  +G+ LG
Sbjct: 179 EVRQIAFDHGYEKLSKKGESQEICFIPGNDYRTFLAEQVENYTEKYGPGNFVDTSGKRLG 238

Query: 255 RHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDG 314
            H G  NYTIGQR+GLG+A+G+P+FV+ +    + V++G +E L+    + +EIN +   
Sbjct: 239 EHKGYPNYTIGQRKGLGIALGQPMFVIAIHPEDNTVVLGTKEELQGKSFFAKEINLMKYA 298

Query: 315 LFEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNE 374
                + DG +   KIR   +     +   D+ + V F ++   +  GQ+ VFY  +   
Sbjct: 299 ----KIPDGLEVTAKIRYRNEGKKASLYPEDNRLRVVFHETMDSITPGQSAVFYEGED-- 352

Query: 375 ARVLGGGIISGSK 387
             V+GGG+I G +
Sbjct: 353 --VVGGGVIEGKR 363


>gi|312129941|ref|YP_003997281.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Leadbetterella byssophila DSM 17132]
 gi|311906487|gb|ADQ16928.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Leadbetterella byssophila DSM 17132]
          Length = 368

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 137/377 (36%), Positives = 207/377 (54%), Gaps = 19/377 (5%)

Query: 19  KDMRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDA 76
           K  RV+VAMSGG+DSS+ A LL   GY+V+G+T++   Y S   +K++  CC+   + DA
Sbjct: 3   KRGRVLVAMSGGIDSSLAAVLLHEQGYEVVGMTMKTWDYASSGGTKKETGCCSLDSINDA 62

Query: 77  RRVCDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQL 136
           R +   +   HY+ D    F ++VI  F   Y  G TP PCV CN  +K+  LL     L
Sbjct: 63  RAIAVNLGFPHYILDIRSEFGDSVIDHFTGEYLEGRTPNPCVLCNTHIKWDALLRRADNL 122

Query: 137 GADVLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMK 196
             + +ATGHY + R   G     R ++ R  D  +DQSY L+  +Q+ L     PLGD+ 
Sbjct: 123 NCEFIATGHYAKIRQENG-----RYVISRGKDTTKDQSYVLWGVSQESLSRTLLPLGDLT 177

Query: 197 KESVRDLAREMGL-DIADKSDSQDICFVQQGKYFDVVKRINAGIALE---GDIVHLNGQI 252
           K  +R++AR+ G  D+ +KS+S +ICFV    Y   +KR   G+  +   G+ V  NGQ+
Sbjct: 178 KAEIREMARQKGFYDLVNKSESYEICFVPDNDYRGFLKRRIEGLEEQVAGGNFVLENGQV 237

Query: 253 LGRHNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLG 312
           +G+H G   YTIGQR+GL +A+G P+FV  + K ++ V++G  E L+ + + + ++N   
Sbjct: 238 VGKHEGYPFYTIGQRKGLKIALGYPVFVTEIRKETNEVVLGTEEYLKKNGMVVSKLNLQK 297

Query: 313 DGLFEDAVVDGFKCFVKIRSSQDPVPVFVQRND-DGVYVDFEKSEVGVASGQACVFYTSD 371
                +    G +   KIR        F+++ D D + V+F +    +A GQA VFY  D
Sbjct: 298 YASIPEG---GLESLTKIRYKDQGEMAFIRQTDADKIEVEFSQPVSAIAPGQAAVFYEGD 354

Query: 372 SNEARVLGGGIISGSKR 388
                V+GGG I  S R
Sbjct: 355 D----VIGGGWIMKSYR 367


>gi|113474569|ref|YP_720630.1| tRNA-specific 2-thiouridylase MnmA [Trichodesmium erythraeum
           IMS101]
 gi|123352667|sp|Q118B7|MNMA_TRIEI RecName: Full=tRNA-specific 2-thiouridylase mnmA
 gi|110165617|gb|ABG50157.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Trichodesmium erythraeum IMS101]
          Length = 359

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 146/380 (38%), Positives = 214/380 (56%), Gaps = 37/380 (9%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           +++V +SGGVDSS  AA+L   GY V G+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KIIVGLSGGVDSSTAAAILHHQGYQVEGLTLWLM------KGKGQCCS-EGMVDAAYICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            +++ H++ D    F+  ++    + Y+AG TPLPC  CN+TVKF  +L+  R+ LG D 
Sbjct: 56  QLDIPHHIVDTRNLFQANIVDYLVTGYSAGITPLPCSQCNKTVKFGPMLAYGREKLGIDK 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R      D    R ++ R +D  +DQSYFL+  TQ  L    FPLG+M K   
Sbjct: 116 IATGHYARLDY---DSKSDRYLLKRAIDRNKDQSYFLYDLTQYLLAGSVFPLGEMVKSET 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQG----KYFDVVKRINAGIALEGDIVHLNGQILGRH 256
           R +A E GL  ADK +SQD+C V+       + D  K I      +G+IV   G++LGRH
Sbjct: 173 RRIAAEYGLKTADKPESQDLCLVESSGSMRAFLD--KYITPH---QGEIVDREGRVLGRH 227

Query: 257 NGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLF 316
           +G+ +YTIGQR+GLGV+   PL+V+ LD   ++VIVG R+S       ++ +NW+     
Sbjct: 228 DGVHHYTIGQRKGLGVSAPHPLYVIDLDPAMNKVIVGDRDSATKMESTVKLVNWVSIAPP 287

Query: 317 EDAVVDGFKCFVKIRSSQDPV-----PVFV--QRNDDGVYVD--FEKSEVGVASGQACVF 367
             ++    +  V++R    PV     P+ V  ++  DG  V   FE++  G+  GQA V+
Sbjct: 288 STSI----RAEVQVRYRSLPVAANIIPLGVNEEKPQDGFRVKLIFEEAVFGITPGQAAVW 343

Query: 368 YTSDSNEARVLGGGIISGSK 387
           Y  D     +LGGGII   K
Sbjct: 344 YEGDI----LLGGGIIENEK 359


>gi|320536235|ref|ZP_08036280.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Treponema phagedenis F0421]
 gi|320146893|gb|EFW38464.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Treponema phagedenis F0421]
          Length = 359

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 134/366 (36%), Positives = 202/366 (55%), Gaps = 16/366 (4%)

Query: 21  MRVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVC 80
           M+++V +SGGVDS+V A LL   G++V GVT+Q+ +      +       QD+ DAR + 
Sbjct: 1   MKILVGLSGGVDSAVAAKLLLEQGHEVSGVTMQMISPVGEIIKSQE----QDIADARAIA 56

Query: 81  DTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADV 140
           +T+ +  +  D    FR  ++  FA +Y  G TP PC  CN+ +KF  LL    + G D 
Sbjct: 57  NTLGIDFFTLDLRSAFREEIMNYFAETYKQGLTPNPCFICNKKMKFRRLLDAALERGFDA 116

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY +    + D    R ++ +  D ++DQSYFL    Q QL  + FPLG+  K  V
Sbjct: 117 IATGHYAQ---IMRDLKTGRYLLLQGSDSKKDQSYFLALLNQFQLAHIMFPLGNYTKPEV 173

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGII 260
           R +A + GL  A + DSQDICFV  G Y  +V+ +      EG+ +   G+I+G+H G+ 
Sbjct: 174 RKIAEKAGLISAHRPDSQDICFVPNGDYAKIVEALLPETFTEGNFLDTKGKIIGKHRGLH 233

Query: 261 NYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAV 320
           +YTIGQRRGL +A GEP++VV  D  ++ V VG  E+L    +    +N++      + +
Sbjct: 234 HYTIGQRRGLALAFGEPVYVVSKDAKTNTVCVGSSENLFASALVAENVNFIAVEKLTEPI 293

Query: 321 VDGFKCFVKIRSSQDPVPV-FVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLG 379
           V    C VK R  Q+ +P   +   +D + V+F + E  VA+GQA V Y     +  V  
Sbjct: 294 V----CTVKTRYRQNEIPARLIPITEDSLRVEFLQPERAVAAGQALVCY----KDGAVFA 345

Query: 380 GGIISG 385
           GGII+ 
Sbjct: 346 GGIITA 351


>gi|205814900|sp|Q6MLR7|MNMA_BDEBA RecName: Full=tRNA-specific 2-thiouridylase mnmA
          Length = 360

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 148/369 (40%), Positives = 206/369 (55%), Gaps = 20/369 (5%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQL--YNSRKASKRKGSCCAGQDVYDARRV 79
           RV+VAMSGGVDSS  AALL   GY+VIG T+Q+  Y++    +  G+CC+  DV DAR V
Sbjct: 5   RVLVAMSGGVDSSAAAALLVEQGYEVIGATMQVWDYSTCDIEEGNGTCCSSIDVDDARAV 64

Query: 80  CDTINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGAD 139
            D + +  YV + E +FR AVI PF  +Y  G+TPLPCV+CN  +KF  L+   R+L  D
Sbjct: 65  ADRLGIPFYVINCEAKFRAAVIDPFLKAYLEGQTPLPCVNCNTYLKFDHLVKKMRELECD 124

Query: 140 VLATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKES 199
            +ATGHY +    V DD  +  I     D  +DQ+YFLF    + +  L FP+GDMKK  
Sbjct: 125 YIATGHYAK---IVYDDKGKASIHTSTDDW-KDQTYFLFTIDPELVPKLLFPVGDMKKPQ 180

Query: 200 VRDLAREMGLDIADKSDSQDICFVQQGKYFDVVK-RINAGI--ALEGDIVHL-NGQILGR 255
           VR+ +   GL  A K DSQ ICFV    Y + +K  + + I  + +G I     GQ++  
Sbjct: 181 VREYSESRGLVTARKKDSQGICFVGNQGYQNFIKDHVKSEILASKKGLIKRFPEGQVMAS 240

Query: 256 HNGIINYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGL 315
           H GI NYT GQ +GLG+   E LFV+ +D + + V VG     E   ++  E++ +   L
Sbjct: 241 HEGIHNYTYGQSKGLGMDYHEKLFVIKIDASDNTVWVG-----EEKHLFANEVDVVDPKL 295

Query: 316 FEDAVVDGFKCFVKIRSSQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEA 375
             D + DG    VKIR      P  V +   G  + F + +  V  GQA VFY     + 
Sbjct: 296 L-DEIQDGEIMNVKIRYQHKGAPAQVIKTASGFKLKFTEPQRAVTPGQAAVFY----RDR 350

Query: 376 RVLGGGIIS 384
           +++GGG I+
Sbjct: 351 QLVGGGWIT 359


>gi|313893420|ref|ZP_07826992.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella sp. oral taxon 158 str. F0412]
 gi|313442061|gb|EFR60481.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [Veillonella sp. oral taxon 158 str. F0412]
          Length = 353

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/362 (37%), Positives = 201/362 (55%), Gaps = 18/362 (4%)

Query: 23  VVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCDT 82
           + VAMSGGVDSS+ AA+L + GY V G+TL L+ S               V DA+++CD 
Sbjct: 5   IAVAMSGGVDSSLTAAMLLKQGYKVFGITLWLWVSGTPYDE-----VPLAVTDAKKMCDF 59

Query: 83  INVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQLGADVLA 142
           + + H+V D  + F   V+  F   YA G TP PCV CN+ +KF  +L+   +LGA  + 
Sbjct: 60  LGIEHHVIDARDVFYENVVDYFVKEYAYGRTPNPCVFCNKNIKFDLMLNRALELGATHMV 119

Query: 143 TGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESVRD 202
           TGHY +      ++      + + +D  +DQSY ++   Q+ L  L FPLG   K   R 
Sbjct: 120 TGHYAQVNF---NEETGLYELHKGVDPTKDQSYVMYNMNQRILSHLMFPLGGQCKTETRK 176

Query: 203 LAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALEGDIVHLNGQILGRHNGIINY 262
           LA E  L +A K DS DICF+  G Y  +V          G+IV  +G++LG+HNG+ NY
Sbjct: 177 LAAEYDLPVAKKPDSVDICFLPHGNYQKLVVEEMKAKPKTGNIVTEDGEVLGKHNGLFNY 236

Query: 263 TIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDAVVD 322
           TIGQR+GLG+A   PL+V+  + + + VIVGP E L  +R+  +  N+L D + ++   +
Sbjct: 237 TIGQRKGLGIAYKHPLYVIGFNGDRNEVIVGPNERLFTNRMICKFYNFLDDTIHKELKAE 296

Query: 323 GFKCFVKIRSSQDPVPVFVQ-RNDDGVYVDFEKSEVGVASGQACVFYTSDSNEARVLGGG 381
           G     KIR + +P P   +  +DD + V FE+ +  +  GQ+  FY    N  ++LGG 
Sbjct: 297 G-----KIRYAANPSPCTARILDDDTMEVIFEEPQRAITPGQSVAFY----NGTQLLGGA 347

Query: 382 II 383
           +I
Sbjct: 348 VI 349


>gi|284929056|ref|YP_003421578.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [cyanobacterium UCYN-A]
 gi|284809515|gb|ADB95220.1| tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase
           [cyanobacterium UCYN-A]
          Length = 352

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 144/367 (39%), Positives = 209/367 (56%), Gaps = 27/367 (7%)

Query: 22  RVVVAMSGGVDSSVVAALLKRDGYDVIGVTLQLYNSRKASKRKGSCCAGQDVYDARRVCD 81
           ++VV +SGGVDSSV AA L   GY+V G+TL L       K KG CC+ + + DA  +C+
Sbjct: 3   KIVVGLSGGVDSSVAAASLCDQGYEVSGLTLWLM------KGKGQCCS-EGMVDAAHICE 55

Query: 82  TINVSHYVFDYEERFRNAVIVPFASSYAAGETPLPCVDCNRTVKFSDLLSVTRQ-LGADV 140
            +N+ HY+ D +E F+  +I    S Y +G TPLPC  CNR+VKF  +L   +Q L  D+
Sbjct: 56  QLNIPHYIVDAKELFKKNIIDYLVSGYKSGITPLPCSQCNRSVKFKPMLDYAQQELDCDL 115

Query: 141 LATGHYIRSRLYVGDDGKRRRIMCRPMDLERDQSYFLFATTQQQLCDLRFPLGDMKKESV 200
           +ATGHY R R    D    +  + R +D  +DQSYFL+   Q  L    FPLG+  KE  
Sbjct: 116 IATGHYARIRY---DKETDKYKLLRAIDPNKDQSYFLYDLPQDILAKTIFPLGEQTKEDT 172

Query: 201 RDLAREMGLDIADKSDSQDICFVQQGKYFDVVKRINAGIALE-GDIVHLNGQILGRHNGI 259
           R +A E  L  A+K +SQD+C ++   Y  +   +   I  + GDIV+  G++LG H GI
Sbjct: 173 RRMATEFKLRTANKPESQDLCLIES--YGSMASFLEKYIKPQTGDIVNSKGEVLGTHKGI 230

Query: 260 INYTIGQRRGLGVAMGEPLFVVYLDKNSSRVIVGPRESLEVHRIYLREINWLGDGLFEDA 319
            NYTIGQR+GLG++  EPL+V+ L+  +++V+VG R         ++++NW+   + +  
Sbjct: 231 HNYTIGQRKGLGISSSEPLYVLKLNLYNNQVVVGNRTEGFHSSCIIKDVNWI--SISKPD 288

Query: 320 VVDGFKCFVKIRS---SQDPVPVFVQRNDDGVYVDFEKSEVGVASGQACVFYTSDSNEAR 376
           +    K  V+ RS   S   +PV   R      + FE+S+ G+ +GQA V Y  D     
Sbjct: 289 ISMNVKVQVRYRSLAVSATIIPVENNRYK----LIFEQSQFGITAGQAAVLYDDDI---- 340

Query: 377 VLGGGII 383
           VL GGII
Sbjct: 341 VLAGGII 347


>gi|238019350|ref|ZP_04599776.1| hypothetical protein VEI